Query         psy3356
Match_columns 180
No_of_seqs    169 out of 2267
Neff          10.9
Searched_HMMs 46136
Date          Fri Aug 16 22:55:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3356.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3356hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 1.1E-30 2.5E-35  178.8   4.4  130   20-179   127-259 (279)
  2 KOG2462|consensus               99.9 6.8E-25 1.5E-29  150.5   5.4  127    1-149   135-265 (279)
  3 KOG3608|consensus               99.8 3.4E-22 7.4E-27  141.3   0.4  167    1-179   184-368 (467)
  4 KOG1074|consensus               99.8   1E-19 2.3E-24  140.9   1.9   76  100-179   606-684 (958)
  5 KOG3608|consensus               99.8 9.1E-20   2E-24  129.2   0.7  164    1-180   141-309 (467)
  6 KOG1074|consensus               99.7 1.4E-18 3.1E-23  134.7   2.3   87   36-123   603-692 (958)
  7 KOG3576|consensus               99.7   7E-18 1.5E-22  111.2   2.3  113   36-153   115-238 (267)
  8 KOG3576|consensus               99.7 3.6E-17 7.9E-22  107.9   2.0  106   63-173   114-222 (267)
  9 KOG3623|consensus               99.6 1.8E-15 3.8E-20  116.4   4.3  100   67-177   211-323 (1007)
 10 KOG3623|consensus               99.6 4.9E-16 1.1E-20  119.4   0.4  116   20-150   207-332 (1007)
 11 PLN03086 PRLI-interacting fact  99.3 3.5E-12 7.6E-17   98.1   6.7  126   22-176   406-554 (567)
 12 PLN03086 PRLI-interacting fact  99.3 7.6E-12 1.6E-16   96.2   6.8  129    9-149   419-562 (567)
 13 PHA00733 hypothetical protein   99.2 6.3E-11 1.4E-15   75.1   5.1   85   63-151    37-123 (128)
 14 PHA02768 hypothetical protein;  99.1 5.6E-11 1.2E-15   62.7   2.9   43  127-179     5-47  (55)
 15 PHA00733 hypothetical protein   99.0 2.2E-10 4.8E-15   72.7   2.3   75   95-179    36-115 (128)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.8 1.8E-09 3.9E-14   48.9   1.3   24  143-174     2-25  (26)
 17 PHA02768 hypothetical protein;  98.8 3.3E-09 7.1E-14   56.0   1.7   43   99-143     5-47  (55)
 18 KOG3993|consensus               98.7 4.9E-09 1.1E-13   76.9   0.4   56   36-91    265-320 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.7 2.2E-08 4.7E-13   45.3   2.3   25  114-138     1-25  (26)
 20 KOG3993|consensus               98.5   5E-08 1.1E-12   71.8   1.6   80   67-151   268-380 (500)
 21 PHA00616 hypothetical protein   98.4 1.3E-07 2.8E-12   47.6   1.5   34  127-168     1-34  (44)
 22 PHA00732 hypothetical protein   98.3 6.8E-07 1.5E-11   51.7   2.9   45   99-149     1-46  (79)
 23 PF05605 zf-Di19:  Drought indu  98.3 1.8E-06 3.9E-11   46.4   3.9   50   67-122     3-52  (54)
 24 PHA00616 hypothetical protein   98.2 5.3E-07 1.1E-11   45.4   1.4   32  100-131     2-33  (44)
 25 PHA00732 hypothetical protein   98.1 1.9E-06 4.1E-11   49.8   2.4   48   66-123     1-48  (79)
 26 PF00096 zf-C2H2:  Zinc finger,  98.0 4.2E-06   9E-11   36.5   2.0   22  128-149     1-22  (23)
 27 PF05605 zf-Di19:  Drought indu  98.0 1.3E-05 2.9E-10   43.0   3.9   49   99-150     2-52  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  97.8 1.2E-05 2.5E-10   35.1   1.6   22   67-88      1-22  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.9E-05 4.2E-10   34.6   2.3   23  128-150     1-23  (24)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.8 2.6E-05 5.6E-10   47.4   2.9   73   68-150     1-73  (100)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.3E-05 4.9E-10   35.6   1.7   24  127-150     1-24  (27)
 32 KOG2231|consensus               97.7 7.2E-05 1.6E-09   59.3   4.8  120   25-151   101-236 (669)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.6 4.7E-05   1E-09   33.2   1.9   23   67-89      1-23  (24)
 34 COG5189 SFP1 Putative transcri  97.5 6.1E-05 1.3E-09   54.0   1.8   56  125-180   347-415 (423)
 35 COG5189 SFP1 Putative transcri  97.4 5.9E-05 1.3E-09   54.1   1.1   72   63-148   346-419 (423)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.4 0.00019 4.1E-09   32.5   2.3   23  100-122     2-24  (27)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00019 4.2E-09   43.5   2.8   72   41-122     2-73  (100)
 38 smart00355 ZnF_C2H2 zinc finge  97.1 0.00039 8.5E-09   30.7   2.0   23  128-150     1-23  (26)
 39 PRK04860 hypothetical protein;  97.1 0.00044 9.6E-09   45.7   2.5   42  126-179   118-159 (160)
 40 PF12874 zf-met:  Zinc-finger o  96.9 0.00049 1.1E-08   30.4   1.3   22  128-149     1-22  (25)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00076 1.6E-08   29.5   1.5   22  128-150     1-22  (24)
 42 PF09237 GAGA:  GAGA factor;  I  96.8  0.0017 3.7E-08   33.6   2.8   20   67-86     25-44  (54)
 43 smart00355 ZnF_C2H2 zinc finge  96.7  0.0015 3.3E-08   28.7   2.1   23   67-89      1-23  (26)
 44 PF09237 GAGA:  GAGA factor;  I  96.5  0.0038 8.2E-08   32.4   2.6   33   95-127    20-52  (54)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.4  0.0026 5.7E-08   27.7   1.7   22   67-89      1-22  (24)
 46 PF12874 zf-met:  Zinc-finger o  96.3  0.0041 8.9E-08   27.3   1.9   20  101-120     2-21  (25)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.2   0.001 2.3E-08   30.0  -0.3   21  128-148     2-22  (27)
 48 KOG2231|consensus               96.1  0.0054 1.2E-07   49.1   3.1  125    4-148   122-260 (669)
 49 KOG1146|consensus               96.0  0.0029 6.4E-08   53.8   1.4  100   50-149   448-611 (1406)
 50 PRK04860 hypothetical protein;  96.0   0.007 1.5E-07   40.1   2.7   39   98-140   118-156 (160)
 51 PF13913 zf-C2HC_2:  zinc-finge  95.2    0.02 4.4E-07   25.2   2.0   21  128-149     3-23  (25)
 52 PF12171 zf-C2H2_jaz:  Zinc-fin  94.7   0.011 2.4E-07   26.5   0.4   21  100-120     2-22  (27)
 53 smart00451 ZnF_U1 U1-like zinc  94.6   0.031 6.8E-07   26.6   1.9   23  127-149     3-25  (35)
 54 COG5236 Uncharacterized conser  94.1   0.046 9.9E-07   40.3   2.6  133    2-151   159-305 (493)
 55 TIGR00622 ssl1 transcription f  94.1   0.063 1.4E-06   33.1   2.8   48  101-150    57-104 (112)
 56 PF12013 DUF3505:  Protein of u  93.6    0.24 5.2E-06   30.6   4.9   24  128-151    81-108 (109)
 57 cd00350 rubredoxin_like Rubred  93.4   0.054 1.2E-06   25.6   1.3    9  126-134    16-24  (33)
 58 cd00729 rubredoxin_SM Rubredox  92.7   0.094   2E-06   25.0   1.6   11  127-137     2-12  (34)
 59 PF13717 zinc_ribbon_4:  zinc-r  92.6    0.14   3E-06   24.7   2.2   33  128-173     3-35  (36)
 60 smart00451 ZnF_U1 U1-like zinc  92.5   0.088 1.9E-06   25.0   1.4   22   66-87      3-24  (35)
 61 KOG2482|consensus               92.0    0.15 3.3E-06   37.6   2.6  112   38-150   195-357 (423)
 62 KOG2893|consensus               91.9   0.046   1E-06   38.1   0.0   44   38-85     10-53  (341)
 63 COG1592 Rubrerythrin [Energy p  91.7    0.13 2.8E-06   34.2   1.9   23  127-170   134-156 (166)
 64 PF09538 FYDLN_acid:  Protein o  91.4     0.2 4.4E-06   30.9   2.4   30  100-140    10-39  (108)
 65 PF10571 UPF0547:  Uncharacteri  90.9   0.078 1.7E-06   23.6   0.2   23   25-48      2-24  (26)
