RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3267
         (105 letters)



>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898).  This
          domain is predominantly found in Maelstrom homolog
          proteins. It has no known function.
          Length = 69

 Score = 46.3 bits (110), Expect = 3e-08
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 11 AYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKS 47
          AY FFVQ  R E K++ P+     AEFSK C+E+WK+
Sbjct: 10 AYFFFVQTMRPELKREGPQVP-GVAEFSKLCSEKWKA 45


>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III
          members of the HMG-box superfamily of DNA-binding
          proteins. These proteins bind the minor groove of DNA
          in a non-sequence specific fashion and contain two or
          more tandem HMG boxes. Class II members include
          non-histone chromosomal proteins, HMG1 and HMG2, which
          bind to bent or distorted DNA such as four-way DNA
          junctions, synthetic DNA cruciforms, kinked
          cisplatin-modified DNA, DNA bulges, cross-overs in
          supercoiled DNA, and can cause looping of linear DNA.
          Class III members include nucleolar and mitochondrial
          transcription factors, UBF and mtTF1, which bind
          four-way DNA junctions.
          Length = 66

 Score = 43.0 bits (102), Expect = 6e-07
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 11 AYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKS 47
          AY  F Q  R + KK++P+ +V   E +K   E+WK 
Sbjct: 7  AYFLFSQEQRPKLKKENPDASV--TEVTKILGEKWKE 41


>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a
          variety of eukaryotic chromosomal proteins and
          transcription factors. HMGs bind to the minor groove of
          DNA and have been classified by DNA binding
          preferences. Two phylogenically distinct groups of
          Class I proteins bind DNA in a sequence specific
          fashion and contain a single HMG box. One group
          (SOX-TCF) includes transcription factors, TCF-1, -3,
          -4; and also SRY and LEF-1, which bind four-way DNA
          junctions and duplex DNA targets. The second group
          (MATA) includes fungal mating type gene products MC,
          MATA1 and Ste11. Class II and III proteins (HMGB-UBF)
          bind DNA in a non-sequence specific fashion and contain
          two or more tandem HMG boxes. Class II members include
          non-histone chromosomal proteins, HMG1 and HMG2, which
          bind to bent or distorted DNA such as four-way DNA
          junctions, synthetic DNA cruciforms, kinked
          cisplatin-modified DNA, DNA bulges, cross-overs in
          supercoiled DNA, and can cause looping of linear DNA.
          Class III members include nucleolar and mitochondrial
          transcription factors, UBF and mtTF1, which bind
          four-way DNA junctions.
          Length = 66

 Score = 39.1 bits (92), Expect = 2e-05
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%)

Query: 11 AYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKS 47
          AY  F Q  R E K ++P  +    E SK   E WKS
Sbjct: 7  AYFLFSQEHRAEVKAENPGLS--VGEISKILGEMWKS 41


>gnl|CDD|197700 smart00398, HMG, high mobility group. 
          Length = 70

 Score = 36.5 bits (85), Expect = 2e-04
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 11 AYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWK 46
          A+  F Q  R + K ++P  ++  AE SKK  ERWK
Sbjct: 8  AFMLFSQENRAKIKAENP--DLSNAEISKKLGERWK 41


>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box. 
          Length = 69

 Score = 31.0 bits (71), Expect = 0.021
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 11 AYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKS 47
          A+  F Q  R + K ++P      AE SK   E+WK+
Sbjct: 7  AFFLFSQEQRAKLKAENPGLKN--AEISKILGEKWKN 41


>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG
           domain [Chromatin structure and dynamics].
          Length = 211

 Score = 28.3 bits (63), Expect = 0.61
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 11  AYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKS 47
           AY  +    R+E +K++P+  + F E  K  +E+WK 
Sbjct: 77  AYFLYSAENRDEIRKENPK--LTFGEVGKLLSEKWKE 111


>gnl|CDD|238175 cd00283, GIY-YIG_Cterm, GIYX(10-11)YIG family of class I homing
          endonucleases C-terminus (GIY-YIG_Cterm). Homing
          endonucleases promote the mobility of intron or intein
          by recognizing and cleaving a homologous allele that
          lacks the sequence. They catalyze a double-strand break
          in the DNA near the insertion site of that element to
          facilitate homing at that site. Class I homing
          endonucleases are sorted into four families based on
          the presence of these motifs in their respective
          N-termini: LAGLIDADG, His-Cys box, HNH, and GIY-YIG.
          This CD contains several but not all members of the
          GIY-YIG family. The C-terminus of GIY-YIG is a
          DNA-binding domain which is separated from the
          N-terminus by a long, flexible linker. The DNA-binding
          domain consists of a minor-groove binding alpha-helix,
          and a helix-turn-helix.  Some also contain a zinc
          finger (i.e. I-TevI) which is not required for DNA
          binding or catalysis, but is a component of the linker
          and directs the catalytic domain to cleave the homing
          site at a fixed distance from the intron insertion
          site.
          Length = 113

