Diaphorina citri psyllid: psy3267

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MQNKLNMQGIAYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKSSRIVNPFVGRKFAPVFLTFLSRMKDSILFCVNPVLAVGSRILEKFDECLDYFGLRALA
ccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHcccccHHHHcccccc
*******QGIAYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKSSRIVNPFVGRKFAPVFLTFLSRMKDSILFCVNPVLAVGSRILEKFDECLDYFGLRALA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNKLNMQGIAYAFFVQVCREEHKKKHPEENVVFAEFSKKCAERWKSSRIVNPFVGRKFAPVFLTFLSRMKDSILFCVNPVLAVGSRILEKFDECLDYFGLRALA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
High mobility group protein B2 DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).confidentP17741
High mobility group protein B2 DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).confidentP26583
High mobility group protein B2 DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).confidentP40673

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033151 [BP]V(D)J recombinationprobableGO:0090304, GO:0034641, GO:0006807, GO:0007275, GO:0044699, GO:0006139, GO:0044260, GO:0071704, GO:1901360, GO:0002200, GO:0046483, GO:0032502, GO:0032501, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0002520, GO:0006310, GO:0002562, GO:0044707, GO:0048856, GO:0044237, GO:0043170, GO:0002376, GO:0006259, GO:0048731, GO:0016444
GO:0006288 [BP]base-excision repair, DNA ligationprobableGO:0051103, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0006266, GO:0044699, GO:0006284, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0050786 [MF]RAGE receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0032075 [BP]positive regulation of nuclease activityprobableGO:0032069, GO:0051336, GO:0080090, GO:0051345, GO:0065009, GO:0060255, GO:0050790, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0044093, GO:0008150, GO:0019222, GO:0050789, GO:0043085
GO:0031493 [MF]nucleosomal histone bindingprobableGO:0042393, GO:0031491, GO:0003674, GO:0005488, GO:0005515, GO:0003682
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0000793 [CC]condensed chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050918 [BP]positive chemotaxisprobableGO:0040011, GO:0006935, GO:0009605, GO:0050896, GO:0042330, GO:0008150, GO:0042221
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0060326 [BP]cell chemotaxisprobableGO:0040011, GO:0051716, GO:0006935, GO:0042330, GO:0048870, GO:0050896, GO:0009987, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0070887, GO:0042221, GO:0051179, GO:0016477, GO:0009605, GO:0044699
GO:0001938 [BP]positive regulation of endothelial cell proliferationprobableGO:0008284, GO:0042127, GO:0050678, GO:0050679, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0001936, GO:0050789, GO:0048522
GO:0045654 [BP]positive regulation of megakaryocyte differentiationprobableGO:0051094, GO:0050793, GO:0045652, GO:0065007, GO:0050794, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0045637, GO:0048522
GO:0043388 [BP]positive regulation of DNA bindingprobableGO:0051099, GO:0051098, GO:0051101, GO:0065007, GO:0044093, GO:0008150, GO:0065009
GO:0008301 [MF]DNA binding, bendingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042056 [MF]chemoattractant activityprobableGO:0003674
GO:0006265 [BP]DNA topological changeprobableGO:0071103, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0045648 [BP]positive regulation of erythrocyte differentiationprobableGO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003684 [MF]damaged DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YRQ, chain A
Confidence level:very confident
Coverage over the Query: 1-95
View the alignment between query and template
View the model in PyMOL