RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3348
         (147 letters)



>gnl|CDD|176069 cd08687, C2_PKN-like, C2 domain in Protein kinase C-like (PKN)
          proteins.  PKN is a lipid-activated serine/threonine
          kinase.  It is a member of the protein kinase C (PKC)
          superfamily, but lacks a C1 domain. There are at least
          3 different isoforms of PKN (PRK1/PKNalpha/PAK1;
          PKNbeta, and PRK2/PAK2/PKNgamma). The C-terminal region
          contains the Ser/Thr type protein kinase domain, while
          the N-terminal region of PKN contains three
          antiparallel coiled-coil (ACC) finger domains which are
          relatively rich in charged residues and contain a
          leucine zipper-like sequence. These domains binds to
          the small GTPase RhoA.  Following these domains is a
          C2-like domain.  Its C-terminal part functions as an
          auto-inhibitory region.  PKNs are not activated by
          classical PKC activators such as diacylglycerol,
          phorbol ester or Ca2+, but instead are activated by
          phospholipids and unsaturated fatty acids. The C2
          domain was first identified in PKC. C2 domains fold
          into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 98

 Score = 99.0 bits (246), Expect = 6e-28
 Identities = 34/61 (55%), Positives = 44/61 (72%)

Query: 4  GNQAWDQRFSIDLDKSRELEIGVYWRDWRSLCGVKFLRLEEFIDDIRHGMALQLEPQGLL 63
           NQAWDQ F+++L++SRELEI VYWRDWRSLC VKFL+LE+   +++  M  QL     L
Sbjct: 31 SNQAWDQSFTLELERSRELEIAVYWRDWRSLCAVKFLKLEDERHEVQLDMEPQLCLVAEL 90

Query: 64 F 64
           
Sbjct: 91 T 91


>gnl|CDD|176071 cd08689, C2_fungal_Pkc1p, C2 domain found in protein kinase C
          (Pkc1p) in Saccharomyces cerevisiae.  This family is
          named after the protein kinase C in Saccharomyces
          cerevisiae, Pkc1p. Protein kinase C is a member of a
          family of Ser/Thr phosphotransferases that are involved
          in many cellular signaling pathways. PKC has two
          antiparallel coiled-coiled regions (ACC finger domain)
          (AKA PKC homology region 1 (HR1)/ Rho binding domain)
          upstream of the C2 domain and two C1 domains
          downstream. The C2 domain was first identified in PKC.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains,
          like those of PKC, are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 109

 Score = 34.7 bits (80), Expect = 0.003
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 3  SGNQAWDQRFSIDLDKSRELEIGVYWRDWRSL--CGVKFLRLEEFIDDIR 50
          S N  W++ F I ++K+ E E+ VY +        G+ +LRL +  ++IR
Sbjct: 42 SRNDRWNEDFEIPVEKNNEEEVIVYDKGGDQPVPVGLLWLRLSDIAEEIR 91


>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease
          inhibitor (RI)-like subfamily. LRRs are 20-29 residue
          sequence motifs present in many proteins that
          participate in protein-protein interactions and have
          different functions and cellular locations. LRRs
          correspond to structural units consisting of a beta
          strand (LxxLxLxxN/CxL conserved pattern) and an alpha
          helix. This alignment contains 12 strands corresponding
          to 11 full repeats, consistent with the extent observed
          in the subfamily acting as Ran GTPase Activating
          Proteins (RanGAP1).
          Length = 319

 Score = 29.2 bits (66), Expect = 0.61
 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 2/53 (3%)

Query: 32 RSLCG--VKFLRLEEFIDDIRHGMALQLEPQGLLFAEIKFLNPMISRKPKLQR 82
           SL G  +K  R  E +  +     L+LE   L     K L   +  +P L+ 
Sbjct: 3  LSLKGELLKTERATELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKE 55


>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
           Ca2+-binding motif present in phospholipases, protein
           kinases C, and synaptotagmins (among others). Some do
           not appear to contain Ca2+-binding sites. Particular C2s
           appear to bind phospholipids, inositol polyphosphates,
           and intracellular proteins. Unusual occurrence in
           perforin. Synaptotagmin and PLC C2s are permuted in
           sequence with respect to N- and C-terminal beta strands.
           SMART detects C2 domains using one or both of two
           profiles.
          Length = 101

 Score = 28.2 bits (63), Expect = 0.69
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 3   SGNQAWDQRFSIDLD--KSRELEIGVYWRDWRS---LCGVKFLRLEEFIDDIRHGM 53
           + N  W++ F  ++   +  ELEI VY +D        G   + L + +   RH  
Sbjct: 45  TLNPVWNETFEFEVPPPELAELEIEVYDKDRFGRDDFIGQVTIPLSDLLLGGRHEK 100


>gnl|CDD|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic
           Malate dehydrogenases.  MDH is one of the key enzymes in
           the citric acid cycle, facilitating both the conversion
           of malate to oxaloacetate and replenishing levels of
           oxalacetate by reductive carboxylation of pyruvate.
           Members of this subfamily are eukaryotic MDHs localized
           to the cytoplasm and cytosol. MDHs are part of the
           NAD(P)-binding Rossmann fold superfamily, which includes
           a wide variety of protein families including the
           NAD(P)-binding domains of alcohol dehydrogenases,
           tyrosine-dependent oxidoreductases,
           glyceraldehyde-3-phosphate dehydrogenases,
           formate/glycerate dehydrogenases, siroheme synthases,
           6-phosphogluconate dehydrogenases, aminoacid
           dehydrogenases, repressor rex, and NAD-binding potassium
           channel domains, among others.
          Length = 325

