Query         psy3290
Match_columns 147
No_of_seqs    151 out of 215
Neff          5.3 
Searched_HMMs 46136
Date          Fri Aug 16 21:14:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3290.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3290hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2201|consensus              100.0 4.1E-40 8.9E-45  280.4  10.5  126    1-146    22-178 (371)
  2 PF03630 Fumble:  Fumble ;  Int 100.0 9.1E-37   2E-41  261.4  12.5  130    3-146     2-160 (341)
  3 PLN02920 pantothenate kinase 1 100.0 7.7E-30 1.7E-34  222.0  11.1  116    2-146    19-169 (398)
  4 PTZ00297 pantothenate kinase;  100.0 4.8E-29   1E-33  243.2  11.7  130    4-146  1042-1218(1452)
  5 PLN02902 pantothenate kinase    99.9 4.6E-28   1E-32  225.8   9.6  128    2-146    54-218 (876)
  6 COG5146 PanK Pantothenate kina  99.8 4.1E-21   9E-26  160.0   5.6  101    3-146    20-149 (342)
  7 TIGR00555 panK_eukar pantothen  99.8 2.1E-19 4.6E-24  150.8   7.5   72    2-117     1-97  (279)
  8 PRK13317 pantothenate kinase;   99.0 9.8E-10 2.1E-14   92.1   8.2   69    3-115     4-91  (277)
  9 smart00732 YqgFc Likely ribonu  91.3    0.21 4.4E-06   34.2   2.8   21    1-21      1-21  (99)
 10 TIGR03286 methan_mark_15 putat  90.3     1.2 2.6E-05   39.8   7.4   26   98-123   222-247 (404)
 11 PF05378 Hydant_A_N:  Hydantoin  87.2    0.49 1.1E-05   37.1   2.5   18    4-21      2-19  (176)
 12 PRK13318 pantothenate kinase;   86.3    0.62 1.3E-05   38.1   2.7   17    3-19      2-18  (258)
 13 PRK13321 pantothenate kinase;   85.6    0.75 1.6E-05   37.8   2.8   18    3-20      2-19  (256)
 14 PRK14101 bifunctional glucokin  79.7     1.1 2.3E-05   41.5   1.7   96    2-111    19-126 (638)
 15 PRK00292 glk glucokinase; Prov  79.5     1.6 3.6E-05   36.3   2.7   26   86-111    85-111 (316)
 16 PRK12408 glucokinase; Provisio  74.8     1.7 3.6E-05   37.1   1.5   26   86-111   103-129 (336)
 17 PTZ00288 glucokinase 1; Provis  73.1     7.4 0.00016   34.6   5.2   19    3-21     28-46  (405)
 18 PF01869 BcrAD_BadFG:  BadF/Bad  68.0     4.3 9.3E-05   32.9   2.4   18    4-21      1-18  (271)
 19 TIGR00749 glk glucokinase, pro  67.8     4.2 9.1E-05   34.1   2.3   23   86-108    84-107 (316)
 20 PF04260 DUF436:  Protein of un  64.2     3.7 8.1E-05   32.8   1.3   11    3-13    122-132 (172)
 21 PF00370 FGGY_N:  FGGY family o  63.4       6 0.00013   31.5   2.4   18    3-20      2-19  (245)
 22 PF11104 PilM_2:  Type IV pilus  61.4      99  0.0022   26.1  11.2  108    5-117     1-175 (340)
 23 TIGR01314 gntK_FGGY gluconate   59.2     7.8 0.00017   34.6   2.5   18    3-20      2-19  (505)
 24 PF00349 Hexokinase_1:  Hexokin  58.0     9.8 0.00021   30.7   2.7   20    3-22     65-84  (206)
 25 TIGR00241 CoA_E_activ CoA-subs  57.1     7.9 0.00017   31.3   2.1   17    3-19      2-18  (248)
 26 COG0145 HyuA N-methylhydantoin  56.6     9.5 0.00021   36.3   2.7   20    3-22      4-23  (674)
 27 PLN02666 5-oxoprolinase         55.7     9.1  0.0002   38.9   2.6   19    3-21     11-29  (1275)
 28 TIGR01440 conserved hypothetic  55.2     4.3 9.4E-05   32.5   0.2   13    3-15    122-134 (172)
 29 PRK13320 pantothenate kinase;   55.0      11 0.00024   30.9   2.7   18    3-20      4-21  (244)
 30 TIGR02259 benz_CoA_red_A benzo  54.6     7.5 0.00016   35.2   1.7   18    3-20      4-21  (432)
 31 PRK13331 pantothenate kinase;   52.4      14  0.0003   30.9   2.8   20    1-20      7-26  (251)
 32 COG3569 Topoisomerase IB [DNA   51.7      12 0.00026   33.0   2.3   33   40-72    155-187 (354)
 33 TIGR01315 5C_CHO_kinase FGGY-f  50.6      13 0.00029   33.6   2.7   18    3-20      2-19  (541)
 34 PRK13690 hypothetical protein;  50.0     5.8 0.00012   32.1   0.2   12    3-14    129-140 (184)
 35 COG1940 NagC Transcriptional r  50.0      15 0.00032   30.3   2.7   32   82-113    96-128 (314)
 36 TIGR01311 glycerol_kin glycero  49.5      14  0.0003   32.9   2.5   18    3-20      3-20  (493)
 37 PF14450 FtsA:  Cell division p  47.2      19 0.00042   26.0   2.6   17    4-20      2-18  (120)
 38 PRK05082 N-acetylmannosamine k  45.7      18 0.00039   29.6   2.4   26   86-111    91-116 (291)
 39 PRK13927 rod shape-determining  45.0      18 0.00038   30.2   2.4   16    3-19      7-22  (334)
 40 TIGR00671 baf pantothenate kin  44.3      21 0.00046   29.3   2.7   18    3-20      1-18  (243)
 41 PRK00047 glpK glycerol kinase;  43.8      19 0.00041   32.1   2.5   18    3-20      7-24  (498)
 42 cd01395 HMT_MBD Methyl-CpG bin  43.0      27 0.00058   23.2   2.5   33    6-45     17-49  (60)
 43 PHA03101 DNA topoisomerase typ  41.9      26 0.00056   30.5   2.9   31   40-70    136-166 (314)
 44 PRK13311 N-acetyl-D-glucosamin  41.6      24 0.00051   28.5   2.5   27   86-112    91-117 (256)
 45 PRK13930 rod shape-determining  41.2      20 0.00043   29.8   2.1   16    3-18     10-25  (335)
 46 TIGR03192 benz_CoA_bzdQ benzoy  40.3      22 0.00047   30.6   2.2   17    3-19     34-50  (293)
 47 cd00659 Topo_IB_C DNA topoisom  38.6      25 0.00053   28.8   2.2   30   40-69     61-90  (218)
 48 TIGR02261 benz_CoA_red_D benzo  38.5      21 0.00045   30.2   1.8   17    3-19      3-19  (262)
 49 PF03309 Pan_kinase:  Type III   36.4      37 0.00081   26.7   2.9   18    3-20      1-18  (206)
 50 smart00842 FtsA Cell division   35.9      29 0.00063   26.7   2.2   17    4-20      2-18  (187)
 51 COG1070 XylB Sugar (pentulose   35.5      32 0.00069   30.9   2.6   19    3-21      6-24  (502)
 52 TIGR03123 one_C_unchar_1 proba  34.9      24 0.00053   30.5   1.7   16    4-19    131-146 (318)
 53 COG1521 Pantothenate kinase ty  34.9      35 0.00075   28.7   2.6   18    2-19      1-18  (251)
 54 PRK15027 xylulokinase; Provisi  34.7      33 0.00073   30.4   2.6   18    3-20      2-19  (484)
 55 PTZ00009 heat shock 70 kDa pro  34.2      35 0.00075   31.9   2.7   20    1-20      4-23  (653)
 56 TIGR02529 EutJ ethanolamine ut  34.1      19  0.0004   29.3   0.8   18    5-22      1-18  (239)
 57 PF00012 HSP70:  Hsp70 protein;  33.6      39 0.00085   30.3   2.9   18    4-21      2-19  (602)
 58 PF01968 Hydantoinase_A:  Hydan  33.4      31 0.00068   28.9   2.1   18    3-20     79-96  (290)
 59 PRK13324 pantothenate kinase;   33.4      40 0.00088   28.1   2.7   18    3-20      2-19  (258)
 60 PRK13310 N-acetyl-D-glucosamin  33.2      31 0.00068   28.3   2.1   26   86-111    91-116 (303)
 61 PF06577 DUF1134:  Protein of u  31.9      37 0.00079   27.0   2.1   19    2-20     76-97  (160)
 62 PRK09698 D-allose kinase; Prov  31.6      42 0.00091   27.5   2.5   22   86-107    99-120 (302)
 63 TIGR02350 prok_dnaK chaperone   31.3      43 0.00092   30.6   2.7   19    2-20      1-19  (595)
 64 PF02685 Glucokinase:  Glucokin  31.1      51  0.0011   28.3   3.0   27   86-112    85-112 (316)
 65 PRK09557 fructokinase; Reviewe  30.1      46 0.00099   27.3   2.5   26   86-111    91-116 (301)
 66 PLN02295 glycerol kinase        30.0      43 0.00094   30.0   2.5   17    4-20      3-19  (512)
 67 PF06706 CTV_P6:  Citrus triste  29.7      26 0.00055   22.4   0.7    9  101-109     1-9   (51)
 68 PRK10331 L-fuculokinase; Provi  29.5      45 0.00098   29.4   2.5   18    3-20      4-21  (470)
 69 PF02541 Ppx-GppA:  Ppx/GppA ph  29.5      55  0.0012   26.8   2.9   19    2-20    113-131 (285)
 70 PRK00290 dnaK molecular chaper  29.2      47   0.001   30.7   2.7   19    2-20      3-21  (627)
 71 PHA02744 hypothetical protein;  28.4      50  0.0011   23.7   2.2   16    5-20     47-62  (88)
 72 CHL00094 dnaK heat shock prote  28.4      51  0.0011   30.6   2.7   19    2-20      3-21  (621)
 73 PTZ00294 glycerol kinase-like   28.4      48   0.001   29.6   2.5   18    3-20      4-21  (504)
 74 TIGR02628 fuculo_kin_coli L-fu  28.1      50  0.0011   29.2   2.6   18    4-21      4-21  (465)
 75 PRK10939 autoinducer-2 (AI-2)   28.0      49  0.0011   29.6   2.5   19    3-21      5-23  (520)
 76 PRK04123 ribulokinase; Provisi  27.9      52  0.0011   29.7   2.7   18    3-20      5-22  (548)
 77 PRK13322 pantothenate kinase;   27.5      54  0.0012   26.9   2.5   18    3-20      2-19  (246)
 78 PRK13326 pantothenate kinase;   26.7      63  0.0014   27.0   2.8   18    3-20      8-25  (262)
 79 PRK15080 ethanolamine utilizat  26.1      50  0.0011   27.2   2.1   19    3-21     26-44  (267)
 80 TIGR00744 ROK_glcA_fam ROK fam  26.0      57  0.0012   26.8   2.4   27   86-112    92-118 (318)
 81 PF06277 EutA:  Ethanolamine ut  25.6      48   0.001   30.5   2.0   17    3-19      5-21  (473)
 82 COG0837 Glk Glucokinase [Carbo  24.8      87  0.0019   27.4   3.4   44    2-45      7-55  (320)
 83 PF06406 StbA:  StbA protein;    24.5      70  0.0015   27.0   2.7   18    4-21      3-20  (318)
 84 smart00391 MBD Methyl-CpG bind  24.1      55  0.0012   22.4   1.7   26   15-47     30-55  (77)
 85 TIGR01174 ftsA cell division p  24.0      58  0.0012   27.8   2.1   17    4-20      3-19  (371)
 86 PF00480 ROK:  ROK family;  Int  24.0      75  0.0016   23.6   2.6   28   86-113    86-113 (179)
 87 cd00122 MBD MeCP2, MBD1, MBD2,  22.9      62  0.0013   20.9   1.7   25   15-46     27-51  (62)
 88 COG1548 Predicted transcriptio  22.8      35 0.00077   29.6   0.6   17    1-17      3-19  (330)
 89 TIGR01234 L-ribulokinase L-rib  22.7      75  0.0016   28.7   2.7   17    3-19      3-19  (536)
 90 PRK10719 eutA reactivating fac  22.5      73  0.0016   29.4   2.5   17    3-19      8-24  (475)
 91 COG0145 HyuA N-methylhydantoin  21.5      55  0.0012   31.2   1.7   17    3-19    280-296 (674)
 92 PTZ00107 hexokinase; Provision  21.3      83  0.0018   28.6   2.7   20    3-22     76-95  (464)
 93 COG1799 Uncharacterized protei  21.3 1.9E+02  0.0042   23.0   4.4   51    8-85     69-119 (167)
 94 TIGR01656 Histidinol-ppas hist  20.6      60  0.0013   23.8   1.4   13    2-14      1-13  (147)
 95 TIGR03123 one_C_unchar_1 proba  20.2      61  0.0013   28.1   1.5   17    4-20      1-17  (318)

No 1  
>KOG2201|consensus
Probab=100.00  E-value=4.1e-40  Score=280.41  Aligned_cols=126  Identities=40%  Similarity=0.740  Sum_probs=117.1

Q ss_pred             CCceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHH
Q psy3290           1 MPWFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVD   80 (147)
Q Consensus         1 ~p~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~   80 (147)
                      +|||||||||||+|||||+|.+++++++++++          ++|.+||+++++|         .||||++|+|.+ |+.
T Consensus        22 ~~~~~~DigGtl~KlvY~s~~~~~~~~~~~~~----------~~n~~~~~~~~~~---------~rl~~~~~e~~~-~~~   81 (371)
T KOG2201|consen   22 ISHFAMDIGGTLVKLVYFSPVDISPEEEESEV----------ILNGAYGKTGYRD---------GRLHFINFETFK-IDG   81 (371)
T ss_pred             CceEEEecCCcEEEEEEEecCCCCcchhhhhc----------ccccccccccccc---------cEEEEEEeeecC-ccc
Confidence            58999999999999999999998887654432          6899999999887         589999999999 999