 66 PF13719 zinc_ribbon_5:  zinc-r  90.9    0.23 5.1E-06   24.1   1.9   34  128-174     3-36  (37)
 67 KOG4173|consensus               90.5   0.034 7.3E-07   37.9  -1.7   76   66-149    79-168 (253)
 68 KOG1146|consensus               90.4    0.17 3.7E-06   43.8   1.8  100   67-176  1261-1393(1406)
 69 KOG1280|consensus               90.2    0.32 6.9E-06   36.0   2.9   81   23-106     8-116 (381)
 70 KOG4173|consensus               90.0    0.32 6.9E-06   33.3   2.6   77   44-123    87-171 (253)
 71 PF09538 FYDLN_acid:  Protein o  90.0    0.21 4.6E-06   30.8   1.6   14  162-175    25-38  (108)
 72 TIGR02098 MJ0042_CXXC MJ0042 f  89.9    0.27 5.8E-06   23.9   1.7   14  128-141     3-16  (38)
 73 TIGR00622 ssl1 transcription f  89.8    0.62 1.3E-05   28.8   3.5   91   24-122     2-104 (112)
 74 COG4049 Uncharacterized protei  89.8    0.15 3.3E-06   26.9   0.7   26  124-149    14-39  (65)
 75 KOG2186|consensus               89.7    0.31 6.7E-06   34.5   2.4   46   67-120     4-49  (276)
 76 PHA00626 hypothetical protein   89.4    0.06 1.3E-06   28.5  -0.9   14  126-139    22-35  (59)
 77 KOG2893|consensus               89.4   0.099 2.1E-06   36.5  -0.2   42   68-118    12-53  (341)
 78 KOG2482|consensus               89.3    0.57 1.2E-05   34.7   3.6  142   38-179   144-350 (423)
 79 KOG2186|consensus               88.5    0.41 8.9E-06   33.9   2.3   48   99-149     3-50  (276)
 80 COG5236 Uncharacterized conser  88.4    0.41 8.8E-06   35.5   2.3   77   66-149   151-242 (493)
 81 COG4049 Uncharacterized protei  88.1    0.34 7.4E-06   25.6   1.3   30   61-90     12-41  (65)
 82 PF09723 Zn-ribbon_8:  Zinc rib  87.2    0.31 6.8E-06   24.4   0.9   11   24-34      6-16  (42)
 83 PF09986 DUF2225:  Uncharacteri  86.8    0.15 3.2E-06   35.7  -0.6   12  128-139    49-60  (214)
 84 smart00531 TFIIE Transcription  86.5     1.4 3.1E-05   28.8   3.9   14  126-139    98-111 (147)
 85 COG2888 Predicted Zn-ribbon RN  86.4    0.44 9.5E-06   25.7   1.2   10  161-170    48-57  (61)
 86 COG5048 FOG: Zn-finger [Genera  86.1    0.28 6.1E-06   37.5   0.5   47   43-89    294-346 (467)
 87 TIGR02300 FYDLN_acid conserved  85.7    0.75 1.6E-05   29.0   2.1   31   99-140     9-39  (129)
 88 PF12013 DUF3505:  Protein of u  85.3     2.9 6.3E-05   25.7   4.7   26   99-124    80-109 (109)
 89 PRK14890 putative Zn-ribbon RN  84.7       1 2.2E-05   24.3   2.1   11  161-171    46-56  (59)
 90 TIGR00373 conserved hypothetic  84.5     1.1 2.4E-05   29.7   2.7   18  126-143   108-125 (158)
 91 PF00301 Rubredoxin:  Rubredoxi  83.7    0.85 1.8E-05   23.5   1.5   14   24-37      2-15  (47)
 92 KOG2071|consensus               83.1    0.99 2.1E-05   36.0   2.3   16  161-176   511-526 (579)
 93 PRK00398 rpoP DNA-directed RNA  81.5    0.84 1.8E-05   23.3   1.0   10   67-76      4-13  (46)
 94 PRK06266 transcription initiat  80.7     1.6 3.4E-05   29.6   2.3   16  127-142   117-132 (178)
 95 PRK00464 nrdR transcriptional   79.7    0.28 6.1E-06   32.3  -1.4   12  100-111    29-40  (154)
 96 KOG2785|consensus               79.7       3 6.6E-05   31.5   3.6   51  100-150   167-243 (390)
 97 smart00531 TFIIE Transcription  79.2     2.1 4.6E-05   28.0   2.6   38   96-137    96-133 (147)
 98 cd00730 rubredoxin Rubredoxin;  78.6     1.5 3.3E-05   22.9   1.4   13   24-36      2-14  (50)
 99 smart00734 ZnF_Rad18 Rad18-lik  78.6     2.1 4.6E-05   18.9   1.7   19  129-148     3-21  (26)
100 COG5048 FOG: Zn-finger [Genera  78.1    0.76 1.6E-05   35.2   0.2   53   99-151   289-347 (467)
101 TIGR00373 conserved hypothetic  77.7     3.4 7.3E-05   27.4   3.2   34   95-137   105-138 (158)
102 smart00834 CxxC_CXXC_SSSS Puta  77.6     1.4   3E-05   21.6   1.1   11   24-34      6-16  (41)
103 PF14353 CpXC:  CpXC protein     77.6     3.9 8.5E-05   26.0   3.4   19   65-83     37-55  (128)
104 KOG2785|consensus               77.0     4.5 9.7E-05   30.7   3.8   56   66-121   166-242 (390)
105 smart00659 RPOLCX RNA polymera  76.6     2.4 5.2E-05   21.5   1.7   10  100-109     3-12  (44)
106 COG1198 PriA Primosomal protei  76.2     1.2 2.5E-05   37.1   0.8   54   16-75    428-484 (730)
107 PF07800 DUF1644:  Protein of u  75.0      12 0.00026   24.8   5.0   53   98-152    79-133 (162)
108 PF06524 NOA36:  NOA36 protein;  74.5     2.9 6.2E-05   30.0   2.2   18  161-178   207-224 (314)
109 PF02176 zf-TRAF:  TRAF-type zi  73.8     3.6 7.7E-05   22.0   2.1   21  112-132    23-43  (60)
110 COG1997 RPL43A Ribosomal prote  73.7     1.6 3.4E-05   25.6   0.7   31   98-138    34-64  (89)
111 PRK06266 transcription initiat  73.3       4 8.6E-05   27.7   2.7   34   96-138   114-147 (178)
112 PF02892 zf-BED:  BED zinc fing  72.2     4.1 8.8E-05   20.4   2.0   23  126-148    15-41  (45)
113 TIGR02605 CxxC_CxxC_SSSS putat  71.9     1.1 2.5E-05   23.3  -0.1   10  100-109     6-15  (52)
114 KOG2593|consensus               71.9     4.5 9.7E-05   31.2   2.9   38  124-172   125-162 (436)
115 PF07754 DUF1610:  Domain of un  70.2     2.1 4.5E-05   18.6   0.5    9  162-170    15-23  (24)
116 KOG2807|consensus               69.4     9.5 0.00021   28.4   3.9   26  125-150   343-368 (378)
117 PRK09678 DNA-binding transcrip  69.0     0.8 1.7E-05   26.0  -1.2   20  123-142    23-44  (72)
118 KOG2807|consensus               68.5     9.6 0.00021   28.4   3.8   91   67-173   245-355 (378)
119 PF04959 ARS2:  Arsenite-resist  67.5     5.6 0.00012   27.9   2.4   31   95-125    73-103 (214)
120 PF12907 zf-met2:  Zinc-binding  66.9     4.9 0.00011   19.9   1.5   22  128-149     2-26  (40)
121 PF07975 C1_4:  TFIIH C1-like d  65.8     1.7 3.6E-05   22.9  -0.3   14   21-34     19-32  (51)
122 COG5151 SSL1 RNA polymerase II  65.7     9.4  0.0002   28.2   3.3   83   66-150   322-411 (421)
123 PF08274 PhnA_Zn_Ribbon:  PhnA   65.0     2.9 6.3E-05   19.2   0.5    9  127-135    19-27  (30)
124 PF15269 zf-C2H2_7:  Zinc-finge  63.7     6.2 0.00013   19.9   1.5   24   99-122    20-43  (54)
125 COG1996 RPC10 DNA-directed RNA  63.1     3.2 6.9E-05   21.6   0.5   12   23-34      6-17  (49)
126 smart00440 ZnF_C2C2 C2C2 Zinc   62.7     1.3 2.8E-05   21.9  -1.0    8  128-135    29-36  (40)
127 smart00154 ZnF_AN1 AN1-like Zi  61.9     4.2 9.1E-05   19.9   0.7   11  163-173    12-22  (39)
128 TIGR01206 lysW lysine biosynth  61.8     5.6 0.00012   21.2   1.3   11   24-34      3-13  (54)
129 COG1198 PriA Primosomal protei  61.7     7.8 0.00017   32.5   2.6   13  160-172   472-484 (730)
130 COG5151 SSL1 RNA polymerase II  61.6     4.3 9.2E-05   29.9   1.0   99   15-122   301-411 (421)
131 PF13878 zf-C2H2_3:  zinc-finge  61.0      10 0.00023   18.8   2.1   12   23-34     13-24  (41)
132 PF03604 DNA_RNApol_7kD:  DNA d  60.4     4.4 9.5E-05   19.0   0.6    8  100-107    18-25  (32)
133 KOG3408|consensus               58.2     7.4 0.00016   24.4   1.5   27  124-150    54-80  (129)
134 PF04959 ARS2:  Arsenite-resist  57.5     8.8 0.00019   26.9   2.0   27  125-151    75-101 (214)
135 COG3677 Transposase and inacti  57.2     5.7 0.00012   25.4   1.0   16  161-176    51-66  (129)