 Score = 25.9 bits (57), Expect = 2.9
 Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 6/40 (15%)

Query: 35 AEFSKKCAE--RWKSSRI----VNPFVGRKFAPVFLTFLS 68
            F K  +E  + K S+      NP  G+K +      +S
Sbjct: 16 PMFGKTHSEETKAKISKNRSGENNPMFGKKHSDETKAKIS 55


>gnl|CDD|132851 cd07212, Pat_PNPLA9, Patatin-like phospholipase domain containing
           protein 9.  PNPLA9 is a Ca-independent phospholipase
           that catalyzes the hydrolysis of glycerophospholipids at
           the sn-2 position. PNPLA9 is also known as PLA2G6
           (phospholipase A2 group VI) or iPLA2beta. PLA2G6 is
           stimulated by ATP and inhibited by bromoenol lactone
           (BEL). In humans, PNPLA9 in expressed ubiquitously and
           is involved in signal transduction, cell proliferation,
           and apoptotic cell death. Mutations in human PLA2G6
           leads to infantile neuroaxonal dystrophy (INAD) and
           idiopathic neurodegeneration with brain iron
           accumulation (NBIA). This family includes PLA2G6 from
           Homo sapiens and Rattus norvegicus.
          Length = 312

 Score = 26.1 bits (58), Expect = 4.1
 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 1/41 (2%)

Query: 60  APVFLTFLSRMKDSILFCVNPVLAVGSRILEKFDECLDYFG 100
           AP +   + R  D  L   NP L   + I  ++++ L   G
Sbjct: 159 APTYFRPMGRFLDGGLIANNPTLDAMTEI-HEYNKTLKSKG 198


