BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3292
         (213 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1JJ2|L Chain L, Fully Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution
 pdb|1KQS|L Chain L, The Haloarcula Marismortui 50s Complexed With A
           Pretranslocational Intermediate In Protein Synthesis
 pdb|1K8A|N Chain N, Co-Crystal Structure Of Carbomycin A Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1K9M|N Chain N, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal
           Subunit Of Haloarcula Marismortui
 pdb|1KD1|N Chain N, Co-crystal Structure Of Spiramycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M1K|N Chain N, Co-Crystal Structure Of Azithromycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M90|N Chain N, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
           Sparsomycin Bound To The 50s Ribosomal Subunit
 pdb|1K73|N Chain N, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|1KC8|N Chain N, Co-Crystal Structure Of Blasticidin S Bound To The 50s
           Ribosomal Subunit
 pdb|1N8R|N Chain N, Structure Of Large Ribosomal Subunit In Complex With
           Virginiamycin M
 pdb|1NJI|N Chain N, Structure Of Chloramphenicol Bound To The 50s Ribosomal
           Subunit
 pdb|1Q7Y|N Chain N, Crystal Structure Of Ccdap-puromycin Bound At The Peptidyl
           Transferase Center Of The 50s Ribosomal Subunit
 pdb|1Q81|N Chain N, Crystal Structure Of Minihelix With 3' Puromycin Bound To
           A- Site Of The 50s Ribosomal Subunit.
 pdb|1Q82|N Chain N, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
           The 50s Ribosomal Subunit
 pdb|1Q86|N Chain N, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
           Simultaneously At Half Occupancy To Both The A-Site And
           P- Site Of The The 50s Ribosomal Subunit.
 pdb|1QVF|L Chain L, Structure Of A Deacylated Trna Minihelix Bound To The E
           Site Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1QVG|L Chain L, Structure Of Cca Oligonucleotide Bound To The Trna Binding
           Sites Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1W2B|L Chain L, Trigger Factor Ribosome Binding Domain In Complex With 50s
 pdb|3CXC|L Chain L, The Structure Of An Enhanced Oxazolidinone Inhibitor Bound
           To The 50s Ribosomal Subunit Of H. Marismortui
 pdb|3OW2|L Chain L, Crystal Structure Of Enhanced Macrolide Bound To 50s
           Ribosomal Subunit
          Length = 194

 Score = 31.6 bits (70), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 17/68 (25%)

Query: 70  MLCDRIGRKWTLLSTAT------------LSAFSVGQ--TFGWSSPVLAYLVSPDSPVPM 115
           M+ +RI RK  +   A             L+++SVG+     W   +L   + PD P   
Sbjct: 86  MMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVIL---IDPDHPAIK 142

Query: 116 SEDESSWV 123
           S+D+ SW+
Sbjct: 143 SDDQLSWI 150


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.134    0.446 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,478,027
Number of Sequences: 62578
Number of extensions: 247770
Number of successful extensions: 493
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 493
Number of HSP's gapped (non-prelim): 2
length of query: 213
length of database: 14,973,337
effective HSP length: 95
effective length of query: 118
effective length of database: 9,028,427
effective search space: 1065354386
effective search space used: 1065354386
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)