136 PRK03824 hypA hydrogenase nick  55.9     4.9 0.00011   25.9   0.5   11  100-110    71-81  (135)
137 KOG2593|consensus               55.0      16 0.00035   28.4   3.1   37   63-107   125-161 (436)
138 smart00614 ZnF_BED BED zinc fi  54.5      12 0.00026   19.3   1.8   21  128-148    19-44  (50)
139 PF10013 DUF2256:  Uncharacteri  53.5     5.1 0.00011   20.0   0.2   12  165-176    10-21  (42)
140 PF00628 PHD:  PHD-finger;  Int  53.5     1.8 3.9E-05   22.3  -1.5   23   26-48      2-24  (51)
141 PF13453 zf-TFIIB:  Transcripti  53.1      10 0.00022   18.6   1.3   16  128-143    20-35  (41)
142 PF08790 zf-LYAR:  LYAR-type C2  52.3     2.8 6.1E-05   18.9  -0.7   19  128-147     1-19  (28)
143 KOG2907|consensus               51.9     9.9 0.00021   23.5   1.3   12   25-36      9-20  (116)
144 PF13248 zf-ribbon_3:  zinc-rib  51.4     5.3 0.00011   17.5   0.1    8   25-32      4-11  (26)
145 PF01428 zf-AN1:  AN1-like Zinc  50.6     3.9 8.5E-05   20.5  -0.5   12  162-173    12-23  (43)
146 PF05443 ROS_MUCR:  ROS/MUCR tr  50.5      14  0.0003   23.8   1.9   27   97-126    70-96  (132)
147 KOG4167|consensus               50.0     4.2 9.1E-05   33.6  -0.6   25  127-151   792-816 (907)
148 COG3357 Predicted transcriptio  49.7       9 0.00019   22.7   0.9   13   99-111    58-70  (97)
149 PTZ00255 60S ribosomal protein  49.6     5.4 0.00012   23.7  -0.0   33   16-48     29-64  (90)
150 PF05191 ADK_lid:  Adenylate ki  49.5      19 0.00041   17.3   1.9   10   25-34      3-12  (36)
151 PF04423 Rad50_zn_hook:  Rad50   48.4     5.6 0.00012   21.0  -0.1   10  165-174    22-31  (54)
152 PF13451 zf-trcl:  Probable zin  47.9      15 0.00033   19.1   1.5   14   98-111     3-16  (49)
153 KOG1280|consensus               47.9      23  0.0005   26.7   2.9   27  125-151    77-103 (381)
154 smart00249 PHD PHD zinc finger  46.7     8.6 0.00019   18.8   0.5   21   26-46      2-22  (47)
155 COG4530 Uncharacterized protei  46.1      14  0.0003   22.8   1.3   27  100-137    10-36  (129)
156 COG4391 Uncharacterized protei  45.6      19 0.00041   19.7   1.6   16   19-34     44-59  (62)
157 KOG0717|consensus               45.4      15 0.00032   28.9   1.7   22  128-149   293-314 (508)
158 COG1571 Predicted DNA-binding   45.4      15 0.00032   28.6   1.7   13  163-175   367-379 (421)
159 cd00065 FYVE FYVE domain; Zinc  45.3      18 0.00039   19.0   1.6   10  128-137    19-28  (57)
160 PF10276 zf-CHCC:  Zinc-finger   45.3      28  0.0006   17.2   2.1   11   23-33     29-39  (40)
161 TIGR00280 L37a ribosomal prote  45.1     6.1 0.00013   23.5  -0.3   33   16-48     28-63  (91)
162 smart00661 RPOL9 RNA polymeras  45.1      12 0.00025   19.3   0.8   12   66-77     20-31  (52)
163 PF01096 TFIIS_C:  Transcriptio  45.0    0.71 1.5E-05   22.7  -3.6    8  128-135    29-36  (39)
164 PF12773 DZR:  Double zinc ribb  44.7     8.7 0.00019   19.7   0.3    7   68-74     31-37  (50)
165 KOG2817|consensus               43.9      21 0.00045   27.4   2.2   71    2-75    309-383 (394)
166 PF04780 DUF629:  Protein of un  43.3      36 0.00077   27.1   3.5   33  119-151    49-81  (466)
167 PF13240 zinc_ribbon_2:  zinc-r  43.3     8.9 0.00019   16.3   0.2    9   26-34      2-10  (23)
168 PF07282 OrfB_Zn_ribbon:  Putat  43.0      19 0.00041   19.9   1.5   13  125-137    44-56  (69)
169 PRK14714 DNA polymerase II lar  42.9      16 0.00034   32.6   1.6   37   23-77    667-703 (1337)
170 TIGR00595 priA primosomal prot  42.7      13 0.00029   29.8   1.2   18   17-34    207-224 (505)
171 PF01780 Ribosomal_L37ae:  Ribo  40.7     4.4 9.6E-05   24.1  -1.3   31   18-48     30-63  (90)
172 PF05495 zf-CHY:  CHY zinc fing  40.5     5.5 0.00012   22.5  -0.9    9  163-171    61-69  (71)
173 PRK12496 hypothetical protein;  40.5      10 0.00023   25.3   0.2   26   23-48    127-153 (164)
174 PRK03976 rpl37ae 50S ribosomal  40.2     8.1 0.00017   23.0  -0.3   33   16-48     29-64  (90)
175 COG0068 HypF Hydrogenase matur  39.9     5.6 0.00012   32.9  -1.2   75   23-108   101-182 (750)
176 PF14446 Prok-RING_1:  Prokaryo  39.9      14  0.0003   19.7   0.6   14  164-177     6-19  (54)
177 PF14369 zf-RING_3:  zinc-finge  39.8      31 0.00068   16.4   1.8   13   22-34     20-32  (35)
178 PF04810 zf-Sec23_Sec24:  Sec23  39.5     8.8 0.00019   18.8  -0.2    8  163-170    24-31  (40)
179 COG1773 Rubredoxin [Energy pro  39.4      12 0.00026   20.0   0.3   12  163-174     3-14  (55)
180 KOG4377|consensus               39.4      13 0.00029   28.6   0.7  104   43-151   278-427 (480)
181 PRK04023 DNA polymerase II lar  39.3      26 0.00057   30.6   2.3   21   24-47    627-647 (1121)
182 KOG1842|consensus               38.7      34 0.00075   26.8   2.7   26   98-123    14-39  (505)
183 COG1594 RPB9 DNA-directed RNA   38.5     9.4  0.0002   23.8  -0.2    9   67-75     23-31  (113)
184 COG3091 SprT Zn-dependent meta  37.9      14  0.0003   24.4   0.5   35  125-172   115-149 (156)
185 PRK14873 primosome assembly pr  37.7      16 0.00035   30.4   1.0   27   15-47    375-401 (665)
186 PF08792 A2L_zn_ribbon:  A2L zi  37.4      23 0.00049   16.7   1.1   12   22-33     20-31  (33)
187 PRK05580 primosome assembly pr  36.4      20 0.00043   30.0   1.3   17   18-34    376-392 (679)
188 PF14787 zf-CCHC_5:  GAG-polypr  36.1      26 0.00056   16.9   1.1   13  165-177     4-16  (36)
189 COG1327 Predicted transcriptio  36.1     8.9 0.00019   25.2  -0.6   12  101-112    30-41  (156)
190 KOG2636|consensus               36.0      32 0.00069   27.0   2.2   29  120-148   394-423 (497)
191 PF06397 Desulfoferrod_N:  Desu  36.0      15 0.00032   17.7   0.3   11  162-172     5-15  (36)
192 COG1675 TFA1 Transcription ini  35.7      52  0.0011   22.4   2.9    8  164-171   133-140 (176)
193 KOG4167|consensus               35.6      13 0.00027   31.0   0.1   26   65-90    791-816 (907)
194 smart00064 FYVE Protein presen  35.5      29 0.00062   19.0   1.5   11  127-137    26-36  (68)
195 PF11023 DUF2614:  Protein of u  35.3      13 0.00029   23.0   0.1   28   20-47     66-94  (114)
196 PHA02998 RNA polymerase subuni  34.8     8.7 0.00019   25.9  -0.8   10  164-173   172-181 (195)
197 TIGR00244 transcriptional regu  34.7     8.5 0.00019   25.2  -0.8   14  100-113    29-42  (147)
198 PRK03564 formate dehydrogenase  34.3      24 0.00053   26.3   1.3   14  161-174   250-263 (309)
199 TIGR00686 phnA alkylphosphonat  34.2      27 0.00058   21.6   1.3   29  101-140     4-32  (109)
200 PF09963 DUF2197:  Uncharacteri  33.5      13 0.00029   19.9  -0.1   15   65-79     30-44  (56)
201 PF12760 Zn_Tnp_IS1595:  Transp  33.4      70  0.0015   16.1   3.0   10  162-171    36-45  (46)
202 PF03884 DUF329:  Domain of unk  33.3      18 0.00039   19.5   0.4   12   24-35      3-14  (57)
203 cd00924 Cyt_c_Oxidase_Vb Cytoc  33.3      20 0.00043   21.7   0.6   13  162-174    78-90  (97)
204 PRK14559 putative protein seri  33.2      36 0.00078   28.4   2.2   23   25-48      3-25  (645)