>gnl|CDD|198240 cd10377, SH2_STAT6, Src homology 2 (SH2) domain found in signal
          transducer and activator of transcription (STAT) 6
          proteins.  STAT6 mediate signals from the IL-4
          receptor. Unlike the other STAT proteins which bind an
          IFNgamma Activating Sequence (GAS),  STAT6 stands out
          as having a unique binding site preference. This site
          consists of a palindromic sequence separated by a 3 bp
          spacer (TTCNNNG-AA)(N3 site). STAT6 is able to bind the
          GAS site but only at a low affinity. STAT6 may be an
          important regulator of mitogenesis when cells respond
          normally to IL-4. There is speculation that the
          inappropriate activation of STAT6 is involved in
          uncontrolled cell growth in an oncogenic state.
          IFNgamma is a negative regulator of STAT6 dependent
          transcription of target genes. Bcl-6 is another
          negative regulator of STAT6 activity. Bcl-6 is a
          transcriptional repressor normally expressed in
          germinal center B cells and some T cells. IL-4
          signaling via STAT6 initially occurs unopposed, but is
          then dampened by a negative feedback mechanism through
          the IL-4/Stat6 dependent induction of SOCS1 expression.
          The IL-4 dependent aspect of Th2 differentiation
          requires the activation of STAT6. IL-4 signaling and
          STAT6 appear to play an important role in the immune
          response. Recently, it was shown that large scale
          chromatin remodeling of the IL-4 gene occurs as cells
          differentiate into Th2 effectors is STAT6 dependent.
          STAT proteins mediate the signaling of cytokines and a
          number of growth factors from the receptors of these
          extracellular signaling molecules to the cell nucleus.
          STATs are specifically phosphorylated by
          receptor-associated Janus kinases, receptor tyrosine
          kinases, or cytoplasmic tyrosine kinases. The
          phosphorylated STAT molecules dimerize by reciprocal
          binding of their SH2 domains to the phosphotyrosine
          residues. These dimeric STATs translocate into the
          nucleus, bind to specific DNA sequences, and regulate
          the transcription of their target genes.  However there
          are a number of unphosphorylated STATs that travel
          between the cytoplasm and nucleus and some STATs that
          exist as dimers in unstimulated cells that can exert
          biological functions independent of being activated.
          There are seven mammalian STAT family members which
          have been identified: STAT1, STAT2, STAT3, STAT4, STAT5
          (STAT5A and STAT5B), and STAT6. There are 6 conserved
          domains in STAT: N-terminal domain (NTD), coiled-coil
          domain (CCD), DNA-binding domain (DBD), alpha-helical
          linker domain (LD), SH2 domain, and transactivation
          domain (TAD).  NTD is involved in dimerization of
          unphosphorylated STATs monomers and for the
          tetramerization between STAT1, STAT3, STAT4 and STAT5
          on promoters with two or more tandem STAT binding
          sites.  It also plays a role in promoting interactions
          with transcriptional co-activators such as CREB binding
          protein (CBP)/p300, as well as being important for
          nuclear import and deactivation of STATs involving
          tyrosine de-phosphorylation. CCD interacts with other
          proteins, such as IFN regulatory protein 9 (IRF-9/p48)
          with STAT1 and c-JUN with STAT3 and is also thought to
          participate in the negative regulation of these
          proteins. Distinct genes are bound to STATs via their
          DBD domain. This domain is also involved in nuclear
          translocation of activated STAT1 and STAT3
          phosphorylated dimers upon cytokine stimulation.  LD
          links the DNA-binding and SH2  domains and is important
          for the transcriptional activation of STAT1 in response
          to IFN-gamma. It also plays a role in protein-protein
          interactions and has also been implicated in the
          constitutive nucleocytoplasmic shuttling of
          unphosphorylated STATs in resting cells.  The SH2
          domain is necessary for receptor association and
          tyrosine phosphodimer formation. Residues within this
          domain may be particularly important for some cellular
          functions mediated by the STATs as well as residues
          adjacent to this domain.  The TAD interacts with
          several proteins, namely minichromosome maintenance
          complex component 5 (MCM5), breast cancer 1 (BRCA1) and
          CBP/p300. TAD also contains a modulatory
          phosphorylation site that regulates STAT activity and
          is necessary for maximal transcription of a number of
          target genes. The conserved tyrosine residue present in
          the C-terminus is crucial for dimerization via
          interaction with the SH2 domain upon the interaction of
          the ligand with the receptor. STAT activation by
          tyrosine phosphorylation also determines nuclear import
          and retention, DNA binding to specific DNA elements in
          the promoters of responsive genes, and transcriptional
          activation of STAT dimers. In addition to the SH2
          domain there is a coiled-coil domain, a DNA binding
          domain, and a transactivation domain in the STAT
          proteins. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 129

 Score = 25.5 bits (56), Expect = 4.1
 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 36 EFSKKCAERWKSSRIVNPFVGRKFAPVFL------TFLSRMKDS 73
          + +K+C   + S R++  F+ +++    L      TFL R  DS
Sbjct: 7  DLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDS 50


>gnl|CDD|185308 PRK15410, PRK15410, DgsA anti-repressor MtfA; Provisional.
          Length = 260

 Score = 25.9 bits (57), Expect = 4.2
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 64 LTFLSRMKDSILFCVNPVLAVGSRILEKFDECLDY 98
          L  L   + ++LFC+ PVL +G   L+ F E L Y
Sbjct: 60 LDSLMSARIALLFCL-PVLELGIEWLDGFHEVLIY 93