Q ss_pred             HHHHH-------------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCCceEEeeCCCCcc
Q psy3290          81 FIRVI-------------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPLECYYWANSTVED  129 (147)
Q Consensus        81 fi~~~-------------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~E~ft~~~~~~~~  129 (147)
                      ||+||                               +|+++|+|+++|+|||+|||+|+||+++++|+|||||+++.+++
T Consensus        82 ~L~Fi~~~~~~~~~k~~~~~~~~i~aTGGGA~Kf~d~~~~~l~v~l~k~Dem~~LI~G~~f~l~~i~~E~fty~~~~~~~  161 (371)
T KOG2201|consen   82 CLNFIRFNITDHPVKNFSKLTTVICATGGGAYKFEDLFREILDVKLDKEDEMDCLIKGLNFLLSNIPAECFTYENDEDEE  161 (371)
T ss_pred             hhHHhhcchhhccccccccceeEEEEeCCcceeHHHHHHHHhCceEeehhHHHHHHhhhHHHHhcCccceEEEecCCCcc
Confidence            99999                               88999999999999999999999999999999999999999999


Q ss_pred             ceeeecCCCCCCccccC
Q psy3290         130 KCTKVQYDFTNPYPFIY  146 (147)
Q Consensus       130 ~~~~~~~~~~~~YPyLL  146 (147)
                      .+++.+++.++||||||
T Consensus       162 ~~~~~~~~~d~~yPyLL  178 (371)
T KOG2201|consen  162 VEFQTNFCLDSPYPYLL  178 (371)
T ss_pred             eecccCCccCCCCceEE
Confidence            99999999999999998


No 2  
>PF03630 Fumble:  Fumble ;  InterPro: IPR004567 Pantothenate kinase (PanK or CoaA) catalyses the first step of the universal five step coenzyme A (CoA) biosynthesis pathway. CoA is a ubiquitous and essential cofactor in all living organsims. Pantothenate kinase catalyses the first and rate limiting step in the CoA biosynthetic pathway, which involves transferring a phosphoryl group from ATP to pantothenate, also known as vitamin B5. Three distinct types of pantothenate kinase enzymes have been identified: type I PanK enzymes are typified by the E. coli CoaA protein, type II enzymes are primarily found in eukaryotic organisms whilst type III enzymes have a wider phylogenic distribution and are not feedback inhibited by CoA []. This family describes the type II (primarily eukaryotic) form of pantothenate kinase PanK, characterised from the fungus Emericella nidulans and with similar forms known in several other eukaryotes. It also includes forms from several Gram-positive bacteria suggested to have originated from the eukaryotic form by lateral transfer. It differs in a number of biochemical properties (such as inhibition by acetyl-CoA) from type I PanK enzymes and shows little sequence similarity [, ].; GO: 0004594 pantothenate kinase activity, 0005524 ATP binding, 0015937 coenzyme A biosynthetic process; PDB: 3SMP_B 2I7N_B 2EWS_B 2I7P_C 3SMS_A 3MK6_D.
Probab=100.00  E-value=9.1e-37  Score=261.44  Aligned_cols=130  Identities=32%  Similarity=0.607  Sum_probs=101.3

Q ss_pred             ceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHHH
Q psy3290           3 WFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDFI   82 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~fi   82 (147)
                      ||||||||||+|||||+|.+.+.++.+++..+++++++...             ..+......+|||++|||++ |++||
T Consensus         2 ~faiDIGGTL~KlVYfs~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~g~L~Fi~FeT~~-ie~~i   67 (341)
T PF03630_consen    2 HFAIDIGGTLVKLVYFSPVDSSPDNQDKEDDSLRSLRREMH-------------EIESKERGGRLHFIKFETKN-IEECI   67 (341)
T ss_dssp             EEEEEE-SSEEEEEEEEESS--CHHHHHCHHHHHHHHH-EE-------------EEEETTEEEEEEEEEEEGGG-HHHHH
T ss_pred             eEEEEcCCceEEEEEEeecCCCcccccccccchhhhhhhhc-------------cccccCcCCEEEEEEechhh-HHHHH
Confidence            99999999999999999998766554445555555554210             11222334599999999999 99999


Q ss_pred             HHH-----------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCCceEEeeCCCCccceee
Q psy3290          83 RVI-----------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPLECYYWANSTVEDKCTK  133 (147)
Q Consensus        83 ~~~-----------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~E~ft~~~~~~~~~~~~  133 (147)
                      +|+                             +|++++|++++|+|||+|||+|++|+++++|+|||+|+++.++++.++
T Consensus        68 ~fi~~~~~~~~~~~~~~~~I~aTGGGA~Ky~~~~~~~Lgv~v~K~DEm~clI~Gl~fLl~~i~~E~f~y~~~~~~~~~~~  147 (341)
T PF03630_consen   68 DFIKENILEHKGISQKITKICATGGGAFKYADLFKEKLGVEVQKEDEMECLIKGLNFLLKNIPDEVFTYDNDEDPEKFEK  147 (341)
T ss_dssp             HHHHHS--S-TTGGGCSSEEEEESTTHHHHHCHHHCTSTSEEEE--HHHHHHHHHHHHHHTTB-SEEEEETTTSTTT-EE
T ss_pred             HHHHHhhhhccccCccceEEEEeCCcHHHHHHHHHHhcCCCeeEehHHHHHHhhHHHHHhcCCcceEEEecCCCcceecc
Confidence            999                             688899999999999999999999999999999999999888887777


Q ss_pred             ecCCCCCCccccC
Q psy3290         134 VQYDFTNPYPFIY  146 (147)
Q Consensus       134 ~~~~~~~~YPyLL  146 (147)
                      ++.+.+++|||||
T Consensus       148 ~~~~~~~~~Pyll  160 (341)
T PF03630_consen  148 VPIDNSDIYPYLL  160 (341)
T ss_dssp             EEETTSS-SSEEE
T ss_pred             cccCCCCCCcEEE
Confidence            7888899999997


No 3  
>PLN02920 pantothenate kinase 1
Probab=99.96  E-value=7.7e-30  Score=221.95  Aligned_cols=116  Identities=24%  Similarity=0.437  Sum_probs=92.0

Q ss_pred             CceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHH
Q psy3290           2 PWFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDF   81 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~f   81 (147)
                      .||||||||||+|||||++........+.               ..+.         .......||||++|||.+ |++|
T Consensus        19 ~~~a~Diggsl~Klvy~~~~~~~~~~~~~---------------~~~~---------~~~~~~g~l~F~~F~T~~-i~~~   73 (398)
T PLN02920         19 SHLALDIGGSLIKLVYFSRNSGDSEDPRN---------------DSSV---------KSDGVNGRLHFAKFETRK-INDC   73 (398)
T ss_pred             eEEEEEcCCceEEEEEEeccCCccccccc---------------cccc---------cccCCCceEEEEEecccC-HHHH
Confidence            69999999999999999987643322110               0000         001223599999999999 9999


Q ss_pred             HHHH-----------------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCCceEEeeCCC
Q psy3290          82 IRVI-----------------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPLECYYWANST  126 (147)
Q Consensus        82 i~~~-----------------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~E~ft~~~~~  126 (147)
                      |+|+                                   .|++++|++++|+|||+|||+|++|+++++|+|||||.++.
T Consensus        74 i~fl~~~~~~~~~~~~~~~~~~~~~~i~~TGGGA~k~~~~~~~~~~i~~~k~DEm~~li~Gl~fLl~~~~~e~f~y~~~~  153 (398)
T PLN02920         74 LEFISSNKLHHGGFQHHENPTHDKNFIKATGGGAYKFADLFKEKLGISLDKEDEMDCLVTGANFLLKAVHHEAFTYLDGQ  153 (398)
T ss_pred             HHHHHhccccccccccccccCCCceEEEEECCcHHHHHHHHHhhhCCCceeecHHHHHHHHHHHHHhhCCcceeEeccCc
Confidence            9998                                   56788999999999999999999999999999999998743


Q ss_pred             CccceeeecCCCCCCccccC
Q psy3290         127 VEDKCTKVQYDFTNPYPFIY  146 (147)
Q Consensus       127 ~~~~~~~~~~~~~~~YPyLL  146 (147)
                      .    ++++.+.+++|||||
T Consensus       154 ~----~~~~~~~~~lyPyLL  169 (398)
T PLN02920        154 K----EFVQIDHNDLYPYLL  169 (398)
T ss_pred             c----cccccCccccCceEE
Confidence            2    345667778999997


No 4  
>PTZ00297 pantothenate kinase; Provisional
Probab=99.96  E-value=4.8e-29  Score=243.23  Aligned_cols=130  Identities=22%  Similarity=0.324  Sum_probs=107.8

Q ss_pred             eEEeecCceeEEEEeeeCC--CCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeec-------------ceeeEE
Q psy3290           4 FGMDIGGTLSKLVYFEPKD--ITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLY-------------TTLTLL   68 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~~~--~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~-------------~t~~Lh   68 (147)
                      ++||||||+|||||++|+.  ..++...+|+++|+            ++.|+|+.|+..+.             ..++||
T Consensus      1042 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~ 1109 (1452)
T PTZ00297       1042 VTIDIGGTFAKIAYVQPPGGFAFPTYIVHEASSLS------------EKLGLRTFHFFADAEAAESELRTRPHSRVGTLR 1109 (1452)
T ss_pred             eEEecCceeEEEEEEeCCCCCCCcchhhhhhhhhh------------hccCccccccccChHHhhhhhccCCCCCceEEE
Confidence            6899999999999999983  23333346766664            55799998887764             335999


Q ss_pred             EEEecchhhHHHHHHHH-----------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCCce
Q psy3290          69 CIELISDDTVVDFIRVI-----------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPLEC  119 (147)
Q Consensus        69 FikFeT~~~i~~fi~~~-----------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~E~  119 (147)
                      |+||||.+ |++||+|+                             +|++.+|+++.|+|||+|||+|++|+++++|+|+
T Consensus      1110 f~~f~t~~-i~~~~~~l~~~~~~~~~~~~~~~~i~~TGGGA~k~~~~~~~~~~~~~~~~dEm~~li~G~~~l~~~~~~~~ 1188 (1452)
T PTZ00297       1110 FAKIPSKQ-IPDFADYLAGSHAINYYKPQYRTKVRATGGGAFKYASVAKKVLGINFSVMREMDAVVKGLNLVIRVAPESI 1188 (1452)
T ss_pred             EEEecccC-HHHHHHHHHhhhhhcccCcCCceEEEEeCCcHHHHHHHHHHHhCCCcceecHHHHHHHHHHHHHhcCCceE
Confidence            99999999 99999999                             5688899999999999999999999999999999


Q ss_pred             EEeeCCCC---ccceeeecCCCCCCccccC
Q psy3290         120 YYWANSTV---EDKCTKVQYDFTNPYPFIY  146 (147)
Q Consensus       120 ft~~~~~~---~~~~~~~~~~~~~~YPyLL  146 (147)
                      |||+...+   ++++++.+.+.+++|||||
T Consensus      1189 f~~~~~~~~~~~~~~~~~~~~~~~~yp~ll 1218 (1452)
T PTZ00297       1189 FTVDPSTGVHHPHQLVSPPGDGFSPFPCLL 1218 (1452)
T ss_pred             EEeccccccccccccccCccccCCCCceEE
Confidence            99987432   3456666677789999998


No 5  
>PLN02902 pantothenate kinase
Probab=99.95  E-value=4.6e-28  Score=225.80  Aligned_cols=128  Identities=23%  Similarity=0.408  Sum_probs=93.9

Q ss_pred             CceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHH
Q psy3290           2 PWFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDF   81 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~f   81 (147)
                      .|+|+||||||+|||||++......+..... +.+..++.-        .+.|.   ..+....|||||+|||.+ |++|
T Consensus        54 ~h~~~digg~l~klvy~s~~~~~~~~~~~~~-~~~~~~~~~--------~~~~~---~~~~~~grl~F~~fet~~-~~~~  120 (876)
T PLN02902         54 SHLALDIGGSLIKLVYFSRHEDRSTDDKRKR-TIKERLGIT--------NGNRR---SYPILGGRLHFVKFETSK-INEC  120 (876)
T ss_pred             eeEEEecCCceEEEEEEeccCCccccccccc-ccccccccc--------ccccc---cccCCCceEEEEEcCccc-HHHH
Confidence            5999999999999999999754322211000 000000000        01111   112234599999999999 9999


Q ss_pred             HHHH-------------------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCCceEEeeC
Q psy3290          82 IRVI-------------------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPLECYYWAN  124 (147)
Q Consensus        82 i~~~-------------------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~E~ft~~~  124 (147)
                      |+|+                                     .|++++|++++|+|||+|||+|++|+++++|+|||||.+
T Consensus       121 ~~f~~~~~~~~~~~~~~~~~~~~~~~~~i~aTGGGA~K~~~~~~~~l~~~l~k~DEm~~li~Gl~fLl~~i~~e~f~~~~  200 (876)
T PLN02902        121 LDFISSKQLHRGGIHSWLSKAPPNGNGVIKATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHME  200 (876)
T ss_pred             HHHHHHhcccccchhhhccccCCCCceEEEEeCCccccHHHHHHHHhCCCeeeecHHHHHHHHHHHHHhhCcchheeecc
Confidence            9999                                     678999999999999999999999999999999999975


Q ss_pred             CCCccceeeecCCCCCCccccC
Q psy3290         125 STVEDKCTKVQYDFTNPYPFIY  146 (147)
Q Consensus       125 ~~~~~~~~~~~~~~~~~YPyLL  146 (147)
                      ..    .++++.+..++|||||
T Consensus       201 ~~----~~~~~~~~~~lyPyLL  218 (876)
T PLN02902        201 GE----KEFVQIDQNDLFPYLL  218 (876)
T ss_pred             cc----ccccccCccCCCceEE
Confidence            32    3556677789999997


No 6  
>COG5146 PanK Pantothenate kinase, acetyl-CoA regulated [Coenzyme metabolism]
Probab=99.83  E-value=4.1e-21  Score=160.04  Aligned_cols=101  Identities=22%  Similarity=0.354  Sum_probs=81.1