205 PF07295 DUF1451:  Protein of u  33.0      37 0.00079   22.3   1.9   11  126-136   111-121 (146)
206 PF14803 Nudix_N_2:  Nudix N-te  32.9      16 0.00036   17.3   0.2    9   67-75     23-31  (34)
207 PF01286 XPA_N:  XPA protein N-  32.7      22 0.00048   16.9   0.6   12  165-176     5-16  (34)
208 COG1655 Uncharacterized protei  32.3      11 0.00023   26.7  -0.7    9  128-136    63-71  (267)
209 PF15135 UPF0515:  Uncharacteri  32.2      30 0.00064   24.9   1.4   60   65-142   111-170 (278)
210 PRK10220 hypothetical protein;  31.3      32  0.0007   21.2   1.3   12   99-110    20-31  (111)
211 PRK12380 hydrogenase nickel in  31.2      24 0.00053   21.9   0.8   12   23-34     70-81  (113)
212 PF01363 FYVE:  FYVE zinc finge  31.2      34 0.00074   18.8   1.3    9  101-109    11-19  (69)
213 PRK05452 anaerobic nitric oxid  30.6      33 0.00072   27.4   1.6   17   20-36    422-438 (479)
214 PRK04351 hypothetical protein;  30.5      25 0.00054   23.1   0.8   34  127-176   112-145 (149)
215 smart00731 SprT SprT homologue  30.3      27 0.00058   22.7   0.9   33  127-174   112-144 (146)
216 COG4957 Predicted transcriptio  30.0      27 0.00058   22.5   0.8   14   53-66     88-101 (148)
217 PF04438 zf-HIT:  HIT zinc fing  30.0      18 0.00039   16.6   0.1   11  162-172    12-22  (30)
218 COG0068 HypF Hydrogenase matur  29.7     6.5 0.00014   32.5  -2.3   56  101-171   125-181 (750)
219 COG1998 RPS31 Ribosomal protei  29.6      18 0.00039   18.8   0.0    8  128-135    38-45  (51)
220 TIGR00100 hypA hydrogenase nic  29.6      43 0.00093   20.9   1.7   12   23-34     70-81  (115)
221 PF10263 SprT-like:  SprT-like   29.3      14 0.00031   24.1  -0.5   32  127-174   123-154 (157)
222 TIGR01562 FdhE formate dehydro  29.1      52  0.0011   24.6   2.3   13  161-173   250-262 (305)
223 COG3024 Uncharacterized protei  28.5      25 0.00054   19.4   0.5   14   21-34      5-18  (65)
224 PRK05978 hypothetical protein;  28.2      20 0.00043   23.6   0.0   10  129-138    54-63  (148)
225 PF14122 YokU:  YokU-like prote  28.1      51  0.0011   19.4   1.7   29    9-37     21-49  (87)
226 PRK00420 hypothetical protein;  27.3      31 0.00068   21.5   0.8   11   24-34     24-34  (112)
227 PF08209 Sgf11:  Sgf11 (transcr  26.8      83  0.0018   14.8   2.1   21  100-121     5-25  (33)
228 PF03119 DNA_ligase_ZBD:  NAD-d  26.6      49  0.0011   14.8   1.2   13   25-37      1-13  (28)
229 PF14447 Prok-RING_4:  Prokaryo  25.9      43 0.00094   17.9   1.0   12  165-176    41-52  (55)
230 COG4338 Uncharacterized protei  25.6      26 0.00056   18.1   0.2   17  101-117    14-30  (54)
231 PRK03681 hypA hydrogenase nick  25.5      54  0.0012   20.4   1.6   12   23-34     70-81  (114)
232 PF08271 TF_Zn_Ribbon:  TFIIB z  24.9      38 0.00081   16.8   0.7    9  164-172     1-9   (43)
233 PF01155 HypA:  Hydrogenase exp  24.8      35 0.00076   21.2   0.7   11  100-110    71-81  (113)
234 COG2331 Uncharacterized protei  24.7      46 0.00099   19.1   1.1   11   99-109    12-22  (82)
235 PF14634 zf-RING_5:  zinc-RING   24.7      36 0.00077   16.8   0.6    8   26-33      2-9   (44)
236 PF14255 Cys_rich_CPXG:  Cystei  24.7      44 0.00095   17.6   0.9   10   25-34      2-11  (52)
237 KOG0782|consensus               24.4      17 0.00037   29.4  -0.9   50   53-112   240-289 (1004)
238 PRK00432 30S ribosomal protein  24.3      39 0.00085   17.6   0.7   11   66-76     37-47  (50)
239 PF11931 DUF3449:  Domain of un  24.1      26 0.00056   24.3   0.0   28  121-148    95-123 (196)
240 PF09845 DUF2072:  Zn-ribbon co  23.9      38 0.00083   21.7   0.7   15  127-141     1-15  (131)
241 TIGR00627 tfb4 transcription f  23.9      67  0.0014   23.7   2.1   10  128-137   256-265 (279)
242 PLN02294 cytochrome c oxidase   23.9      39 0.00085   22.8   0.8   15  161-175   139-153 (174)
243 PLN02748 tRNA dimethylallyltra  23.8      58  0.0013   26.0   1.8   25  125-149   416-441 (468)
244 PRK02935 hypothetical protein;  23.7      38 0.00083   20.8   0.7   29   20-48     67-96  (110)
245 TIGR00416 sms DNA repair prote  23.6      46   0.001   26.4   1.3   26   66-110     7-32  (454)
246 PRK00418 DNA gyrase inhibitor;  23.4      41 0.00089   18.5   0.7   13   22-34      5-17  (62)
247 PF11238 DUF3039:  Protein of u  23.3      23  0.0005   19.1  -0.3   11   23-33     44-54  (58)
248 KOG0978|consensus               23.1      28 0.00061   29.1   0.1   10   99-108   643-652 (698)
249 PF14311 DUF4379:  Domain of un  23.0      63  0.0014   16.9   1.4    7  129-135    30-36  (55)
250 PF04780 DUF629:  Protein of un  22.9      62  0.0013   25.8   1.8   26   66-91     57-82  (466)
251 PRK12722 transcriptional activ  22.7      66  0.0014   22.2   1.7   47  108-171   116-162 (187)
252 PRK11823 DNA repair protein Ra  22.7      49  0.0011   26.1   1.3   27   65-110     6-32  (446)
253 KOG0717|consensus               22.6      59  0.0013   25.8   1.6   21  100-120   293-313 (508)
254 PF11672 DUF3268:  Protein of u  22.5      46 0.00099   20.4   0.9    8   67-74      3-10  (102)
255 PF04216 FdhE:  Protein involve  22.5     9.6 0.00021   28.0  -2.5   13  160-172   235-247 (290)
256 PF06827 zf-FPG_IleRS:  Zinc fi  22.3      23  0.0005   15.9  -0.4   10   25-34      3-12  (30)
257 TIGR03831 YgiT_finger YgiT-typ  22.2      75  0.0016   15.5   1.6   15   20-34     29-43  (46)
258 PF04606 Ogr_Delta:  Ogr/Delta-  21.6     9.8 0.00021   19.4  -1.9   13  126-138    24-38  (47)
259 TIGR01384 TFS_arch transcripti  21.5      16 0.00034   22.2  -1.3   10   25-34      2-11  (104)
260 COG5112 UFD2 U1-like Zn-finger  21.3      48   0.001   20.3   0.8   24  126-149    54-77  (126)
261 TIGR03829 YokU_near_AblA uncha  21.3      67  0.0014   19.1   1.3   22   16-37     28-49  (89)
262 PRK01343 zinc-binding protein;  21.2   1E+02  0.0022   16.6   1.9   10  164-173    10-19  (57)
263 COG4888 Uncharacterized Zn rib  21.2      45 0.00098   20.3   0.6   12  160-171    19-30  (104)
264 KOG4727|consensus               21.1      58  0.0013   22.0   1.2   22  127-148    75-96  (193)
265 PLN03238 probable histone acet  21.1      91   0.002   23.1   2.2   26  124-149    45-70  (290)
266 PF11789 zf-Nse:  Zinc-finger o  20.9 1.4E+02   0.003   16.0   2.4   13  127-139    24-36  (57)
267 CHL00174 accD acetyl-CoA carbo  20.7      50  0.0011   24.5   0.9   34   98-140    37-70  (296)
268 cd01121 Sms Sms (bacterial rad  20.5      62  0.0013   24.9   1.4    8  100-107    15-22  (372)
269 PF02748 PyrI_C:  Aspartate car  20.3      21 0.00045   18.8  -0.8   15  160-174    32-46  (52)
270 PF03107 C1_2:  C1 domain;  Int  20.1      68  0.0015   14.4   1.0    8  165-172     2-9   (30)
271 PTZ00448 hypothetical protein;  20.1      80  0.0017   24.3   1.8   23  127-149   314-336 (373)
272 KOG0402|consensus               20.1      15 0.00033   21.4  -1.4   18   17-34     30-47  (92)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=1.1e-30  Score=178.76  Aligned_cols=130  Identities=35%  Similarity=0.688  Sum_probs=117.7