>gnl|CDD|132916 cd07033, TPP_PYR_DXS_TK_like, Pyrimidine (PYR) binding domain of
          1-deoxy-D-xylulose-5-phosphate synthase (DXS),
          transketolase (TK), and related proteins.  Thiamine
          pyrophosphate (TPP) family, pyrimidine (PYR) binding
          domain of 1-deoxy-D-xylulose-5-phosphate synthase
          (DXS), transketolase (TK), and the beta subunits of the
          E1 component of the human pyruvate dehydrogenase
          complex (E1- PDHc), subfamily. The PYR domain is found
          in many key metabolic enzymes which use TPP (also known
          as thiamine diphosphate) as a cofactor. TPP binds in
          the cleft formed by a PYR domain and a PP domain. The
          PYR domain, binds the aminopyrimidine ring of TPP, the
          PP domain binds the diphosphate residue. A polar
          interaction between the conserved glutamate of the PYR
          domain and the N1' of the TPP aminopyrimidine ring is
          shared by most TPP-dependent enzymes, and participates
          in the activation of TPP. The PYR and PP domains have a
          common fold, but do not share strong sequence
          conservation. The PP domain is not included in this
          sub-family. Like many TPP-dependent enzymes DXS and TK
          are homodimers having a PYR and a PP domain on the same
          subunit. TK has two active sites per dimer which lie
          between PYR and PP domains of different subunits. For
          DXS each active site is located at the interface of a
          PYR and a PP domain from the same subunit. E1-PDHc is
          an alpha2beta2 dimer-of-heterodimers having two active
          sites but having the PYR and PP domains arranged on
          separate subunits, the PYR domains on the beta
          subunits, the PP domains on the alpha subunits. DXS is
          a regulatory enzyme of the mevalonate-independent
          pathway involved in terpenoid biosynthesis, it
          catalyzes a transketolase-type condensation of pyruvate
          with D-glyceraldehyde-3-phosphate to form
          1-deoxy-D-xylulose-5-phosphate (DXP) and carbon
          dioxide. TK catalyzes the transfer of a two-carbon unit
          from ketose phosphates to aldose phosphates. In
          heterotrophic organisms, TK provides a link between
          glycolysis and the pentose phosphate pathway and
          provides precursors for nucleotide, aromatic amino acid
          and vitamin biosynthesis. TK also plays a central role
          in the Calvin cycle in plants. PDHc catalyzes the
          irreversible oxidative decarboxylation of pyruvate to
          produce acetyl-CoA in the bridging step between
          glycolysis and the citric acid cycle. This subfamily
          includes the beta subunits of the E1 component of the
          acetoin dehydrogenase complex (ADC) and the branched
          chain alpha-keto acid dehydrogenase/2-oxoisovalerate
          dehydrogenase complex (BCADC). ADC participates in the
          breakdown of acetoin. BCADC catalyzes the oxidative
          decarboxylation of 4-methyl-2-oxopentanoate,
          3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate
          during the breakdown of branched chain amino acids.
          Length = 156

 Score = 25.5 bits (57), Expect = 5.3
 Identities = 13/39 (33%), Positives = 15/39 (38%), Gaps = 9/39 (23%)

Query: 53 PFVGRKFAPVFLTFLSRMKDSI--LFCVN--PVLAVGSR 87
          PFV       F  FL R  D I     +   PV  VG+ 
Sbjct: 65 PFVS-----TFSFFLQRAYDQIRHDVALQNLPVKFVGTH 98


>gnl|CDD|204067 pfam08793, 2C_adapt, 2-cysteine adaptor domain.  The
          virus-specific 2-cysteine adaptor domain is found fused
          to OTU/A20-like peptidases and S/T protein kinases. The
          domain associations of these proteins indicate that
          they might function as viral adaptors connecting the
          kinases and OTU/A20 peptidases to specific targets.
          Length = 37

 Score = 23.7 bits (52), Expect = 6.0
 Identities = 10/22 (45%), Positives = 12/22 (54%), Gaps = 1/22 (4%)

Query: 40 KCAERWKSSRIVNPFVGRKFAP 61
          KC E +  +  VNP  GRK  P
Sbjct: 2  KCEE-FLRNPTVNPITGRKIKP 22


>gnl|CDD|219457 pfam07534, TLD, TLD.  This domain is predicted to be an enzyme
          and is often found associated with pfam01476.
          Length = 136

 Score = 24.5 bits (54), Expect = 9.8
 Identities = 14/64 (21%), Positives = 23/64 (35%), Gaps = 11/64 (17%)

Query: 29 EENVVFAEFSKKCAERWKSSRIVNPFVGRK------FAPVFLTFLSRMKDSILFCVNPVL 82
          ++  VF  F    ++ WK+S     F G         +P F  +    K++  F     L
Sbjct: 32 DDGYVFGAF---LSQPWKNSG--KKFYGDGESFLFSLSPKFKVYKWTGKNNAYFNATSGL 86

Query: 83 AVGS 86
            G 
Sbjct: 87 GFGG 90


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.328    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0727    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,454,379
Number of extensions: 454390
Number of successful extensions: 475
Number of sequences better than 10.0: 1
Number of HSP's gapped: 469
Number of HSP's successfully gapped: 20
Length of query: 105
Length of database: 10,937,602
Length adjustment: 70
Effective length of query: 35
Effective length of database: 7,832,822
Effective search space: 274148770
Effective search space used: 274148770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (24.2 bits)