Q ss_pred             ceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHHH
Q psy3290           3 WFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDFI   82 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~fi   82 (147)
                      ++||||||||||+|| ||..+                                         -||.|..+||.+ |++|+
T Consensus        20 ~vaiDiGGtLaKvv~-sp~~s-----------------------------------------nrl~F~t~eT~k-Id~~v   56 (342)
T COG5146          20 KVAIDIGGTLAKVVQ-SPSQS-----------------------------------------NRLTFKTEETKK-IDQVV   56 (342)
T ss_pred             EEEEecCceeeeeee-Ccccc-----------------------------------------cceeeehHhhhh-HHHHH
Confidence            579999999999999 43210                                         178999999999 99999


Q ss_pred             HHH-----------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCCceEEeeCCCCccceee
Q psy3290          83 RVI-----------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPLECYYWANSTVEDKCTK  133 (147)
Q Consensus        83 ~~~-----------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~E~ft~~~~~~~~~~~~  133 (147)
                      +++                             ...+.+.+++.+++||+|||.||||+..+||+|+|++.+.+..-..+-
T Consensus        57 e~l~~li~~h~k~C~~~~~liatGGga~kfyd~m~~~~~ikv~r~~eme~li~gl~~fv~~IP~evFv~~d~~~e~~~~~  136 (342)
T COG5146          57 EWLNNLIQQHEKLCLTKITLIATGGGAYKFYDRMSKQLDIKVIRENEMEILINGLNYFVINIPAEVFVEFDAASEGLGIL  136 (342)
T ss_pred             HHHHHHHHHHHhhhhheeeEEecCCcchhhHHHHhhhccceeeecchHHHHHhcccceeeeccHHHeeeeccccchhhhh
Confidence            998                             345789999999999999999999999999999999998543211111


Q ss_pred             ecCCCCCCccccC
Q psy3290         134 VQYDFTNPYPFIY  146 (147)
Q Consensus       134 ~~~~~~~~YPyLL  146 (147)
                      ..-...++|||||
T Consensus       137 ~~~~~h~lypyil  149 (342)
T COG5146         137 LKEQGHDLYPYIL  149 (342)
T ss_pred             hhhccccccceee
Confidence            1223367999997


No 7  
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type. This model describes a eukaryotic form of pantothenate kinase, characterized from the fungus Aspergillus nidulans and with similar forms known in several other eukaryotes. It also includes forms from several Gram-positive bacteria suggested to have originated from the eukaryotic form by lateral transfer. It differs in a number of biochemical properties (such as inhibition by acetyl-CoA) from most bacterial CoaA and lacks sequence similarity. This enzyme is the key regulatory step in the biosynthesis of coenzyme A (CoA).
Probab=99.79  E-value=2.1e-19  Score=150.84  Aligned_cols=72  Identities=33%  Similarity=0.548  Sum_probs=63.7

Q ss_pred             CceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHH
Q psy3290           2 PWFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDF   81 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~f   81 (147)
                      +|+|||||||++|+||++..                                           .++||++|||.+ +++|
T Consensus         1 ~~iGiDiGgT~~Kiv~~~~~-------------------------------------------~~~~f~~~~~~~-~~~~   36 (279)
T TIGR00555         1 SRIGIDIGGTLIKVVYEEPK-------------------------------------------GRRKFKTFETTN-IDKF   36 (279)
T ss_pred             CeEEEEeCcceEEEEEEcCC-------------------------------------------CcEEEEEeeccc-HHHH
Confidence            58999999999999998631                                           269999999999 9999


Q ss_pred             HHHH-------------------------HHHHHcCCceeeechhhhhhhhhhhhhhhCCC
Q psy3290          82 IRVI-------------------------MRIQEVNMKLEKCDELDCLIRGMLFIEANYPL  117 (147)
Q Consensus        82 i~~~-------------------------~f~~~lgv~l~k~DEMecLI~Gl~fll~~i~~  117 (147)
                      ++|+                         .|+..+|++++|+|||+|+++|++|++.+.|+
T Consensus        37 ~~~l~~~~~~~~~~~~i~~TGgGa~k~~~~~~~~~~v~~~k~dE~~a~~~g~~~ll~~~~~   97 (279)
T TIGR00555        37 IEWLKNQIHRHSRITTLCATGGGAFKFAELIYESAGIQLHKFDEFDALIQGLNYLLKEEPK   97 (279)
T ss_pred             HHHHHHHHHhhcCceEEEEECCcHHHHHHHhccccCCcccchhHHHHHHHHHHHHhhcccC
Confidence            9999                         45666789999999999999999999987765


No 8  
>PRK13317 pantothenate kinase; Provisional
Probab=99.02  E-value=9.8e-10  Score=92.13  Aligned_cols=69  Identities=23%  Similarity=0.289  Sum_probs=55.4

Q ss_pred             ceEEeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHHH
Q psy3290           3 WFGMDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDFI   82 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~fi   82 (147)
                      ++|||||||++|+||+....                                           +++|.+|.+.. .+.++
T Consensus         4 ~iGIDiGstt~K~v~~~~~~-------------------------------------------~~~~~~~~~~~-~~~~~   39 (277)
T PRK13317          4 KIGIDAGGTLTKIVYLEEKK-------------------------------------------QRTFKTEYSAE-GKKVI   39 (277)
T ss_pred             eEEEEeCcccEEEEEEcCCC-------------------------------------------eEEEEeeccHH-HHHHH
Confidence            58999999999999998421                                           35677777777 77777


Q ss_pred             HHH-----------------HHHH--HcCCceeeechhhhhhhhhhhhhhhC
Q psy3290          83 RVI-----------------MRIQ--EVNMKLEKCDELDCLIRGMLFIEANY  115 (147)
Q Consensus        83 ~~~-----------------~f~~--~lgv~l~k~DEMecLI~Gl~fll~~i  115 (147)
                      +++                 .+.+  .+|+++.|.|||+|+++|++|++++.
T Consensus        40 ~~l~~~~~~~~i~~TG~g~~~~~~~~~~~~~~~~v~E~~a~~~g~~~l~~~~   91 (277)
T PRK13317         40 DWLINLQDIEKICLTGGKAGYLQQLLNYGYPIAEFVEFEATGLGVRYLLKEE   91 (277)
T ss_pred             HHhhccCCceEEEEECcchhhhhHHHhcCCCeeeeHHHHHHHHHHHHHHHhc
Confidence            775                 4444  48999999999999999999998543


No 9  
>smart00732 YqgFc Likely ribonuclease with RNase H fold. YqgF proteins are likely to function as an alternative to RuvC in most bacteria, and could be the principal holliday junction resolvases in low-GC Gram-positive bacteria. In Spt6p orthologues, the catalytic residues are substituted indicating that they lack enzymatic functions.
Probab=91.31  E-value=0.21  Score=34.25  Aligned_cols=21  Identities=14%  Similarity=0.164  Sum_probs=17.9

Q ss_pred             CCceEEeecCceeEEEEeeeC
Q psy3290           1 MPWFGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         1 ~p~faiDIGGTL~KlVYf~~~   21 (147)
                      |-.+|+|||||-+|++...+.
T Consensus         1 ~~ilgiD~Ggt~i~~a~~d~~   21 (99)
T smart00732        1 KRVLGLDPGRKGIGVAVVDET   21 (99)
T ss_pred             CcEEEEccCCCeEEEEEECCC
Confidence            346899999999999999764


No 10 
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. Related proteins include the BadF/BadG/BcrA/BcrD ATPase family (pfam01869), which includes an activator for (R)-2-hydroxyglutaryl-CoA dehydratase.
Probab=90.35  E-value=1.2  Score=39.82  Aligned_cols=26  Identities=12%  Similarity=0.133  Sum_probs=19.4

Q ss_pred             echhhhhhhhhhhhhhhCCCceEEee
Q psy3290          98 CDELDCLIRGMLFIEANYPLECYYWA  123 (147)
Q Consensus        98 ~DEMecLI~Gl~fll~~i~~E~ft~~  123 (147)
                      ..|+.|..+|..|+..+.|+...-.+
T Consensus       222 v~EItaha~GA~~L~p~~~~v~TIID  247 (404)
T TIGR03286       222 QEELTVNSKGAVYLADKQEGPATVID  247 (404)
T ss_pred             EEEEhhHHHHHHHhcccCCCCcEEEE
Confidence            79999999999999765555443333


No 11 
>PF05378 Hydant_A_N:  Hydantoinase/oxoprolinase N-terminal region;  InterPro: IPR008040 This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 from INTERPRO family.
Probab=87.22  E-value=0.49  Score=37.12  Aligned_cols=18  Identities=33%  Similarity=0.824  Sum_probs=16.9

Q ss_pred             eEEeecCceeEEEEeeeC
Q psy3290           4 FGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~~   21 (147)
                      +|||+|||.+-.|.+.+.
T Consensus         2 igIDvGGT~TD~v~~d~~   19 (176)
T PF05378_consen    2 IGIDVGGTFTDAVLLDED   19 (176)
T ss_pred             eeEecCCCcEEEEEEeCC
Confidence            799999999999999985


No 12 
>PRK13318 pantothenate kinase; Reviewed
Probab=86.26  E-value=0.62  Score=38.14  Aligned_cols=17  Identities=24%  Similarity=0.507  Sum_probs=15.8

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      .++||||||-+|...|.
T Consensus         2 iL~IDIGnT~iK~al~d   18 (258)
T PRK13318          2 LLAIDVGNTNTVFGLYE   18 (258)
T ss_pred             EEEEEECCCcEEEEEEE
Confidence            57999999999999997


No 13 
>PRK13321 pantothenate kinase; Reviewed
Probab=85.57  E-value=0.75  Score=37.76  Aligned_cols=18  Identities=33%  Similarity=0.423  Sum_probs=16.3

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      +++||||||-+|+..|..
T Consensus         2 iL~IDIGnT~ik~gl~~~   19 (256)
T PRK13321          2 LLLIDVGNTNIKLGVFDG   19 (256)
T ss_pred             EEEEEECCCeEEEEEEEC
Confidence            589999999999999974


No 14 
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional
Probab=79.68  E-value=1.1  Score=41.52  Aligned_cols=96  Identities=19%  Similarity=0.186  Sum_probs=48.6

Q ss_pred             CceEEeecCceeEEEEeeeCCCCCCchh---hHHHHH-HHHHHHhhhc-------ccCCCCCcccccceeecceeeEEEE
Q psy3290           2 PWFGMDIGGTLSKLVYFEPKDITPDEAN---SEIETL-KNIRKYLTKN-------KAYGSTGHRDTHLQVLYTTLTLLCI   70 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~~~~~~~~~~---~e~~~l-~~i~~~l~~n-------~~yg~~g~rd~~le~~~~t~~LhFi   70 (147)
                      |++|+|||||-+|+.-+.....-.....   ...+++ ..+++++...       ...|-.|.=|.. ....  -++.+.
T Consensus        19 ~~L~iDIGGT~ir~al~~~~g~i~~~~~~~t~~~~~~~~~i~~~l~~~~~~~~~~igig~pGpVd~~-~~~~--~nl~w~   95 (638)
T PRK14101         19 PRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIRKYLKDVKIGRVNHAAIAIANPVDGD-QVRM--TNHDWS   95 (638)
T ss_pred             CEEEEEcCchhheeeeecCCCcccceeEEecCCCCCHHHHHHHHHHhcCCCCcceEEEEEecCccCC-eeee--cCCCcE
Confidence            7899999999999998843221000000   011122 4466776432       112222322211 0000  022221


Q ss_pred             EecchhhHHHHHHHHHHHHHcCCc-eeeechhhhhhhhhhhh
Q psy3290          71 ELISDDTVVDFIRVIMRIQEVNMK-LEKCDELDCLIRGMLFI  111 (147)
Q Consensus        71 kFeT~~~i~~fi~~~~f~~~lgv~-l~k~DEMecLI~Gl~fl  111 (147)
                       ++    .      -.+++++|+. +.-+.-..|..-|...+
T Consensus        96 -~~----~------~~l~~~~g~~~v~l~ND~~aaA~ge~~l  126 (638)
T PRK14101         96 -FS----I------EATRRALGFDTLLVVNDFTALAMALPGL  126 (638)
T ss_pred             -ec----H------HHHHHHcCCCeEEEEchHHHHHcCCccC
Confidence             21    1      1456778985 67888888888886443


No 15 
>PRK00292 glk glucokinase; Provisional
Probab=79.48  E-value=1.6  Score=36.33  Aligned_cols=26  Identities=12%  Similarity=0.110  Sum_probs=22.2

Q ss_pred             HHHHHcCCc-eeeechhhhhhhhhhhh
Q psy3290          86 MRIQEVNMK-LEKCDELDCLIRGMLFI  111 (147)
Q Consensus        86 ~f~~~lgv~-l~k~DEMecLI~Gl~fl  111 (147)
                      .+++++|+. +.-+....|..-|-.++
T Consensus        85 ~l~~~~~~p~v~l~ND~~aaalgE~~~  111 (316)
T PRK00292         85 AMKQELGLDHLLLINDFTAQALAIPRL  111 (316)
T ss_pred             HHHHHhCCCeEEEEecHHHHHcccccC
Confidence            577889995 99999999999997764


No 16 
>PRK12408 glucokinase; Provisional
Probab=74.80  E-value=1.7  Score=37.09  Aligned_cols=26  Identities=0%  Similarity=0.216  Sum_probs=22.2

Q ss_pred             HHHHHcCCc-eeeechhhhhhhhhhhh
Q psy3290          86 MRIQEVNMK-LEKCDELDCLIRGMLFI  111 (147)
Q Consensus        86 ~f~~~lgv~-l~k~DEMecLI~Gl~fl  111 (147)
                      .+++.+|+. +.-+.-..|..-|..++
T Consensus       103 ~l~~~~~~~~V~l~ND~naaa~gE~~~  129 (336)
T PRK12408        103 QIRAQLGLQAVHLVNDFEAVAYAAPYM  129 (336)
T ss_pred             HHHHHcCCCeEEEeecHHHHHcccccC
Confidence            566789995 99999999999998777


