BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy333
         (70 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3S27|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S27|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications
          Length = 816

 Score = 26.9 bits (58), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 19 NEVLPYLSRRATENKGVLE--KISKEKKLLRQEILRRIKSGKLF 60
          NEVL  LSR   + KG+L+  +I  E + L ++  ++++ G  F
Sbjct: 27 NEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTRKKLEGGPFF 70


>pdb|2G37|A Chain A, Structure Of Thermus Thermophilus L-Proline Dehydrogenase
 pdb|2G37|B Chain B, Structure Of Thermus Thermophilus L-Proline Dehydrogenase
          Length = 327

 Score = 26.6 bits (57), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%)

Query: 3   GQAGYSAYKYIPYGPVNEVLPYLSRRATE 31
            + GY+   Y+PYG   +  PYL+RR  E
Sbjct: 286 AREGYTVRAYVPYG--RDWYPYLTRRIAE 312


>pdb|2EKG|A Chain A, Structure Of Thermus Thermophilus Proline Dehydrogenase
           Inactivated By N-propargylglycine
 pdb|2EKG|B Chain B, Structure Of Thermus Thermophilus Proline Dehydrogenase
           Inactivated By N-propargylglycine
          Length = 327

 Score = 26.6 bits (57), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%)

Query: 3   GQAGYSAYKYIPYGPVNEVLPYLSRRATE 31
            + GY+   Y+PYG   +  PYL+RR  E
Sbjct: 286 AREGYTVRAYVPYG--RDWYPYLTRRIAE 312


>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex
          With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From
          Arabidopsis Thaliana And Its Functional Implications
          Length = 816

 Score = 25.4 bits (54), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 19 NEVLPYLSRRATENKGVLE--KISKEKKLLRQEILRRIKSGKLF 60
          NEVL  LSR   + KG+L+  +I  E + L ++  ++++ G  F
Sbjct: 27 NEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTRKKLEGGPFF 70


>pdb|3L4B|C Chain C, Crystal Structure Of An Octomeric Two-Subunit Trka K+
           Channel Ring Gating Assembly, Tm1088a:tm1088b, From
           Thermotoga Maritima
 pdb|3L4B|D Chain D, Crystal Structure Of An Octomeric Two-Subunit Trka K+
           Channel Ring Gating Assembly, Tm1088a:tm1088b, From
           Thermotoga Maritima
 pdb|3L4B|G Chain G, Crystal Structure Of An Octomeric Two-Subunit Trka K+
           Channel Ring Gating Assembly, Tm1088a:tm1088b, From
           Thermotoga Maritima
 pdb|3L4B|H Chain H, Crystal Structure Of An Octomeric Two-Subunit Trka K+
           Channel Ring Gating Assembly, Tm1088a:tm1088b, From
           Thermotoga Maritima
          Length = 218

 Score = 25.4 bits (54), Expect = 8.0,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 17  PVNEVLPYLSRRATENKGVLEKISKEKKLLRQEILRRIKSGKLFYTPKG 65
           P+ + + +LS    E+  V+ K  K+  L R  I+  I  G +   P+G
Sbjct: 141 PLEQGIEFLSVNVEEDSPVVGKKLKDLPLPRDSIIAAIVRGGVLVVPRG 189


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.137    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,265,293
Number of Sequences: 62578
Number of extensions: 72979
Number of successful extensions: 155
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 152
Number of HSP's gapped (non-prelim): 7
length of query: 70
length of database: 14,973,337
effective HSP length: 40
effective length of query: 30
effective length of database: 12,470,217
effective search space: 374106510
effective search space used: 374106510
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)