Q ss_pred             cCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcCC---CCCcccccchhhccChHHHHHHHHhccCCCcCC
Q psy3356          20 KNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTG---ERPFECDVCGKRFAQKSTLNTHKRVHISYLHVK   96 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~   96 (180)
                      ..+.++|+.||+.+.               +...|.+|.++|-.   .+.+.|++|++.|.+-..|..|+++|       
T Consensus       127 ~~~r~~c~eCgk~ys---------------T~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH-------  184 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYS---------------TSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTH-------  184 (279)
T ss_pred             cCCceeccccccccc---------------cccccchhhcccccccccccccCCCCCceeeehHHHhhHhhcc-------
Confidence            445667777777777               99999999998854   56799999999999999999999987       


Q ss_pred             CcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCc
Q psy3356          97 DKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTK  176 (180)
Q Consensus        97 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~  176 (180)
                      ..+..|.+||+.|...+.|+.|+++|+|+|||.|+.|++.|.++++|+.|+++        |.+.|+|+|..|+++|+..
T Consensus       185 ~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT--------HS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  185 TLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT--------HSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             CCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh--------hcCCccccCcchhhHHHHH
Confidence            47899999999999999999999999999999999999999999999999998        7889999999999999987


Q ss_pred             cCC
Q psy3356         177 QNL  179 (180)
Q Consensus       177 ~~L  179 (180)
                      +-|
T Consensus       257 SyL  259 (279)
T KOG2462|consen  257 SYL  259 (279)
T ss_pred             HHH
Confidence            655