 Score = 28.0 bits (63), Expect = 2.0
 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 15/54 (27%)

Query: 76  RKPKLQRQRKIFKQQGKNFPR-----------ANQMNINVATWGRLLKRSAPSI 118
           RK  L+   KIFK+QG+   +            N  N N       L + APSI
Sbjct: 96  RKDLLKANVKIFKEQGEALDKYAKKNVKVLVVGNPANTNALI----LLKYAPSI 145


>gnl|CDD|176068 cd08686, C2_ABR, C2 domain in the Active BCR (Breakpoint cluster
          region) Related protein.  The ABR protein is similar to
          the breakpoint cluster region protein.  It has homology
          to guanine nucleotide exchange proteins and
          GTPase-activating proteins (GAPs).  ABR is expressed
          primarily in the brain, but also includes non-neuronal
          tissues such as the heart.  It has been associated with
          human diseases such as Miller-Dieker syndrome in which
          mental retardation and malformations of the heart are
          present.  ABR contains a RhoGEF domain and a PH-like
          domain upstream of its C2 domain and a RhoGAP domain
          downstream of this domain.  A few members also contain
          a Bcr-Abl oncoprotein oligomerization domain at the
          very N-terminal end. Splice variants of ABR have been
          identified. ABR is found in a wide variety of organisms
          including chimpanzee, dog, mouse, rat, fruit fly, and
          mosquito. The C2 domain was first identified in PKC. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 118

 Score = 27.1 bits (60), Expect = 2.0
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 8  WDQRFSIDLDKSRELEIGVYWRDWRSLCGVKFLRLEEFIDDIRHGMALQLEPQGL 62
          W++ F I+L+ S+ L I  Y +     C  K     E  D I     +QL+PQ L
Sbjct: 46 WNEEFEIELEGSQTLRILCYEK-----CYSKVKLDGEGTDAIMGKGQIQLDPQSL 95


>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC)
           epsilon.  A single C2 domain is found in PKC epsilon.
           The PKC family of serine/threonine kinases regulates
           apoptosis, proliferation, migration, motility,
           chemo-resistance, and differentiation.  There are 3
           groups: group 1 (alpha, betaI, beta II, gamma) which
           require phospholipids and calcium, group 2 (delta,
           epsilon, theta, eta) which do not require calcium for
           activation, and group 3 (xi, iota/lambda) which are
           atypical and can be activated in the absence of
           diacylglycerol and calcium. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  Members here have a type-II
           topology.
          Length = 132

 Score = 25.7 bits (57), Expect = 6.3
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 11/70 (15%)

Query: 7   AWDQRFSIDLDKSRELEIGVYWR------DWRSLCGVKFLRLEEFIDDIRHG--MALQLE 58
            W++ F+ ++   R LE+ V+        D+ + C + F   E+ I        + + LE
Sbjct: 61  VWNEEFTTEVHNGRNLELTVFHDAAIGPDDFVANCTISF---EDLIQRGSGSFDLWVDLE 117

Query: 59  PQGLLFAEIK 68
           PQG L  +I+
Sbjct: 118 PQGKLHVKIE 127


>gnl|CDD|235835 PRK06589, PRK06589, putative monovalent cation/H+ antiporter
          subunit D; Reviewed.
          Length = 489

 Score = 26.3 bits (58), Expect = 8.4
 Identities = 9/21 (42%), Positives = 13/21 (61%)

Query: 44 EFIDDIRHGMALQLEPQGLLF 64
          E +D   + + L LEP GL+F
Sbjct: 68 ELMDFGNYSIGLHLEPLGLIF 88


>gnl|CDD|211419 cd11578, GH99_GH71_like_1, Uncharacterized glycoside hydrolase
           family 99-like domain.  This family of putative
           glycoside hydrolases resembles glycosyl hydrolase
           families 71 and 99 (following the CAZY nomenclature) and
           may share a similar catalytic site and mechanism.
          Length = 313

 Score = 25.8 bits (57), Expect = 9.3
 Identities = 7/35 (20%), Positives = 13/35 (37%), Gaps = 2/35 (5%)

Query: 69  FLNPMISRKPKLQRQRKIFKQQGKNFPRANQMNIN 103
           F +  + R P     +K+     +N    N + I 
Sbjct: 247 FQSYKLERNPS--SFKKMCNVALRNDGACNIVLIT 279


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.321    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0645    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 7,720,932
Number of extensions: 691884
Number of successful extensions: 542
Number of sequences better than 10.0: 1
Number of HSP's gapped: 542
Number of HSP's successfully gapped: 18
Length of query: 147
Length of database: 10,937,602
Length adjustment: 88
Effective length of query: 59
Effective length of database: 7,034,450
Effective search space: 415032550
Effective search space used: 415032550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (24.8 bits)