No 17 
>PTZ00288 glucokinase 1; Provisional
Probab=73.11  E-value=7.4  Score=34.64  Aligned_cols=19  Identities=26%  Similarity=0.583  Sum_probs=16.6

Q ss_pred             ceEEeecCceeEEEEeeeC
Q psy3290           3 WFGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~   21 (147)
                      .+|.|||||-+++.+|...
T Consensus        28 ~~~~DiGgt~~R~~~~~~~   46 (405)
T PTZ00288         28 FVGCDVGGTNARVGFAREV   46 (405)
T ss_pred             EEEEEecCCceEEEEEecc
Confidence            3688999999999999863


No 18 
>PF01869 BcrAD_BadFG:  BadF/BadG/BcrA/BcrD ATPase family;  InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis. The family also includes an activase subunit from the enzyme 2-hydroxyglutaryl-CoA dehydratase (P11568 from SWISSPROT). The hypothetical protein AQ_278 from Aquifex aeolicus O66634 from SWISSPROT contains two copies of this region suggesting that the family may structurally dimerise.; PDB: 2E2N_B 2E2Q_A 2E2P_B 2E2O_A 1ZBS_A 2CH6_A 2CH5_D 1ZC6_A 1HUX_A.
Probab=67.96  E-value=4.3  Score=32.95  Aligned_cols=18  Identities=39%  Similarity=0.647  Sum_probs=15.3

Q ss_pred             eEEeecCceeEEEEeeeC
Q psy3290           4 FGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~~   21 (147)
                      +|||+|||-+|.|=+...
T Consensus         1 lGIDgGgTkt~~vl~d~~   18 (271)
T PF01869_consen    1 LGIDGGGTKTKAVLVDEN   18 (271)
T ss_dssp             EEEEECSSEEEEEEEETT
T ss_pred             CEEeeChheeeeEEEeCC
Confidence            599999999999877743


No 19 
>TIGR00749 glk glucokinase, proteobacterial type. This model represents glucokinase of E. coli and close homologs, mostly from other proteobacteria, presumed to have equivalent function. This glucokinase is more closely related to a number of uncharacterized paralogs than to the glucokinase glcK (fromerly yqgR) of Bacillus subtilis and its closest homologs, so the two sets are represented by separate models.
Probab=67.75  E-value=4.2  Score=34.07  Aligned_cols=23  Identities=13%  Similarity=0.215  Sum_probs=19.3

Q ss_pred             HHHHHcCC-ceeeechhhhhhhhh
Q psy3290          86 MRIQEVNM-KLEKCDELDCLIRGM  108 (147)
Q Consensus        86 ~f~~~lgv-~l~k~DEMecLI~Gl  108 (147)
                      .+++++|+ ++.-+.-.+|..-|.
T Consensus        84 ~l~~~~g~~~V~l~ND~naaa~ge  107 (316)
T TIGR00749        84 ELKQNLGFSHLEIINDFTAVSYAI  107 (316)
T ss_pred             HHHHhcCCCeEEEEecHHHHHcCC
Confidence            55678998 599999999999886


No 20 
>PF04260 DUF436:  Protein of unknown function (DUF436) ;  InterPro: IPR006340 Members of this family are uncharacterised proteins of about 180 amino acids from the Bacillus/Clostridium group of Gram-positive bacteria, found in no more than one copy per genome. ; PDB: 1V8D_C.
Probab=64.16  E-value=3.7  Score=32.84  Aligned_cols=11  Identities=55%  Similarity=0.658  Sum_probs=7.0

Q ss_pred             ceEEeecCcee
Q psy3290           3 WFGMDIGGTLS   13 (147)
Q Consensus         3 ~faiDIGGTL~   13 (147)
                      +-|||||+||+
T Consensus       122 ~aGiDIGdTlI  132 (172)
T PF04260_consen  122 DAGIDIGDTLI  132 (172)
T ss_dssp             SEEEEESS---
T ss_pred             ccCccccccee
Confidence            46999999996


No 21 
>PF00370 FGGY_N:  FGGY family of carbohydrate kinases, N-terminal domain;  InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related. These enzymes include L-fucolokinase (2.7.1.51 from EC) (gene fucK); gluconokinase (2.7.1.12 from EC) (gene gntK); glycerol kinase (2.7.1.30 from EC) (gene glpK); xylulokinase (2.7.1.17 from EC) (gene xylB); and L-xylulose kinase (2.7.1.53 from EC) (gene lyxK). These enzymes are proteins of from 480 to 520 amino acid residues. This entry represents the N-terminal domain of these proteins. It adopts a ribonuclease H-like fold and is structurally related to the C-terminal domain [, ].; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3G25_D 3GE1_D 2NLX_A 2ITM_A 2ZF5_Y 3L0Q_B 3GG4_B 3I8B_A 3H3O_C 3FLC_X ....
Probab=63.37  E-value=6  Score=31.45  Aligned_cols=18  Identities=44%  Similarity=0.803  Sum_probs=15.6

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||.|-+|++=|..
T Consensus         2 ~lgiDiGTts~K~~l~d~   19 (245)
T PF00370_consen    2 YLGIDIGTTSVKAVLFDE   19 (245)
T ss_dssp             EEEEEECSSEEEEEEEET
T ss_pred             EEEEEEcccceEEEEEeC
Confidence            479999999999888773


No 22 
>PF11104 PilM_2:  Type IV pilus assembly protein PilM;; PDB: 2YCH_A.
Probab=61.44  E-value=99  Score=26.07  Aligned_cols=108  Identities=24%  Similarity=0.292  Sum_probs=62.2

Q ss_pred             EEeecCceeEEEEeeeCCCCCC------------c--hh--hHHHHH-HHHHHHhhhcccCCCCCcccccceeecceeeE
Q psy3290           5 GMDIGGTLSKLVYFEPKDITPD------------E--AN--SEIETL-KNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTL   67 (147)
Q Consensus         5 aiDIGGTL~KlVYf~~~~~~~~------------~--~~--~e~~~l-~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~L   67 (147)
                      |||||-+.+|+|=.+.+.....            .  ..  ...+.+ +.+++.+..+..    ..+++.+-++...+..
T Consensus         1 GiDiG~~siK~v~l~~~~~~~~l~~~~~~~~p~~~i~~g~i~d~~~l~~~L~~~~~~~~~----~~k~v~~aip~~~vi~   76 (340)
T PF11104_consen    1 GIDIGSSSIKAVELSKKGNRFQLEAFASIPLPPGAISDGEIVDPEALAEALKELLKENKI----KGKKVVLAIPGSSVII   76 (340)
T ss_dssp             EEEE-SSEEEEEEEETTTT--EEEEEEEEE--TTSEETTEES-HHHHHHHHHHHHHHHT--------EEEEEE-GGG-EE
T ss_pred             CeecCCCeEEEEEEEEcCCccEEEEEEEEECCCCCccCCCcCCHHHHHHHHHHHHHHcCC----CCCeEEEEeCCCcEEE
Confidence            8999999999998887432100            0  00  122233 335555544321    2356677777777788


Q ss_pred             EEEEecc----hhhHHHHHHHH---------------------------------------------HHHHHcCCceeee
Q psy3290          68 LCIELIS----DDTVVDFIRVI---------------------------------------------MRIQEVNMKLEKC   98 (147)
Q Consensus        68 hFikFeT----~~~i~~fi~~~---------------------------------------------~f~~~lgv~l~k~   98 (147)
                      ..+++|.    .+ +++.|.|-                                             ..-+.+|+++...
T Consensus        77 r~i~lP~~m~~~e-l~~~I~~Ea~~~iP~~~~e~~~D~~vl~~~~~~~~~~~Vll~Aa~k~~v~~~~~~~~~aGL~~~~v  155 (340)
T PF11104_consen   77 RNIRLPAVMPEKE-LEEAIRWEAEQYIPFPLEEVVFDYQVLGESEDGEEKMEVLLVAAPKEIVESYVELFEEAGLKPVAV  155 (340)
T ss_dssp             EEEEEE----HHH-HHHHHHHHHGGG-SS----EEEEEEESS-GS-TTSEEEEEEEEEEHHHHHHHHHHHHHTT-EEEEE
T ss_pred             EEEecCCCCCHHH-HHHHHHHHHHhhCCCChhHeEEEEEEeccCCCCCCceEEEEEEEcHHHHHHHHHHHHHcCCceEEE
Confidence            8888875    34 66666664                                             4457889999988


Q ss_pred             c-hhhhhhhhhhhhhhhCCC
Q psy3290          99 D-ELDCLIRGMLFIEANYPL  117 (147)
Q Consensus        99 D-EMecLI~Gl~fll~~i~~  117 (147)
                      | +--||.+=++++....|.
T Consensus       156 Dv~~~Al~r~~~~~~~~~~~  175 (340)
T PF11104_consen  156 DVEAFALARLFEFLEPQLPD  175 (340)
T ss_dssp             EEHHHHGGGGGHHHHHTST-
T ss_pred             eehHHHHHHHHHHHHHhCCc
Confidence            7 456777777776555544


No 23 
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type. Gluconate is derived from glucose in two steps. This model describes one form of gluconate kinase, belonging to the FGGY family of carbohydrate kinases. Gluconate kinase phosphoryates gluconate for entry into the Entner-Douderoff pathway.
Probab=59.17  E-value=7.8  Score=34.57  Aligned_cols=18  Identities=50%  Similarity=0.737  Sum_probs=15.3

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||+|.+|.+=|..
T Consensus         2 ~lgiDiGtt~~K~~l~d~   19 (505)
T TIGR01314         2 MIGVDIGTTSTKAVLFEE   19 (505)
T ss_pred             EEEEeccccceEEEEEcC
Confidence            479999999999887754


No 24 
>PF00349 Hexokinase_1:  Hexokinase;  InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P). The enzyme can catalyse this reaction on glucose, fructose, sorbitol and glucosamine, and as such is the first step in a number of metabolic pathways []. The addition of a phosphate group to the sugar acts to trap it in a cell, since the negatively charged phosphate cannot easily traverse the plasma membrane. The enzyme is widely distributed in eukaryotes. There are three isozymes of hexokinase in yeast (PI, PII and glucokinase): isozymes PI and PII phosphorylate both aldo- and keto-sugars; glucokinase is specific for aldo-hexoses. All three isozymes contain two domains []. Structural studies of yeast hexokinase reveal a well-defined catalytic pocket that binds ATP and hexose, allowing easy transfer of the phosphate from ATP to the sugar []. Vertebrates contain four hexokinase isozymes, designated I to IV, where types I to III contain a duplication of the two-domain yeast-type hexokinases. Both the N- and C-terminal halves bind hexose and H6P, though in types I an III only the C-terminal half supports catalysis, while both halves support catalysis in type II. The N-terminal half is the regulatory region. Type IV hexokinase is similar to the yeast enzyme in containing only the two domains, and is sometimes incorrectly referred to as glucokinase. The different vertebrate isozymes differ in their catalysis, localisation and regulation, thereby contributing to the different patterns of glucose metabolism in different tissues []. Whereas types I to III can phosphorylate a variety of hexose sugars and are inhibited by glucose-6-phosphate (G6P), type IV is specific for glucose and shows no G6P inhibition. Type I enzyme may have a catabolic function, producing H6P for energy production in glycolysis; it is bound to the mitochondrial membrane, which enables the coordination of glycolysis with the TCA cycle. Types II and III enzyme may have anabolic functions, providing H6P for glycogen or lipid synthesis. Type IV enzyme is found in the liver and pancreatic beta-cells, where it is controlled by insulin (activation) and glucagon (inhibition). In pancreatic beta-cells, type IV enzyme acts as a glucose sensor to modify insulin secretion. Mutations in type IV hexokinase have been associated with diabetes mellitus.  Hexokinase (2.7.1.1 from EC), a fructose and glucose phosphorylating enzyme, contains two structurally similar domains represented by this family and PF03727 from PFAM. Some hexokinases have two copies of each of these domains. This entry represents the N-terminal domain.; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3O1W_A 3O6W_A 3O4W_B 3O08_B 3O80_A 3O5B_A 3O8M_A 3O1B_A 1BG3_A 4DHY_A ....
Probab=57.99  E-value=9.8  Score=30.65  Aligned_cols=20  Identities=25%  Similarity=0.554  Sum_probs=16.9

Q ss_pred             ceEEeecCceeEEEEeeeCC
Q psy3290           3 WFGMDIGGTLSKLVYFEPKD   22 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~~   22 (147)
                      .+|||+|||-.+++..+=.+
T Consensus        65 ~LalDlGGTnlRv~~V~L~g   84 (206)
T PF00349_consen   65 FLALDLGGTNLRVALVELSG   84 (206)
T ss_dssp             EEEEEESSSSEEEEEEEEES
T ss_pred             EEEEeecCcEEEEEEEEEcC
Confidence            58999999999988887544


No 25 
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative. This domain may be involved in generating or regenerating the active sites of enzymes related to (R)-2-hydroxyglutaryl-CoA dehydratase and benzoyl-CoA reductase.
Probab=57.10  E-value=7.9  Score=31.31  Aligned_cols=17  Identities=41%  Similarity=0.686  Sum_probs=15.1

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      .+|||||+|-+|.|-|.
T Consensus         2 ~lGIDiGtts~K~vl~d   18 (248)
T TIGR00241         2 SLGIDSGSTTTKMVLME   18 (248)
T ss_pred             EEEEEcChhheEEEEEc
Confidence            37999999999998886


No 26 
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]
Probab=56.58  E-value=9.5  Score=36.27  Aligned_cols=20  Identities=30%  Similarity=0.717  Sum_probs=18.0

Q ss_pred             ceEEeecCceeEEEEeeeCC
Q psy3290           3 WFGMDIGGTLSKLVYFEPKD   22 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~~   22 (147)
                      .+|||+|||.+=.|++...+
T Consensus         4 ~iGID~GGTfTDaV~~~~~~   23 (674)
T COG0145           4 RIGIDVGGTFTDAVLLDEDG   23 (674)
T ss_pred             EEEEEcCCCcEeEEEEeCCC
Confidence            48999999999999999864


No 27 
>PLN02666 5-oxoprolinase
Probab=55.69  E-value=9.1  Score=38.95  Aligned_cols=19  Identities=32%  Similarity=0.476  Sum_probs=16.4

