Diaphorina citri psyllid: psy3345

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------

MFNHLSGPVVPRNHISLLDLDEVEFIYKITQEQLKAKFEEKGTVTDVQLKYTTEGKFRRFAFIGYHREDQAQAALDYFNNTYVFSSRIKVEKCSNLGDTTKPKSWSKYAPDSSAYQKLHNIAPKQDLKPEHTKDSKPGKKSKNDPTFSDFLQLHGKDVSKLLPLSNKDGEEKEEENEDESNNQIAHADISDMEYLKLKTKSKDTAPSDPSVPPVSKAPVHKRQYHTIVVKNLPAGVKKKDLKAYFKPLPLASVRTTFLGMAYIGFKDEKNCNKALNKNKSFWKGKQLNIYKYSKDNSAKYSGAADDNNNASMENIKAKHWKSQEDSVQFAEDIAESGRIFVRNLSYTVTEDDLTKLFEKYGPLAEVILPIDKETDKTKGFALVTFLMPEHATQAYQHLDGTVFLGRMLHLIPGKPKENEGNVDGKVHCCISERKLDAFNQVVEARSKRIILVKNLPYRTLPTDLKALFEPFGDLGRVLVPPYGITGLVEFLQKNQAKAAFNSLAYTKFKEVPLYLEWAPEGVFAEAKEKSKGKEKEKNEEEGEEGEEEKKENTAEEDNQQGVPEVEENVEEDEEREPEPDTTLYIKNLNFNSTEDSIRRHFKKCGPIASVTVARKKDPKSPGQFLSMGYGFVQFYTRESLNQALKVLQNSSLDEHQIELKRSNRNLESEATTVKRKSSNVAKQTGSKILVRNIPFQAKQSEVEELFKAFGELKFVRLPKKMVGSGLHRGFGFVEFITKNEAKRAMKALCQSTHLYGRRLVLEWAEEADNVEDIRKRTNRYFGTAVGL

cccccccccccccccEEcccccccccccccHHHHHHHHcccccEEEEEEEEccccccccEEEEECccHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHccccHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccEEEEccccccccHHHHHHHHccccccccccccccEEEEccccHHHHHHHHHccccccccCEEEEEcccccccccccccccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHHcccccEEEEcccccccccCEEEEEEEccHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccHHHHccHHHHHHHcccccHHHccccccccHHHHHHHHcccccEEEEEccccccEEEEEEccHHHHHHHHHHHcccccccCEEEEEccccccHHHHHHHHccccccccccccccccHHHcccccHccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccEEEEEEEccccccccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEccHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHccccc

********VVPRNHISLLDLDEVEFIYKITQEQLKAKFEEKGTVTDVQLKYTTEGKFRRFAFIGYHREDQAQAALDYFNNTYVFSSRIKVEKCSN***********************************************NDPTFSDFLQLHGKDVSKLLPLSNKDGEEK*************************************************RQYHTIVVKNLPAGVKKKDLKAYFKPLPLASVRTTFLGMAYIGFKDEKNCNKALNKNKSFWKGKQLNIYKY*************************************AEDIAESGRIFVRNLSYTVTEDDLTKLFEKYGPLAEVILPIDKETDKTKGFALVTFLMPEHATQAYQHLDGTVFLGRMLHLIPGKP***EGNVDGKVHCCISERKLDAFNQVVEARSKRIILVKNLPYRTLPTDLKALFEPFGDLGRVLVPPYGITGLVEFLQKNQAKAAFNSLAYTKFKEVPLYLEWAPEGVF********************************************************DTTLYIKNLNFNSTEDSIRRHFKKCGPIASVTV***********FLSMGYGFVQFYTRESLNQALKVLQNSSLDEHQI******************************ILVRNIPFQAKQSEVEELFKAFGELKFVRLPKKMVGSGLHRGFGFVEFITKNEAKRAMKALCQSTHLYGRRLVLEWAEEADNVEDIRKRTNRYF******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFNHLSGPVVPRNHISLLDLDEVEFIYKITQEQLKAKFEEKGTVTDVQLKYTTEGKFRRFAFIGYHREDQAQAALDYFNNTYVFSSRIKVEKCSNLGDTTKPKSWSKYAPDSSAYQKLHNIAPKQDLKPEHTKDSKPGKKSKNDPTFSDFLQLHGKDVSKLLPLSNKDGEEKEEENEDESNNQIAHADISDMEYLKLKTKSKDTAPSDPSVPPVSKAPVHKRQYHTIVVKNLPAGVKKKDLKAYFKPLPLASVRTTFLGMAYIGFKDEKNCNKALNKNKSFWKGKQLNIYKYSKDNSAKYSGAADDNNNASMENIKAKHWKSQEDSVQFAEDIAESGRIFVRNLSYTVTEDDLTKLFEKYGPLAEVILPIDKETDKTKGFALVTFLMPEHATQAYQHLDGTVFLGRMLHLIPGKPKENEGNVDGKVHCCISERKLDAFNQVVEARSKRIILVKNLPYRTLPTDLKALFEPFGDLGRVLVPPYGITGLVEFLQKNQAKAAFNSLAYTKFKEVPLYLEWAPEGVxxxxxxxxxxxxxxxxxxxxxEGEEEKKENTAEEDNQQGVPEVEENVEEDEEREPEPDTTLYIKNLNFNSTEDSIRRHFKKCGPIASVTVARKKDPKSPGQFLSMGYGFVQFYTRESLNQALKVLQNSSxxxxxxxxxxxxxxxxxxxxxVKRKSSNVAKQTGSKILVRNIPFQAKQSEVEELFKAFGELKFVRLPKKMVGSGLHRGFGFVEFITKNEAKRAMKALCQSTHLYGRRLVLEWAEEADNVEDIRKRTNRYFGTAVGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable RNA-binding protein 19	Plays a role in embryo pre-implantation development.	confident	Q8R3C6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044428 [CC]	nuclear part	probable	GO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006417 [BP]	regulation of translation	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0030529 [CC]	ribonucleoprotein complex	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 333-415,447-523,574-667
View the alignment between query and template
View the model in PyMOL

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 443-520,580-667,679-778
View the alignment between query and template
View the model in PyMOL

Template: 2QFJ, chain A
Confidence level:very confident
Coverage over the Query: 334-420,435-521
View the alignment between query and template
View the model in PyMOL

Template: 2KN4, chain A
Confidence level:very confident
Coverage over the Query: 257-299,319-416
View the alignment between query and template
View the model in PyMOL

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 220-294,335-414
View the alignment between query and template
View the model in PyMOL

Template: 2LEA, chain A
Confidence level:very confident
Coverage over the Query: 7-95
View the alignment between query and template
View the model in PyMOL

Template: 3TYT, chain A
Confidence level:very confident
Coverage over the Query: 446-530,541-662
View the alignment between query and template
View the model in PyMOL