No 2  
>KOG2462|consensus
Probab=99.91  E-value=6.8e-25  Score=150.52  Aligned_cols=127  Identities=31%  Similarity=0.633  Sum_probs=114.8

Q ss_pred             CCCcccccCCceeeeeeccc----CCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhc
Q psy3356           1 ACSSKWITSPSVTFDINIQK----NPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRF   76 (180)
Q Consensus         1 ~C~~~f~~~~~~~~~~~~~~----~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f   76 (180)
                      .|+..+.|+.+|..|-..+.    ...+.|++||+.+.               ....|..|+++|.  -+++|.+||+.|
T Consensus       135 eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~Yv---------------SmpALkMHirTH~--l~c~C~iCGKaF  197 (279)
T KOG2462|consen  135 ECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYV---------------SMPALKMHIRTHT--LPCECGICGKAF  197 (279)
T ss_pred             ccccccccccccchhhcccccccccccccCCCCCceee---------------ehHHHhhHhhccC--CCcccccccccc
Confidence            38899999999999977553    44457777776666               9999999999996  578999999999


Q ss_pred             cChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHH
Q psy3356          77 AQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus        77 ~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      ...=.|+.|+++|     +|++||.|+.|++.|.+.++|+.|+++|.+.+.|.|..|++.|...+.|.+|...
T Consensus       198 SRPWLLQGHiRTH-----TGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  198 SRPWLLQGHIRTH-----TGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cchHHhhcccccc-----cCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999     9999999999999999999999999999999999999999999999999999875


No 3  
>KOG3608|consensus
Probab=99.84  E-value=3.4e-22  Score=141.31  Aligned_cols=167  Identities=22%  Similarity=0.410  Sum_probs=139.8

Q ss_pred             CCCcccccCCceeeeeecccCC-cccccccceeeeecC---------------CeeEeeeecccCCCchhhhHhhhcCCC
Q psy3356           1 ACSSKWITSPSVTFDINIQKNP-LVFIPACVFRFSVEN---------------EKRFFFFSFLFGPLLVPQIHMRTHTGE   64 (180)
Q Consensus         1 ~C~~~f~~~~~~~~~~~~~~~~-~~~c~~C~~~~~~~~---------------~~~~~~C~~~~~~~~~l~~H~~~h~~~   64 (180)
                      +|-..+.+...|..|++.+.+. .+-||.||..|....               ...|..|.|.|++...|..|+..|.  
T Consensus       184 ~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--  261 (467)
T KOG3608|consen  184 MCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--  261 (467)
T ss_pred             hhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--
Confidence            4778889999999999988664 458999999998654               4455569999999999999998885  