Q ss_pred             ceEEeecCceeEEEEeeeC
Q psy3290           3 WFGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~   21 (147)
                      .+|||||||++-+|.+.+.
T Consensus        11 rigIDvGGTFTD~v~~~~~   29 (1275)
T PLN02666         11 RFCIDRGGTFTDVYAEVPG   29 (1275)
T ss_pred             EEEEECCcCCEeEEEEecC
Confidence            4799999999999988753


No 28 
>TIGR01440 conserved hypothetical protein TIGR01440. Members of this family are uncharacterized proteins of about 180 amino acids from the Bacillus/Clostridium group of Gram-positive bacteria, found in no more than one copy per genome.
Probab=55.18  E-value=4.3  Score=32.46  Aligned_cols=13  Identities=46%  Similarity=0.606  Sum_probs=10.5

Q ss_pred             ceEEeecCceeEE
Q psy3290           3 WFGMDIGGTLSKL   15 (147)
Q Consensus         3 ~faiDIGGTL~Kl   15 (147)
                      +-|||||.||+-.
T Consensus       122 ~aGiDIGdT~IGM  134 (172)
T TIGR01440       122 PAGIDIGDTLIGM  134 (172)
T ss_pred             ccCcccccceeee
Confidence            4589999999853


No 29 
>PRK13320 pantothenate kinase; Reviewed
Probab=54.96  E-value=11  Score=30.95  Aligned_cols=18  Identities=44%  Similarity=0.578  Sum_probs=16.6

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      +++||||.|-+|...|+.
T Consensus         4 ~L~iDiGNT~ik~~~~~~   21 (244)
T PRK13320          4 NLVIDIGNTTTKLAVFEG   21 (244)
T ss_pred             EEEEEeCCCcEEEEEEEC
Confidence            689999999999999984


No 30 
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A. This model describes A, or gamma, subunit of the bcr type of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This family shows strong sequence similarity to the 2-hydroxyglutaryl-CoA dehydratase alpha chain and to subunits of different types of benzoyl-CoA reductase (such as the bzd type).
Probab=54.55  E-value=7.5  Score=35.18  Aligned_cols=18  Identities=33%  Similarity=0.722  Sum_probs=15.1

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||+|-+|.|=...
T Consensus         4 ~lGIDIGSTsTKaVVmd~   21 (432)
T TIGR02259         4 FVGIDLGSTTTKAVLMDD   21 (432)
T ss_pred             EEEEEcCchhEEEEEEcC
Confidence            479999999999777653


No 31 
>PRK13331 pantothenate kinase; Reviewed
Probab=52.35  E-value=14  Score=30.89  Aligned_cols=20  Identities=25%  Similarity=0.534  Sum_probs=17.8

Q ss_pred             CCceEEeecCceeEEEEeee
Q psy3290           1 MPWFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         1 ~p~faiDIGGTL~KlVYf~~   20 (147)
                      |-++++|||=|-+|+.+|+-
T Consensus         7 ~~~L~iDiGNT~~~~g~f~~   26 (251)
T PRK13331          7 NEWLALMIGNSRLHWGYFSG   26 (251)
T ss_pred             CcEEEEEeCCCcEEEEEEEC
Confidence            34799999999999999984


No 32 
>COG3569 Topoisomerase IB [DNA replication, recombination, and repair]
Probab=51.68  E-value=12  Score=33.05  Aligned_cols=33  Identities=24%  Similarity=0.265  Sum_probs=28.9

Q ss_pred             HHhhhcccCCCCCcccccceeecceeeEEEEEe
Q psy3290          40 KYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIEL   72 (147)
Q Consensus        40 ~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikF   72 (147)
                      .|.+.|.+||.||.++-|......+++|.|.-=
T Consensus       155 ~y~r~ngsyg~TtllkRhV~~~~~ti~~~f~gk  187 (354)
T COG3569         155 AYARDNGSYGLTTLLKRHVDVEGSTIRFRFKGK  187 (354)
T ss_pred             HHhhccCCcCcccceeeeeccCCCEEEEEecCC
Confidence            688999999999999999999888888888643


No 33 
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase. This model represents a subfamily of the FGGY family of carbohydrate kinases. This subfamily is closely related to a set of ribulose kinases, and many members are designated ribitol kinase. However, the member from Klebsiella pneumoniae, from a ribitol catabolism operon, accepts D-ribulose and to a lesser extent D-arabinitol and ribitol (PubMed:9639934 and JW Lengeler, personal communication); its annotation in GenBank as ribitol kinase is imprecise and may have affected public annotation of related proteins.
Probab=50.57  E-value=13  Score=33.56  Aligned_cols=18  Identities=17%  Similarity=0.545  Sum_probs=15.5

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||+|.+|.+=|..
T Consensus         2 ~lgID~GTts~Ka~l~d~   19 (541)
T TIGR01315         2 YIGVDVGTGSARACIIDS   19 (541)
T ss_pred             EEEEEecCcCEEEEEEcC
Confidence            479999999999888864


No 34 
>PRK13690 hypothetical protein; Provisional
Probab=50.04  E-value=5.8  Score=32.08  Aligned_cols=12  Identities=50%  Similarity=0.695  Sum_probs=10.2

Q ss_pred             ceEEeecCceeE
Q psy3290           3 WFGMDIGGTLSK   14 (147)
Q Consensus         3 ~faiDIGGTL~K   14 (147)
                      +-|||||.||+-
T Consensus       129 ~AGiDIGdT~IG  140 (184)
T PRK13690        129 HAGIDIGDTLIG  140 (184)
T ss_pred             ccCcccccceee
Confidence            468999999985


No 35 
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]
Probab=49.99  E-value=15  Score=30.30  Aligned_cols=32  Identities=3%  Similarity=0.007  Sum_probs=26.1

Q ss_pred             HHHH-HHHHHcCCceeeechhhhhhhhhhhhhh
Q psy3290          82 IRVI-MRIQEVNMKLEKCDELDCLIRGMLFIEA  113 (147)
Q Consensus        82 i~~~-~f~~~lgv~l~k~DEMecLI~Gl~fll~  113 (147)
                      +++. .+++.+|+.+.-+..-.|..-|=.++-.
T Consensus        96 ~~l~~~L~~~~~~Pv~veNDan~aalaE~~~g~  128 (314)
T COG1940          96 VDLAEELEARLGLPVFVENDANAAALAEAWFGA  128 (314)
T ss_pred             ccHHHHHHHHHCCCEEEecHHHHHHHHHHHhCC
Confidence            3344 7889999999999999999988777754


No 36 
>TIGR01311 glycerol_kin glycerol kinase. This model describes glycerol kinase, a member of the FGGY family of carbohydrate kinases.
Probab=49.46  E-value=14  Score=32.86  Aligned_cols=18  Identities=28%  Similarity=0.495  Sum_probs=15.0

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||+|.+|.+=|..
T Consensus         3 ~lgiDiGtt~iKa~l~d~   20 (493)
T TIGR01311         3 ILAIDQGTTSSRAIVFDK   20 (493)
T ss_pred             EEEEecCCCceEEEEECC
Confidence            478999999999877754


No 37 
>PF14450 FtsA:  Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T.
Probab=47.17  E-value=19  Score=25.95  Aligned_cols=17  Identities=29%  Similarity=0.411  Sum_probs=14.5

Q ss_pred             eEEeecCceeEEEEeee
Q psy3290           4 FGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~   20 (147)
                      .+||||++-++++-|+.
T Consensus         2 ~~iDiGs~~~~~~i~~~   18 (120)
T PF14450_consen    2 VVIDIGSSKTKVAIAED   18 (120)
T ss_dssp             EEEEE-SSSEEEEEEET
T ss_pred             EEEEcCCCcEEEEEEEe
Confidence            58999999999999886


No 38 
>PRK05082 N-acetylmannosamine kinase; Provisional
Probab=45.66  E-value=18  Score=29.58  Aligned_cols=26  Identities=4%  Similarity=-0.131  Sum_probs=20.5

Q ss_pred             HHHHHcCCceeeechhhhhhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRGMLFI  111 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~Gl~fl  111 (147)
                      .+++++++.+.-+....|...|=.+.
T Consensus        91 ~l~~~~~~pv~v~NDa~a~a~aE~~~  116 (291)
T PRK05082         91 TLEQLTDLPTIALNDAQAAAWAEYQA  116 (291)
T ss_pred             HHHHHhCCCEEEECcHHHHHHHHHHh
Confidence            46788899999999999987775443


No 39 
>PRK13927 rod shape-determining protein MreB; Provisional
Probab=44.99  E-value=18  Score=30.20  Aligned_cols=16  Identities=25%  Similarity=0.559  Sum_probs=13.9

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      |+|||+|.|.+|+ |+.
T Consensus         7 ~igIDlGt~~~~i-~~~   22 (334)
T PRK13927          7 DLGIDLGTANTLV-YVK   22 (334)
T ss_pred             eeEEEcCcceEEE-EEC
Confidence            7999999999997 654


No 40 
>TIGR00671 baf pantothenate kinase, type III. This model describes a family of proteins found in a single copy in at least ten different early completed bacterial genomes. The only characterized member of the family is Bvg accessory factor (Baf), a protein required, in addition to the regulatory operon bvgAS, for heterologous transcription of the Bordetella pertussis toxin operon (ptx) in E. coli.
Probab=44.28  E-value=21  Score=29.26  Aligned_cols=18  Identities=17%  Similarity=0.161  Sum_probs=16.2

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      |+++|||=|-+|+..|+-
T Consensus         1 ~L~iDiGNT~i~~g~~~~   18 (243)
T TIGR00671         1 LLLIDVGNTRIVFALNSG   18 (243)
T ss_pred             CEEEEECCCcEEEEEEEC
Confidence            789999999999999863


No 41 
>PRK00047 glpK glycerol kinase; Provisional
Probab=43.84  E-value=19  Score=32.09  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=15.3

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||+|.+|.+=|..
T Consensus         7 ~lgiD~GTts~Ka~l~d~   24 (498)
T PRK00047          7 ILALDQGTTSSRAIIFDH   24 (498)
T ss_pred             EEEEecCCCceEEEEECC
Confidence            479999999999877754


No 42 
>cd01395 HMT_MBD Methyl-CpG binding domains (MBD) present in putative histone methyltransferases (HMT) such as CLLD8 and SETDB1 proteins; CLLD8 contains a MBD, a PreSET and a bifurcated SET domain, suggesting that CLLD8 might be associated with methylation-mediated transcriptional repression. SETDB1 and other proteins in this group have a similar domain architecture. SETDB1 is a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.
Probab=43.01  E-value=27  Score=23.24  Aligned_cols=33  Identities=15%  Similarity=0.483  Sum_probs=24.0

Q ss_pred             EeecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhc
Q psy3290           6 MDIGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKN   45 (147)
Q Consensus         6 iDIGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n   45 (147)
                      .++||+.-=++|++|.+       ..-+++.++.+||..+
T Consensus        17 ~~~~~~k~~V~Y~aPCG-------r~Lr~~~EV~~YL~~t   49 (60)
T cd01395          17 ARVGKVKKHVIYKAPCG-------RSLRNMSEVHRYLRET   49 (60)
T ss_pred             ccCCCcccceEEECCcc-------hhhhcHHHHHHHHHhc
Confidence            35666666699999986       2345578899999765


No 43 
>PHA03101 DNA topoisomerase type I; Provisional
Probab=41.88  E-value=26  Score=30.54  Aligned_cols=31  Identities=19%  Similarity=0.420  Sum_probs=26.9

Q ss_pred             HHhhhcccCCCCCcccccceeecceeeEEEE
Q psy3290          40 KYLTKNKAYGSTGHRDTHLQVLYTTLTLLCI   70 (147)
Q Consensus        40 ~~l~~n~~yg~~g~rd~~le~~~~t~~LhFi   70 (147)
                      +|...|.+||-+-.|..|+++....++|+|.
T Consensus       136 ~Ya~~N~SyGltTLr~rHv~v~g~~i~f~F~  166 (314)
T PHA03101        136 KYLKENETVGLLTLKNKHITISNDKILIKFV  166 (314)
T ss_pred             hHHHhcCCccccccchhceEEECCEEEEEEE
Confidence            6888899999999999999998777777774


No 44 
>PRK13311 N-acetyl-D-glucosamine kinase; Provisional
Probab=41.60  E-value=24  Score=28.51  Aligned_cols=27  Identities=4%  Similarity=0.062  Sum_probs=21.6

Q ss_pred             HHHHHcCCceeeechhhhhhhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRGMLFIE  112 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~Gl~fll  112 (147)
                      .+++++++.+.-+-.-.|..-|=.+.-
T Consensus        91 ~l~~~~~~pV~leNDanaaAlaE~~~g  117 (256)
T PRK13311         91 DLSRLIQREVRIDNDANCFALSEAWDP  117 (256)
T ss_pred             HHHHHHCCCEEEEchhhHHHHHHHHhc
Confidence            567888999999999888887766653


No 45 
>PRK13930 rod shape-determining protein MreB; Provisional
Probab=41.20  E-value=20  Score=29.82  Aligned_cols=16  Identities=19%  Similarity=0.235  Sum_probs=13.4

Q ss_pred             ceEEeecCceeEEEEe
Q psy3290           3 WFGMDIGGTLSKLVYF   18 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf   18 (147)
                      |+|||+|-|.+|+.++
T Consensus        10 ~vgiDlGt~~t~i~~~   25 (335)
T PRK13930         10 DIGIDLGTANTLVYVK   25 (335)
T ss_pred             ceEEEcCCCcEEEEEC
Confidence            3679999999999775


No 46 
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit. Members of this family are the Q subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Probab=40.33  E-value=22  Score=30.56  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=15.3

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      .+|||||.|-+|+|-..
T Consensus        34 ~~GIDiGStt~K~Vlld   50 (293)
T TIGR03192        34 TCGIDVGSVSSQAVLVC   50 (293)
T ss_pred             EEEEEeCchhEEEEEEe
Confidence            47999999999998886


No 47 
>cd00659 Topo_IB_C DNA topoisomerase IB, C-terminal catalytic domain.  Topoisomerase I promotes the relaxation of both positive and negative DNA superhelical tension by introducing a transient single-stranded break in duplex DNA. This function is vital for the processes of replication, transcription, and recombination.  Unlike Topo IA enzymes, Topo IB enzymes do not require a single-stranded region of DNA or metal ions for their function. The type IB family of DNA topoisomerases includes eukaryotic nuclear topoisomerase I, topoisomerases of poxviruses and bacterial versions of Topo IB.  They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their C-terminal catalytic domain and the overall reaction mechanism with tyrosine recombinases.  The C-terminal catalytic domain in topoisomerases is linked to a divergent N-terminal domain that shows no sequence or structure similarity to the N-terminal domains of tyrosine recombinases.
Probab=38.63  E-value=25  Score=28.83  Aligned_cols=30  Identities=20%  Similarity=0.255  Sum_probs=25.3

Q ss_pred             HHhhhcccCCCCCcccccceeecceeeEEE
Q psy3290          40 KYLTKNKAYGSTGHRDTHLQVLYTTLTLLC   69 (147)
Q Consensus        40 ~~l~~n~~yg~~g~rd~~le~~~~t~~LhF   69 (147)
                      +|...|.+||-+..|..|.++....++|.|
T Consensus        61 ~Ya~~n~s~GltTLr~~Hv~~~~~~i~f~F   90 (218)
T cd00659          61 KYERENDTVGLCTLRKEHVTLKPNVVRFDF   90 (218)
T ss_pred             hhhhcCCCEeecccchhheeEeCCEEEEEE
Confidence            588889999999999999998776666665


No 48 
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D. This model describes the D subunit of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This family shows sequence similarity to the A subunit (TIGR02259) and to the 2-hydroxyglutaryl-CoA dehydratase alpha chain.
Probab=38.49  E-value=21  Score=30.17  Aligned_cols=17  Identities=47%  Similarity=0.575  Sum_probs=15.3

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      ..|||||.|-+|.|=+.
T Consensus         3 ~~GIDiGStttK~Vlid   19 (262)
T TIGR02261         3 TAGIDIGTGAIKTVLFE   19 (262)
T ss_pred             EEEEEcCcccEEEEEEe
Confidence            36999999999999887


No 49 
>PF03309 Pan_kinase:  Type III pantothenate kinase;  InterPro: IPR004619 Pantothenate kinase (PanK or CoaA) catalyses the first step of the universal five step coenzyme A (CoA) biosynthesis pathway. CoA is a ubiquitous and essential cofactor in all living organsims. Pantothenate kinase catalyses the first and rate limiting step in the CoA biosynthetic pathway, which involves transferring a phosphoryl group from ATP to pantothenate, also known as vitamin B5. Three distinct types of pantothenate kinase enzymes have been identified: type I PanK enzymes are typified by the E. coli CoaA protein, type II enzymes are primarily found in eukaryotic organisms whilst type III enzymes have a wider phylogenic distribution and are not feedback inhibited by CoA []. This entry represents the type III pantothenate kinase family, such as that found in Helicobacter pylori. PanK III enzymes have a much wider phylogenic distribution than PanK I, and differs significantly in biochemical activity. PanK III enzymes are are not feedback inhibited by CoA concentration (which is also the case for PanK II enzymes), and PanK III enzymes have an unusually high Km for ATP []. ; GO: 0045893 positive regulation of transcription, DNA-dependent; PDB: 2GTD_E 3BF1_F 3BEX_D 3BF3_F 2NRH_B 2H3G_X 3DJC_J 2F9T_A 2F9W_A.
Probab=36.37  E-value=37  Score=26.73  Aligned_cols=18  Identities=33%  Similarity=0.431  Sum_probs=14.9

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      ++.||||=|-+|...|+.
T Consensus         1 ~L~iDiGNT~ik~~~~~~   18 (206)
T PF03309_consen    1 ILLIDIGNTRIKWALFDG   18 (206)
T ss_dssp             EEEEEE-SSEEEEEEEET
T ss_pred             CEEEEECCCeEEEEEEEC
Confidence            578999999999999963


No 50 
>smart00842 FtsA Cell division protein FtsA. FtsA is essential for bacterial cell division, and co-localizes to the septal ring with FtsZ. It has been suggested that the interaction of FtsA-FtsZ has arisen through coevolution in different bacterial strains PUBMED:9352931.
Probab=35.87  E-value=29  Score=26.70  Aligned_cols=17  Identities=35%  Similarity=0.462  Sum_probs=14.1

Q ss_pred             eEEeecCceeEEEEeee
Q psy3290           4 FGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~   20 (147)
                      .|+|||-|-+|+|=-+.
T Consensus         2 ~~lDIGs~~ik~vv~~~   18 (187)
T smart00842        2 VGLDIGTSKIKALVAEV   18 (187)
T ss_pred             EEEEeccceEEEEEEEE
Confidence            69999999999875543


No 51 
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]
Probab=35.48  E-value=32  Score=30.89  Aligned_cols=19  Identities=42%  Similarity=0.653  Sum_probs=17.4

Q ss_pred             ceEEeecCceeEEEEeeeC
Q psy3290           3 WFGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~   21 (147)
                      .+|||||.|-+|.|=|...
T Consensus         6 ~lgIDiGTt~~Kavl~d~~   24 (502)
T COG1070           6 VLGIDIGTTSVKAVLFDED   24 (502)
T ss_pred             EEEEEcCCCcEEEEEEeCC
Confidence            6899999999999999876


No 52 
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein. This protein family was identified, by the method of partial phylogenetic profiling, as related to the use of tetrahydromethanopterin (H4MPT) as a C-1 carrier. Characteristic markers of the H4MPT-linked C1 transfer pathway include formylmethanofuran dehydrogenase subunits, methenyltetrahydromethanopterin cyclohydrolase, etc. Tetrahydromethanopterin, a tetrahydrofolate analog, occurs in methanogenic archaea, bacterial methanotrophs, planctomycetes, and a few other lineages.
Probab=34.90  E-value=24  Score=30.51  Aligned_cols=16  Identities=19%  Similarity=0.353  Sum_probs=14.2

Q ss_pred             eEEeecCceeEEEEee
Q psy3290           4 FGMDIGGTLSKLVYFE   19 (147)
Q Consensus         4 faiDIGGTL~KlVYf~   19 (147)
                      +.+|||||-+++.=..
T Consensus       131 I~~DmGGTTtDi~~i~  146 (318)
T TIGR03123       131 LFVDMGSTTTDIIPII  146 (318)
T ss_pred             EEEEcCccceeeEEec
Confidence            6899999999998775


No 53 
>COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription]
Probab=34.88  E-value=35  Score=28.69  Aligned_cols=18  Identities=28%  Similarity=0.377  Sum_probs=16.8

Q ss_pred             CceEEeecCceeEEEEee
Q psy3290           2 PWFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~   19 (147)
                      ||+++|||-|.+|...++
T Consensus         1 ~~L~iDiGNT~~~~a~~~   18 (251)
T COG1521           1 MLLLIDIGNTRIVFALYE   18 (251)
T ss_pred             CeEEEEeCCCeEEEEEec
Confidence            689999999999999997


No 54 
>PRK15027 xylulokinase; Provisional
Probab=34.74  E-value=33  Score=30.37  Aligned_cols=18  Identities=22%  Similarity=0.626  Sum_probs=15.7

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      ++|||||.|-+|.+=|..
T Consensus         2 ~lgID~GTts~Ka~l~d~   19 (484)
T PRK15027          2 YIGIDLGTSGVKVILLNE   19 (484)
T ss_pred             EEEEEecccceEEEEEcC
Confidence            479999999999887775


No 55 
>PTZ00009 heat shock 70 kDa protein; Provisional
Probab=34.18  E-value=35  Score=31.91  Aligned_cols=20  Identities=30%  Similarity=0.448  Sum_probs=17.7

Q ss_pred             CCceEEeecCceeEEEEeee
Q psy3290           1 MPWFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         1 ~p~faiDIGGTL~KlVYf~~   20 (147)
                      ++.+|||.|.|.++++++.+
T Consensus         4 ~~~iGIDlGTt~s~va~~~~   23 (653)
T PTZ00009          4 GPAIGIDLGTTYSCVGVWKN   23 (653)
T ss_pred             ccEEEEEeCcccEEEEEEeC
Confidence            46799999999999999865


No 56 
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein.
Probab=34.06  E-value=19  Score=29.29  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=15.8

Q ss_pred             EEeecCceeEEEEeeeCC
Q psy3290           5 GMDIGGTLSKLVYFEPKD   22 (147)
Q Consensus         5 aiDIGGTL~KlVYf~~~~   22 (147)
                      |+|||.|-+|+|=.+..+
T Consensus         1 g~dig~~~ik~v~~~~~~   18 (239)
T TIGR02529         1 GVDLGTANIVIVVLDEDG   18 (239)
T ss_pred             CCCcccceEEEEEEecCC
Confidence            689999999999988654


No 57 
>PF00012 HSP70:  Hsp70 protein;  InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins. Hsp70 assisted folding involves repeated cycles of substrate binding and release. Hsp70 activity is ATP dependent. Hsp70 proteins are made up of two regions: the amino terminus is the ATPase domain and the carboxyl terminus is the substrate binding region []. Hsp70 proteins have an average molecular weight of 70 kDa [, , ]. In most species,there are many proteins that belong to the hsp70 family. Some of these are only expressed under stress conditions (strictly inducible), while some are present in cells under normal growth conditions and are not heat-inducible (constitutive or cognate) [, ]. Hsp70 proteins can be found in different cellular compartments(nuclear, cytosolic, mitochondrial, endoplasmic reticulum, for example).; PDB: 2P32_D 3D2F_A 2QXL_A 3D2E_C 3C7N_A 3FE1_C 4ANI_C 2V7Y_A 2KHO_A 3DPQ_B ....
Probab=33.60  E-value=39  Score=30.27  Aligned_cols=18  Identities=39%  Similarity=0.648  Sum_probs=15.0

Q ss_pred             eEEeecCceeEEEEeeeC
Q psy3290           4 FGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~~   21 (147)
                      +|||+|.|.+++.++...
T Consensus         2 iGID~Gt~~~~va~~~~~   19 (602)
T PF00012_consen    2 IGIDLGTTNSKVAVFKNG   19 (602)
T ss_dssp             EEEEE-SSEEEEEEEETT
T ss_pred             EEEEeccCCEEEEEEEec
Confidence            799999999999998753


No 58 
>PF01968 Hydantoinase_A:  Hydantoinase/oxoprolinase;  InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3.5.2.9 from EC). Both reactions involve the hydrolysis of 5-membered rings via hydrolysis of their internal imide bonds [].; GO: 0016787 hydrolase activity; PDB: 3C0B_C 3CET_B.
Probab=33.38  E-value=31  Score=28.89  Aligned_cols=18  Identities=22%  Similarity=0.440  Sum_probs=13.5

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      -+.+|||||-+.+.-...
T Consensus        79 ~i~vDmGGTTtDi~~i~~   96 (290)
T PF01968_consen   79 AIVVDMGGTTTDIALIKD   96 (290)
T ss_dssp             EEEEEE-SS-EEEEEEET
T ss_pred             EEEEeCCCCEEEEEEEEC
Confidence            478999999999998863


No 59 
>PRK13324 pantothenate kinase; Reviewed
Probab=33.36  E-value=40  Score=28.09  Aligned_cols=18  Identities=22%  Similarity=0.398  Sum_probs=16.4

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      ++++|||=|-+|+..|+.
T Consensus         2 iL~iDiGNT~ik~gl~~~   19 (258)
T PRK13324          2 LLVMDMGNSHIHIGVFDG   19 (258)
T ss_pred             EEEEEeCCCceEEEEEEC
Confidence            689999999999999983


No 60 
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional
Probab=33.22  E-value=31  Score=28.29  Aligned_cols=26  Identities=4%  Similarity=0.060  Sum_probs=20.8

Q ss_pred             HHHHHcCCceeeechhhhhhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRGMLFI  111 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~Gl~fl  111 (147)
                      .+++++|+.+.-+..-.|..-|=.+.
T Consensus        91 ~l~~~~~~pV~ieNDa~aaalaE~~~  116 (303)
T PRK13310         91 DLSARLGRDVRLDNDANCFALSEAWD  116 (303)
T ss_pred             HHHHHHCCCeEEeccHhHHHHHHhhh
Confidence            56788899999999998888775554


No 61 
>PF06577 DUF1134:  Protein of unknown function (DUF1134);  InterPro: IPR008325 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=31.85  E-value=37  Score=26.95  Aligned_cols=19  Identities=53%  Similarity=0.882  Sum_probs=16.4

Q ss_pred             CceEEeecCceeE---EEEeee
Q psy3290           2 PWFGMDIGGTLSK---LVYFEP   20 (147)
Q Consensus         2 p~faiDIGGTL~K---lVYf~~   20 (147)
                      |.+|.|+||.-+|   |||=-|
T Consensus        76 PSiG~D~G~~~~r~~~LVYnL~   97 (160)
T PF06577_consen   76 PSIGFDFGGNGSRVFMLVYNLP   97 (160)
T ss_pred             CceeEeecCCceEEEEEEEcCC
Confidence            8899999999999   788554


No 62 
>PRK09698 D-allose kinase; Provisional
Probab=31.56  E-value=42  Score=27.45  Aligned_cols=22  Identities=5%  Similarity=-0.103  Sum_probs=17.8

Q ss_pred             HHHHHcCCceeeechhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRG  107 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~G  107 (147)
                      .+++.+|+.+.-+....|...|
T Consensus        99 ~l~~~~~~pv~v~NDa~aaa~~  120 (302)
T PRK09698         99 KLENTLNCPVFFSRDVNLQLLW  120 (302)
T ss_pred             HHHHHhCCCEEEcchHhHHHHH
Confidence            5678899999999988886655