Q ss_pred             CCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccc--cccccCChHH
Q psy3356          65 RPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEI--CGKRFSQKSA  142 (180)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~  142 (180)
                      ..|+|+.|+.+.....+|..|++.-|    ...++++|..|...+.+.++|.+|...|. +..|.|..  |..+|.+..+
T Consensus       262 n~ykCplCdmtc~~~ssL~~H~r~rH----s~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q  336 (467)
T KOG3608|consen  262 NCYKCPLCDMTCSSASSLTTHIRYRH----SKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQ  336 (467)
T ss_pred             hcccccccccCCCChHHHHHHHHhhh----ccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHH
Confidence            56899999999999999999988765    56899999999999999999999999887 66799977  9999999999


Q ss_pred             HHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCccCC
Q psy3356         143 CNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNL  179 (180)
Q Consensus       143 l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~~~L  179 (180)
                      +.+|++.++.     ..++.+|.|..|++.|++..+|
T Consensus       337 ~~~H~~evhE-----g~np~~Y~CH~Cdr~ft~G~~L  368 (467)
T KOG3608|consen  337 MRRHFLEVHE-----GNNPILYACHCCDRFFTSGKSL  368 (467)
T ss_pred             HHHHHHHhcc-----CCCCCceeeecchhhhccchhH
Confidence            9999987531     2345679999999999987665


No 4  
>KOG1074|consensus
Probab=99.76  E-value=1e-19  Score=140.92  Aligned_cols=76  Identities=38%  Similarity=0.805  Sum_probs=63.8

Q ss_pred             eeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccC---CCcccCCCc
Q psy3356         100 YHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCP---ACEGMFTTK  176 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~---~C~~~F~~~  176 (180)
                      -+|.+|.++..-...|+.|.++|+|++||+|.+|++.|.++.+|..|+.+|-.    .+.-.-.++|+   +|.+.|+..
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka----~p~~R~q~ScP~~~ic~~kftn~  681 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKA----KPPARVQFSCPSTFICQKKFTNA  681 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhccccccc----CccccccccCCchhhhccccccc
Confidence            48999999999999999999999999999999999999999999999987631    12223458999   999999876


Q ss_pred             cCC
Q psy3356         177 QNL  179 (180)
Q Consensus       177 ~~L  179 (180)
                      -.|
T Consensus       682 V~l  684 (958)
T KOG1074|consen  682 VTL  684 (958)
T ss_pred             ccc
Confidence            554


No 5  
>KOG3608|consensus
Probab=99.76  E-value=9.1e-20  Score=129.16  Aligned_cols=164  Identities=24%  Similarity=0.491  Sum_probs=125.9

Q ss_pred             CCCcccccCCceeeeeecccCCcccccccceeeeecCCeeEe-----eeecccCCCchhhhHhhhcCCCCCcccccchhh
Q psy3356           1 ACSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFF-----FFSFLFGPLLVPQIHMRTHTGERPFECDVCGKR   75 (180)
Q Consensus         1 ~C~~~f~~~~~~~~~~~~~~~~~~~c~~C~~~~~~~~~~~~~-----~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~   75 (180)
                      .|+..|++...+..|+..+.-   .|.+ +..+....+.+-.     .|.+.+..+..|+.|++.|++++...|+.|+..
T Consensus       141 dCe~~F~s~~ef~dHV~~H~l---~cey-d~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~  216 (467)
T KOG3608|consen  141 DCEREFVSIVEFQDHVVKHAL---FCEY-DIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGEL  216 (467)
T ss_pred             hcCCcccCHHHHHHHHHHhhh---hhhh-hhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHH
Confidence            488888888877777653211   1111 1111111111111     367788899999999999999999999999999


Q ss_pred             ccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHcCCCCC
Q psy3356          76 FAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLP  155 (180)
Q Consensus        76 f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  155 (180)
                      |++++.|..|.+..-.   ....+|.|..|-+.|.++..|..|+..|.  ..|+|+.|......+++|..|++.      
T Consensus       217 F~~~tkl~DH~rRqt~---l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~------  285 (467)
T KOG3608|consen  217 FRTKTKLFDHLRRQTE---LNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRY------  285 (467)
T ss_pred             hccccHHHHHHHhhhh---hcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHh------
Confidence            9999999999876521   45668999999999999999999998874  458999999999999999999987      


Q ss_pred             CcCCCCCCcccCCCcccCCCccCCC
Q psy3356         156 RVHPKDRPFHCPACEGMFTTKQNLE  180 (180)
Q Consensus       156 ~~h~~~~~~~C~~C~~~F~~~~~L~  180 (180)
                       -|...+||+|..|+..|.++++|.
T Consensus       286 -rHs~dkpfKCd~Cd~~c~~esdL~  309 (467)
T KOG3608|consen  286 -RHSKDKPFKCDECDTRCVRESDLA  309 (467)
T ss_pred             -hhccCCCccccchhhhhccHHHHH
Confidence             477899999999999998888773


No 6  
>KOG1074|consensus
Probab=99.72  E-value=1.4e-18  Score=134.74  Aligned_cols=87  Identities=31%  Similarity=0.601  Sum_probs=69.7

Q ss_pred             cCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccCCCcCCCcceecc---ccCcccCCh
Q psy3356          36 ENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCT---ECEATFSWK  112 (180)
Q Consensus        36 ~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~---~C~~~~~~~  112 (180)
                      ...+.|-+|.++..-+..|+.|++.|.+++||+|.+|++.|.++.+|+.|+..|.... .....+.|+   +|-+.|...
T Consensus       603 TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p-~~R~q~ScP~~~ic~~kftn~  681 (958)
T KOG1074|consen  603 TDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKP-PARVQFSCPSTFICQKKFTNA  681 (958)
T ss_pred             CCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCc-cccccccCCchhhhccccccc
Confidence            3477788899998899999999999999999999999999999999999999885422 223456666   677777776


Q ss_pred             hhHHHHHhhcC
Q psy3356         113 QNLEVHMRTHT  123 (180)
Q Consensus       113 ~~l~~H~~~h~  123 (180)
                      -.+..|++.|.
T Consensus       682 V~lpQhIriH~  692 (958)
T KOG1074|consen  682 VTLPQHIRIHL  692 (958)
T ss_pred             ccccceEEeec
Confidence            66666666654


No 7  
>KOG3576|consensus
Probab=99.69  E-value=7e-18  Score=111.22  Aligned_cols=113  Identities=27%  Similarity=0.561  Sum_probs=90.7

Q ss_pred             cCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhH
Q psy3356          36 ENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNL  115 (180)
Q Consensus        36 ~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l  115 (180)
                      .....|.+|+|.|+....|.+|++-|...+.+.|..|+++|...-+|++|+++|     +|..||+|..|++.|+..-.|
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rth-----tgvrpykc~~c~kaftqrcsl  189 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTH-----TGVRPYKCSLCEKAFTQRCSL  189 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccc-----cCccccchhhhhHHHHhhccH
Confidence            345667777888878888888888888888888888888888888888888888     888888888888888888888