No 63 
>TIGR02350 prok_dnaK chaperone protein DnaK. Members of this family are the chaperone DnaK, of the DnaK-DnaJ-GrpE chaperone system. All members of the seed alignment were taken from completely sequenced bacterial or archaeal genomes and (except for Mycoplasma sequence) found clustered with other genes of this systems. This model excludes DnaK homologs that are not DnaK itself, such as the heat shock cognate protein HscA (TIGR01991). However, it is not designed to distinguish among DnaK paralogs in eukaryotes. Note that a number of dnaK genes have shadow ORFs in the same reverse (relative to dnaK) reading frame, a few of which have been assigned glutamate dehydrogenase activity. The significance of this observation is unclear; lengths of such shadow ORFs are highly variable as if the presumptive protein product is not conserved.
Probab=31.27  E-value=43  Score=30.65  Aligned_cols=19  Identities=32%  Similarity=0.422  Sum_probs=16.8

Q ss_pred             CceEEeecCceeEEEEeee
Q psy3290           2 PWFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~   20 (147)
                      ..+|||.|.|.+++.|+.+
T Consensus         1 ~viGIDlGtt~s~va~~~~   19 (595)
T TIGR02350         1 KIIGIDLGTTNSCVAVMEG   19 (595)
T ss_pred             CEEEEEeCcccEEEEEEEC
Confidence            3689999999999999975


No 64 
>PF02685 Glucokinase:  Glucokinase;  InterPro: IPR003836 Glucokinases 2.7.1.2 from EC are found in invertebrates and microorganisms and are highly specific for glucose. These enzymes phosphorylate glucose using ATP as a donor to give glucose-6-phosphate and ADP [].; GO: 0004340 glucokinase activity, 0005524 ATP binding, 0006096 glycolysis, 0051156 glucose 6-phosphate metabolic process; PDB: 1SZ2_B 1Q18_B 2Q2R_B.
Probab=31.13  E-value=51  Score=28.26  Aligned_cols=27  Identities=7%  Similarity=0.217  Sum_probs=20.0

Q ss_pred             HHHHHcCCc-eeeechhhhhhhhhhhhh
Q psy3290          86 MRIQEVNMK-LEKCDELDCLIRGMLFIE  112 (147)
Q Consensus        86 ~f~~~lgv~-l~k~DEMecLI~Gl~fll  112 (147)
                      .+++.+|+. +.-..-++.+--|+..+.
T Consensus        85 ~l~~~lg~~~v~liNDfeA~a~gl~~L~  112 (316)
T PF02685_consen   85 ELAQRLGIPRVRLINDFEAQAYGLPALD  112 (316)
T ss_dssp             HCHCCCT-TCEEEEEHHHHHHHHHHHHH
T ss_pred             HHHHHhCCceEEEEcccchheeccCCCC
Confidence            566777875 777888888888887765


No 65 
>PRK09557 fructokinase; Reviewed
Probab=30.12  E-value=46  Score=27.34  Aligned_cols=26  Identities=12%  Similarity=0.143  Sum_probs=21.5

Q ss_pred             HHHHHcCCceeeechhhhhhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRGMLFI  111 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~Gl~fl  111 (147)
                      .+++.+|+.+.-+..-.|...|-.+.
T Consensus        91 ~l~~~~~~pv~~~NDa~aaA~aE~~~  116 (301)
T PRK09557         91 DLSARLNREVRLANDANCLAVSEAVD  116 (301)
T ss_pred             HHHHHHCCCEEEccchhHHHHHHHHh
Confidence            46788899999999999988887665


No 66 
>PLN02295 glycerol kinase
Probab=30.02  E-value=43  Score=30.00  Aligned_cols=17  Identities=18%  Similarity=0.432  Sum_probs=14.7

Q ss_pred             eEEeecCceeEEEEeee
Q psy3290           4 FGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~   20 (147)
                      +|||||.|-+|.+=|..
T Consensus         3 lgID~GTts~Ka~l~d~   19 (512)
T PLN02295          3 GAIDQGTTSTRFIIYDR   19 (512)
T ss_pred             EEEecCCCceEEEEECC
Confidence            69999999999877764


No 67 
>PF06706 CTV_P6:  Citrus tristeza virus 6-kDa protein;  InterPro: IPR009584 This family consists of several Citrus tristeza virus (CTV) 6 kDa, 51 residue long hydrophobic (P6) proteins. The function of this family is unknown.
Probab=29.71  E-value=26  Score=22.39  Aligned_cols=9  Identities=56%  Similarity=1.424  Sum_probs=7.5

Q ss_pred             hhhhhhhhh
Q psy3290         101 LDCLIRGML  109 (147)
Q Consensus       101 MecLI~Gl~  109 (147)
                      |||+|+|..
T Consensus         1 MDCVIQGfL    9 (51)
T PF06706_consen    1 MDCVIQGFL    9 (51)
T ss_pred             CchhHHHHH
Confidence            899999943


No 68 
>PRK10331 L-fuculokinase; Provisional
Probab=29.48  E-value=45  Score=29.42  Aligned_cols=18  Identities=17%  Similarity=0.246  Sum_probs=15.0

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||.|-+|.+=|..
T Consensus         4 ~lgID~GTt~~Ka~l~d~   21 (470)
T PRK10331          4 ILVLDCGATNVRAIAVDR   21 (470)
T ss_pred             EEEEecCCCceEEEEEcC
Confidence            378999999999887754


No 69 
>PF02541 Ppx-GppA:  Ppx/GppA phosphatase family;  InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3.6.1.11 from EC and guanosine pentaphosphate phosphatase (GppA) 3.6.1.40 from EC belong to the sugar kinase/actin/hsp70 superfamily [].; PDB: 3MDQ_A 1U6Z_A 1T6D_B 2J4R_B 1T6C_A 2FLO_B 3CER_B 3HI0_A.
Probab=29.48  E-value=55  Score=26.80  Aligned_cols=19  Identities=37%  Similarity=0.606  Sum_probs=16.8

Q ss_pred             CceEEeecCceeEEEEeee
Q psy3290           2 PWFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~   20 (147)
                      +.+-+||||-.+-+++++.
T Consensus       113 ~~lviDIGGGStEl~~~~~  131 (285)
T PF02541_consen  113 NGLVIDIGGGSTELILFEN  131 (285)
T ss_dssp             SEEEEEEESSEEEEEEEET
T ss_pred             CEEEEEECCCceEEEEEEC
Confidence            4678999999999999965


No 70 
>PRK00290 dnaK molecular chaperone DnaK; Provisional
Probab=29.21  E-value=47  Score=30.73  Aligned_cols=19  Identities=32%  Similarity=0.422  Sum_probs=17.0

Q ss_pred             CceEEeecCceeEEEEeee
Q psy3290           2 PWFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~   20 (147)
                      +.+|||.|.|.+++.|+.+
T Consensus         3 ~viGIDlGTt~s~va~~~~   21 (627)
T PRK00290          3 KIIGIDLGTTNSCVAVMEG   21 (627)
T ss_pred             cEEEEEeCcccEEEEEEEC
Confidence            4799999999999999964


No 71 
>PHA02744 hypothetical protein; Provisional
Probab=28.43  E-value=50  Score=23.70  Aligned_cols=16  Identities=31%  Similarity=0.478  Sum_probs=13.8

Q ss_pred             EEeecCceeEEEEeee
Q psy3290           5 GMDIGGTLSKLVYFEP   20 (147)
Q Consensus         5 aiDIGGTL~KlVYf~~   20 (147)
                      .+-|||.-|||.|+-.
T Consensus        47 ~~~i~gVTAkL~y~~~   62 (88)
T PHA02744         47 NTNIAGVSTKLEYNDL   62 (88)
T ss_pred             eEEEccEEEEEEEcCC
Confidence            4679999999999875


No 72 
>CHL00094 dnaK heat shock protein 70
Probab=28.42  E-value=51  Score=30.55  Aligned_cols=19  Identities=32%  Similarity=0.412  Sum_probs=16.9

Q ss_pred             CceEEeecCceeEEEEeee
Q psy3290           2 PWFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~   20 (147)
                      +.+|||+|.|.++++++.+
T Consensus         3 ~viGIDlGTt~s~va~~~~   21 (621)
T CHL00094          3 KVVGIDLGTTNSVVAVMEG   21 (621)
T ss_pred             ceEEEEeCcccEEEEEEEC
Confidence            5799999999999999864


No 73 
>PTZ00294 glycerol kinase-like protein; Provisional
Probab=28.35  E-value=48  Score=29.60  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=15.1

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||.|-+|.+=|..
T Consensus         4 ~lgiDiGTts~Ka~l~d~   21 (504)
T PTZ00294          4 IGSIDQGTTSTRFIIFDE   21 (504)
T ss_pred             EEEEecCCCceEEEEECC
Confidence            468999999999877765


No 74 
>TIGR02628 fuculo_kin_coli L-fuculokinase. Members of this family are L-fuculokinase, from the clade that includes the L-fuculokinase of Escherichia coli. This enzyme catalyzes the second step in fucose catabolism. This family belongs to FGGY family of carbohydrate kinases (pfam02782, pfam00370). It is encoded by the kinase (K) gene of the fucose (fuc) operon.
Probab=28.08  E-value=50  Score=29.15  Aligned_cols=18  Identities=17%  Similarity=0.270  Sum_probs=15.3

Q ss_pred             eEEeecCceeEEEEeeeC
Q psy3290           4 FGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~~   21 (147)
                      +|||||.|-+|.+=|...
T Consensus         4 lgiD~GTss~K~~l~d~~   21 (465)
T TIGR02628         4 LVLDCGATNLRAIAINRQ   21 (465)
T ss_pred             EEEecCCCcEEEEEEcCC
Confidence            689999999998877753


No 75 
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional
Probab=28.02  E-value=49  Score=29.65  Aligned_cols=19  Identities=21%  Similarity=0.370  Sum_probs=15.9

Q ss_pred             ceEEeecCceeEEEEeeeC
Q psy3290           3 WFGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~   21 (147)
                      .+|||||.|-+|.+=|...
T Consensus         5 ~lgID~GTts~Ka~l~d~~   23 (520)
T PRK10939          5 LMALDAGTGSIRAVIFDLN   23 (520)
T ss_pred             EEEEecCCCceEEEEECCC
Confidence            4789999999998877753


No 76 
>PRK04123 ribulokinase; Provisional
Probab=27.93  E-value=52  Score=29.68  Aligned_cols=18  Identities=17%  Similarity=0.351  Sum_probs=15.8

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+|||||.|-+|.+=|..
T Consensus         5 ~lgiD~GTts~Ka~l~d~   22 (548)
T PRK04123          5 VIGLDFGTDSVRALLVDC   22 (548)
T ss_pred             EEEEecCCCceEEEEEEC
Confidence            579999999999888873


No 77 
>PRK13322 pantothenate kinase; Reviewed
Probab=27.49  E-value=54  Score=26.95  Aligned_cols=18  Identities=17%  Similarity=0.228  Sum_probs=16.5

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .+.||||=|-+|...|+.
T Consensus         2 ~L~IDiGNT~iK~~l~~~   19 (246)
T PRK13322          2 ILELDCGNSRLKWRVIDN   19 (246)
T ss_pred             EEEEEeCCCcEEEEEEcC
Confidence            578999999999999995


No 78 
>PRK13326 pantothenate kinase; Reviewed
Probab=26.72  E-value=63  Score=26.96  Aligned_cols=18  Identities=22%  Similarity=0.361  Sum_probs=16.3

Q ss_pred             ceEEeecCceeEEEEeee
Q psy3290           3 WFGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~   20 (147)
                      .++||||=|-+|+..|+-
T Consensus         8 ~L~IDiGNT~ik~glf~~   25 (262)
T PRK13326          8 QLIIDIGNTSISFALYKD   25 (262)
T ss_pred             EEEEEeCCCeEEEEEEEC
Confidence            478999999999999985


No 79 
>PRK15080 ethanolamine utilization protein EutJ; Provisional
Probab=26.15  E-value=50  Score=27.20  Aligned_cols=19  Identities=21%  Similarity=0.345  Sum_probs=16.0

Q ss_pred             ceEEeecCceeEEEEeeeC
Q psy3290           3 WFGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~   21 (147)
                      ..|||||.|-+|+|=.+..
T Consensus        26 ~~~iDiGSssi~~vv~~~~   44 (267)
T PRK15080         26 KVGVDLGTANIVLAVLDED   44 (267)
T ss_pred             EEEEEccCceEEEEEEcCC
Confidence            3699999999998887753


No 80 
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase). This alignment models one branch of the ROK superfamily of proteins. The three members of the seed alignment for this model all have experimental evidence for activity as glucokinase, but the set of related proteins is crowded with paralogs of different or unknown function. Proteins scoring above the trusted_cutoff will show strong similarity to at least one known glucokinase and may be designated as putative glucokinases. However, definitive identification of glucokinases should be done only with extreme caution.
Probab=26.02  E-value=57  Score=26.79  Aligned_cols=27  Identities=7%  Similarity=-0.048  Sum_probs=21.7

Q ss_pred             HHHHHcCCceeeechhhhhhhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRGMLFIE  112 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~Gl~fll  112 (147)
                      .+++++|+.+.-+..-.|...|-.+.-
T Consensus        92 ~l~~~~~~pv~v~NDa~~~alaE~~~g  118 (318)
T TIGR00744        92 KVEARVGLPVVVENDANAAALGEYKKG  118 (318)
T ss_pred             HHHHHHCCCEEEechHHHHHHHHHHhc
Confidence            467889999999999999888766553


No 81 
>PF06277 EutA:  Ethanolamine utilisation protein EutA;  InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon. The holoenzyme of adenosylcobalamin-dependent ethanolamine ammonia-lyase (EutBC, IPR0092462 from INTERPRO, IPR010628 from INTERPRO), which is part of the ethanolamine utilization pathway [, , ], undergoes suicidal inactivation during catalysis as well as inactivation in the absence of substrate. The inactivation involves the irreversible cleavage of the Co-C bond of the coenzyme. The inactivated holoenzyme undergoes rapid and continuous reactivation in the presence of ATP, Mg2+, and free adenosylcobalamin in permeabilised cells (in situ), homogenate, and cell extracts of Escherichia coli. The EutA protein is essential for reactivation. It was demonstrated with purified recombinant EutA that both the suicidally inactivated and O2-inactivated holoethanolamine ammonia lyase underwent rapid reactivation in vitro by EutA in the presence of adenosylcobalamin, ATP, and Mg2+ []. The inactive enzyme-cyanocobalamin complex was also activated in situ and in vitro by EutA under the same conditions. Thus EutA is believed to be the only component of the reactivating factor for ethanolamine ammonia lyase. Reactivation and activation occur through the exchange of modified coenzyme for free intact adenosylcobalamin []. Bacteria that harbor the ethanolamine utilization pathway can use ethanolamine as a source of carbon and nitrogen. For more information on the ethanolamine utilization pathway, please see IPR009194 from INTERPRO, IPR012408 from INTERPRO.
Probab=25.65  E-value=48  Score=30.47  Aligned_cols=17  Identities=35%  Similarity=0.655  Sum_probs=14.6

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      ..|||||.|-++||+-.
T Consensus         5 SVGIDIGTSTTQlvfSr   21 (473)
T PF06277_consen    5 SVGIDIGTSTTQLVFSR   21 (473)
T ss_pred             EEEEeecCCceeEEEEE
Confidence            47999999999998755


No 82 
>COG0837 Glk Glucokinase [Carbohydrate transport and metabolism]
Probab=24.77  E-value=87  Score=27.44  Aligned_cols=44  Identities=27%  Similarity=0.501  Sum_probs=26.8

Q ss_pred             CceEEeecCceeEEEEeeeCCCCCCchh----hHHHHHH-HHHHHhhhc
Q psy3290           2 PWFGMDIGGTLSKLVYFEPKDITPDEAN----SEIETLK-NIRKYLTKN   45 (147)
Q Consensus         2 p~faiDIGGTL~KlVYf~~~~~~~~~~~----~e~~~l~-~i~~~l~~n   45 (147)
                      |.+.=|||||-+.+.-.++...++...+    .+=.++. .+++||.+.
T Consensus         7 p~LvgDIGGTnaRfaLv~~a~~~~~~~~~~~~~dypsle~av~~yl~~~   55 (320)
T COG0837           7 PRLVGDIGGTNARFALVEIAPAEPLQAETYACADYPSLEEAVQDYLSEH   55 (320)
T ss_pred             ceEEEecCCcceEEEEeccCCCCccccceecccCcCCHHHHHHHHHHHh
Confidence            6667799999999888776543222211    1222232 388999555


No 83 
>PF06406 StbA:  StbA protein;  InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA []. They are involved in the control of plasmid partition and required for the accurate segregation of the plasmid. ; PDB: 3IKY_C 3IKU_I 2ZGZ_B 1MWM_A 1MWK_A 2ZHC_A 2ZGY_A 2QU4_A.
Probab=24.48  E-value=70  Score=26.97  Aligned_cols=18  Identities=33%  Similarity=0.532  Sum_probs=14.4

Q ss_pred             eEEeecCceeEEEEeeeC
Q psy3290           4 FGMDIGGTLSKLVYFEPK   21 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~~   21 (147)
                      +++|-|-|-+||+|++..
T Consensus         3 i~iDdG~~~~K~~~~~~~   20 (318)
T PF06406_consen    3 IAIDDGSTNVKLAWYEDG   20 (318)
T ss_dssp             EEEEE-SSEEEEEEE-SS
T ss_pred             EEEecCCCceeEEEecCC
Confidence            799999999999999743


No 84 
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=24.06  E-value=55  Score=22.45  Aligned_cols=26  Identities=23%  Similarity=0.533  Sum_probs=18.5

Q ss_pred             EEEeeeCCCCCCchhhHHHHHHHHHHHhhhccc
Q psy3290          15 LVYFEPKDITPDEANSEIETLKNIRKYLTKNKA   47 (147)
Q Consensus        15 lVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~   47 (147)
                      +.|++|.+       ..-++..++.+||.+|..
T Consensus        30 V~Y~sP~G-------kklRs~~ev~~YL~~~~~   55 (77)
T smart00391       30 VYYISPCG-------KKLRSKSELARYLHKNGD   55 (77)
T ss_pred             EEEECCCC-------CeeeCHHHHHHHHHhCCC
Confidence            67888865       245567889999977653


No 85 
>TIGR01174 ftsA cell division protein FtsA. This bacterial cell division protein interacts with FtsZ, the bacterial homolog of tubulin. It is an ATP-binding protein and shows structural similarities to actin and heat shock cognate protein 70.
Probab=24.04  E-value=58  Score=27.76  Aligned_cols=17  Identities=29%  Similarity=0.370  Sum_probs=14.4

Q ss_pred             eEEeecCceeEEEEeee
Q psy3290           4 FGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~   20 (147)
                      .|+|||-|-+|+|=-+.
T Consensus         3 ~~lDIGs~~ik~vv~~~   19 (371)
T TIGR01174         3 VGLDIGTSKICAIVAEV   19 (371)
T ss_pred             EEEEeccceEEEEEEEE
Confidence            59999999999886554


No 86 
>PF00480 ROK:  ROK family;  InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames []. This family, known as ROK (Repressor, ORF, Kinase) includes the xylose operon repressor, xylR, from Bacillus subtilis, Lactobacillus pentosus and Staphylococcus xylosus; N-acetylglucosamine repressor, nagC, from Escherichia coli; glucokinase 2.7.1.2 from EC from Streptomyces coelicolor; fructokinase 2.7.1.4 from EC from Pediococcus pentosaceus, Streptococcus mutans and Zymomonas mobilis; allokinase 2.7.1.55 from EC and mlc from E. coli; and E. coli hypothetical proteins yajF and yhcI and the corresponding Haemophilus influenzae proteins. The repressor proteins (xylR and nagC) from this family possess an N-terminal region not present in the sugar kinases and which contains an helix-turn-helix DNA-binding motif.; PDB: 2GUP_A 3LM2_B 3EO3_A 2YHY_A 2YHW_A 2YI1_A 3MCP_A 1Z05_A 3HTV_A 3OHR_A ....
Probab=24.02  E-value=75  Score=23.59  Aligned_cols=28  Identities=4%  Similarity=-0.026  Sum_probs=23.7

Q ss_pred             HHHHHcCCceeeechhhhhhhhhhhhhh
Q psy3290          86 MRIQEVNMKLEKCDELDCLIRGMLFIEA  113 (147)
Q Consensus        86 ~f~~~lgv~l~k~DEMecLI~Gl~fll~  113 (147)
                      .+++.+++.+.-+....|...|-.++-.
T Consensus        86 ~l~~~~~~pv~i~Nd~~~~a~ae~~~~~  113 (179)
T PF00480_consen   86 ELEERFGVPVIIENDANAAALAEYWFGA  113 (179)
T ss_dssp             HHHHHHTSEEEEEEHHHHHHHHHHHHST
T ss_pred             HhhcccceEEEEecCCCcceeehhhcCc
Confidence            6788999999999999999988766543


No 87 
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=22.91  E-value=62  Score=20.94  Aligned_cols=25  Identities=20%  Similarity=0.566  Sum_probs=17.1

Q ss_pred             EEEeeeCCCCCCchhhHHHHHHHHHHHhhhcc
Q psy3290          15 LVYFEPKDITPDEANSEIETLKNIRKYLTKNK   46 (147)
Q Consensus        15 lVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~   46 (147)
                      +.|++|.+       .+-++..++.+||.++.
T Consensus        27 v~Y~sP~G-------k~~Rs~~ev~~yL~~~~   51 (62)
T cd00122          27 VYYYSPCG-------KKLRSKPEVARYLEKTG   51 (62)
T ss_pred             EEEECCCC-------ceecCHHHHHHHHHhCC
Confidence            55667654       24566788999997663


No 88 
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]
Probab=22.81  E-value=35  Score=29.61  Aligned_cols=17  Identities=41%  Similarity=0.749  Sum_probs=13.4

Q ss_pred             CCceEEeecCceeEEEE
Q psy3290           1 MPWFGMDIGGTLSKLVY   17 (147)
Q Consensus         1 ~p~faiDIGGTL~KlVY   17 (147)
                      |-.+|+||||--+|+.=
T Consensus         3 ~kilGiDIGGAntk~a~   19 (330)
T COG1548           3 MKILGIDIGGANTKIAS   19 (330)
T ss_pred             ceEEEeeccCccchhhh
Confidence            34689999999998653


No 89 
>TIGR01234 L-ribulokinase L-ribulokinase. This enzyme catalyzes the second step in arabinose catabolism. The most closely related protein subfamily outside the scope of this model includes ribitol kinase from E. coli.
Probab=22.75  E-value=75  Score=28.67  Aligned_cols=17  Identities=18%  Similarity=0.348  Sum_probs=15.5

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      .+|||+|.|-+|.+=|.
T Consensus         3 ~lgiD~GTss~Ka~l~d   19 (536)
T TIGR01234         3 AIGVDFGTLSGRALAVD   19 (536)
T ss_pred             EEEEecCCCceEEEEEE
Confidence            47999999999999888


No 90 
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional
Probab=22.47  E-value=73  Score=29.36  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=14.2

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      ..|||||.|-++||+-+
T Consensus         8 SVGIDIGTsTTqlvfSr   24 (475)
T PRK10719          8 SVGIDIGTTTTQVIFSR   24 (475)
T ss_pred             EEEEeccCceEEEEEEE
Confidence            36999999999998744


No 91 
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]
Probab=21.51  E-value=55  Score=31.22  Aligned_cols=17  Identities=24%  Similarity=0.368  Sum_probs=14.5

Q ss_pred             ceEEeecCceeEEEEee
Q psy3290           3 WFGMDIGGTLSKLVYFE   19 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~   19 (147)
                      .+++|||||-+++.=+.
T Consensus       280 ~i~~DmGGTStDva~i~  296 (674)
T COG0145         280 AIVFDMGGTSTDVALII  296 (674)
T ss_pred             EEEEEcCCcceeeeeee
Confidence            46899999999988666


No 92 
>PTZ00107 hexokinase; Provisional
Probab=21.26  E-value=83  Score=28.62  Aligned_cols=20  Identities=25%  Similarity=0.529  Sum_probs=16.0

Q ss_pred             ceEEeecCceeEEEEeeeCC
Q psy3290           3 WFGMDIGGTLSKLVYFEPKD   22 (147)
Q Consensus         3 ~faiDIGGTL~KlVYf~~~~   22 (147)
                      .+|||.|||--+++-.+=.+
T Consensus        76 fLAlDlGGTN~RV~~V~L~g   95 (464)
T PTZ00107         76 YYAIDFGGTNFRAVRVSLRG   95 (464)
T ss_pred             EEEEecCCceEEEEEEEeCC
Confidence            57999999999977766543


No 93 
>COG1799 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.25  E-value=1.9e+02  Score=23.00  Aligned_cols=51  Identities=18%  Similarity=0.338  Sum_probs=36.0

Q ss_pred             ecCceeEEEEeeeCCCCCCchhhHHHHHHHHHHHhhhcccCCCCCcccccceeecceeeEEEEEecchhhHHHHHHHH
Q psy3290           8 IGGTLSKLVYFEPKDITPDEANSEIETLKNIRKYLTKNKAYGSTGHRDTHLQVLYTTLTLLCIELISDDTVVDFIRVI   85 (147)
Q Consensus         8 IGGTL~KlVYf~~~~~~~~~~~~e~~~l~~i~~~l~~n~~yg~~g~rd~~le~~~~t~~LhFikFeT~~~i~~fi~~~   85 (147)
                      ++-+.+|+|..+|+...  +       ...|-.+|..+.                 .+.++|....-.. -.+|++|+
T Consensus        69 ~~~~~s~iv~~ePr~ye--d-------a~~ia~~lk~~k-----------------~Vvinl~~m~~~q-ArRivDFl  119 (167)
T COG1799          69 AAQDSSKIVLLEPRKYE--D-------AQEIADYLKNRK-----------------AVVINLQRMDPAQ-ARRIVDFL  119 (167)
T ss_pred             ccCCceEEEEecCccHH--H-------HHHHHHHHhcCc-----------------eEEEEeeeCCHHH-HHHHHHHh
Confidence            45788999999998752  2       345667773332                 3577777777776 77899988


No 94 
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain. This domain is a member of the haloacid-dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. This superfamily is distinguished by the presence of three motifs: an N-terminal motif containing the nucleophilic aspartate, a central motif containing an conserved serine or threonine, and a C-terminal motif containing a conserved lysine (or arginine) and conserved aspartates. More specifically, the domian modelled here is a member of subfamily III of the HAD-superfamily by virtue of lacking a "capping" domain in either of the two common positions, between motifs 1 and 2, or between motifs 2 and 3.
Probab=20.63  E-value=60  Score=23.82  Aligned_cols=13  Identities=23%  Similarity=0.450  Sum_probs=11.0

Q ss_pred             CceEEeecCceeE
Q psy3290           2 PWFGMDIGGTLSK   14 (147)
Q Consensus         2 p~faiDIGGTL~K   14 (147)
                      |-+.+|++|||+.
T Consensus         1 ~~~~~d~dgtl~~   13 (147)
T TIGR01656         1 PALFLDRDGVINE   13 (147)
T ss_pred             CeEEEeCCCceec
Confidence            5688999999985


No 95 
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein. This protein family was identified, by the method of partial phylogenetic profiling, as related to the use of tetrahydromethanopterin (H4MPT) as a C-1 carrier. Characteristic markers of the H4MPT-linked C1 transfer pathway include formylmethanofuran dehydrogenase subunits, methenyltetrahydromethanopterin cyclohydrolase, etc. Tetrahydromethanopterin, a tetrahydrofolate analog, occurs in methanogenic archaea, bacterial methanotrophs, planctomycetes, and a few other lineages.
Probab=20.23  E-value=61  Score=28.10  Aligned_cols=17  Identities=35%  Similarity=0.700  Sum_probs=14.7

Q ss_pred             eEEeecCceeEEEEeee
Q psy3290           4 FGMDIGGTLSKLVYFEP   20 (147)
Q Consensus         4 faiDIGGTL~KlVYf~~   20 (147)
                      +|+||||--.|++...+
T Consensus         1 ~G~DiGGA~~K~a~~~~   17 (318)
T TIGR03123         1 LGIDIGGANTKAAELDE   17 (318)
T ss_pred             CccccccceeeeEEecC
Confidence            58999999999997764


Done!