Q ss_pred             HHHHhhcCC-----------CCceeccccccccCChHHHHHHHHHcCCC
Q psy3356         116 EVHMRTHTG-----------ERPYECEICGKRFSQKSACNTHKRTHIPY  153 (180)
Q Consensus       116 ~~H~~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  153 (180)
                      ..|++.-++           .+.|.|..||..-.....+..|++.|+|+
T Consensus       190 eshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  190 ESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             HHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            888865443           35588888888888888888888887654


No 8  
>KOG3576|consensus
Probab=99.65  E-value=3.6e-17  Score=107.86  Aligned_cols=106  Identities=32%  Similarity=0.627  Sum_probs=90.9

Q ss_pred             CCCCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHH
Q psy3356          63 GERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSA  142 (180)
Q Consensus        63 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  142 (180)
                      +...|.|.+|++.|.....|.+|++-|     ...+.+.|..||+.|.+..+|.+|.++|+|.+||+|..|++.|..+-+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch-----~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcs  188 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCH-----SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCS  188 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhc-----cHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhcc
Confidence            345699999999999999999999998     788889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCC---CCcCCCCCCcccCCCcccC
Q psy3356         143 CNTHKRTHIPYL---PRVHPKDRPFHCPACEGMF  173 (180)
Q Consensus       143 l~~H~~~h~~~~---~~~h~~~~~~~C~~C~~~F  173 (180)
                      |..|++.-|+-.   .-....++.|.|..||.+-
T Consensus       189 leshl~kvhgv~~~yaykerr~kl~vcedcg~t~  222 (267)
T KOG3576|consen  189 LESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTS  222 (267)
T ss_pred             HHHHHHHHcCchHHHHHHHhhhheeeecccCCCC
Confidence            999988644211   0011246789999999763


No 9  
>KOG3623|consensus
Probab=99.57  E-value=1.8e-15  Score=116.42  Aligned_cols=100  Identities=29%  Similarity=0.716  Sum_probs=85.6

Q ss_pred             cccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCC-------------CCceecccc
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTG-------------ERPYECEIC  133 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~-------------~~~~~C~~C  133 (180)
                      .+|++|.+.+...+.|+.|++.-|.   ..+..+.|..|..+|.+...|.+|+..|..             .+-|+|.+|
T Consensus       211 ltcpycdrgykrltslkeHikyrhe---kne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtEC  287 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHE---KNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTEC  287 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHh---hCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcccccccc
Confidence            6899999999999999999876543   345568899999999999999999988743             234999999


Q ss_pred             ccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCcc
Q psy3356         134 GKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQ  177 (180)
Q Consensus       134 ~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~~  177 (180)
                      ++.|..+-.|..|+|+        |.|||||.|+-|+++|+-..
T Consensus       288 gKAFKfKHHLKEHlRI--------HSGEKPfeCpnCkKRFSHSG  323 (1007)
T KOG3623|consen  288 GKAFKFKHHLKEHLRI--------HSGEKPFECPNCKKRFSHSG  323 (1007)
T ss_pred             chhhhhHHHHHhhhee--------ecCCCCcCCcccccccccCC
Confidence            9999999999999995        88999999999999998654


No 10 
>KOG3623|consensus
Probab=99.56  E-value=4.9e-16  Score=119.43  Aligned_cols=116  Identities=30%  Similarity=0.634  Sum_probs=97.1

Q ss_pred             cCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcC--CCCCcccccchhhccChHHHHHHHHhccCC-----
Q psy3356          20 KNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHT--GERPFECDVCGKRFAQKSTLNTHKRVHISY-----   92 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-----   92 (180)
                      ..+..+|++|+..+.               ...+|+.|++.-+  .+..|.|..|..+|...+.|.+|+..|.+-     
T Consensus       207 fsqlltcpycdrgyk---------------rltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~  271 (1007)
T KOG3623|consen  207 FSQLLTCPYCDRGYK---------------RLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAI  271 (1007)
T ss_pred             hhhhhcchhHHHHHH---------------HHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccc
Confidence            344557777776666               8899999987543  455699999999999999999999988542     


Q ss_pred             ---CcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHc
Q psy3356          93 ---LHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus        93 ---~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                         .....+.++|..|++.|..+..|..|++.|.|++||.|+.|++.|....++..||...
T Consensus       272 sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSSK  332 (1007)
T KOG3623|consen  272 SLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSK  332 (1007)
T ss_pred             cccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccccc
Confidence               1123456999999999999999999999999999999999999999999999998753


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.32  E-value=3.5e-12  Score=98.06  Aligned_cols=126  Identities=18%  Similarity=0.394  Sum_probs=89.3

Q ss_pred             CcccccccceeeeecC-----------CeeEee--eecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHh
Q psy3356          22 PLVFIPACVFRFSVEN-----------EKRFFF--FSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRV   88 (180)
Q Consensus        22 ~~~~c~~C~~~~~~~~-----------~~~~~~--C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   88 (180)
                      ....|+.|.+..+..+           ...|..  |+..|. ...+..|         +.|+.|++.|. ...|..|+..
T Consensus       406 ~~V~C~NC~~~i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~-r~el~~H---------~~C~~Cgk~f~-~s~LekH~~~  474 (567)
T PLN03086        406 DTVECRNCKHYIPSRSIALHEAYCSRHNVVCPHDGCGIVLR-VEEAKNH---------VHCEKCGQAFQ-QGEMEKHMKV  474 (567)
T ss_pred             CeEECCCCCCccchhHHHHHHhhCCCcceeCCcccccceee-ccccccC---------ccCCCCCCccc-hHHHHHHHHh
Confidence            3447888888777544           222332  666662 2333333         57999988885 5678889887


Q ss_pred             ccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccC----------ChHHHHHHHHHcCCCCCCcC
Q psy3356          89 HISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFS----------QKSACNTHKRTHIPYLPRVH  158 (180)
Q Consensus        89 ~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~h  158 (180)
                      +|       .++.|+ |+..+ ....|..|+..|...+++.|+.|+..|.          ....|..|...         
T Consensus       475 ~H-------kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~---------  536 (567)
T PLN03086        475 FH-------EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI---------  536 (567)
T ss_pred             cC-------CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh---------
Confidence            62       678888 98654 5688888988888889999999998884          23478888775         


Q ss_pred             CCCCCcccCCCcccCCCc
Q psy3356         159 PKDRPFHCPACEGMFTTK  176 (180)
Q Consensus       159 ~~~~~~~C~~C~~~F~~~  176 (180)
                      .|.+++.|..|++.|..+
T Consensus       537 CG~rt~~C~~Cgk~Vrlr  554 (567)
T PLN03086        537 CGSRTAPCDSCGRSVMLK  554 (567)
T ss_pred             cCCcceEccccCCeeeeh
Confidence            378889999999887654


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.29  E-value=7.6e-12  Score=96.24  Aligned_cols=129  Identities=20%  Similarity=0.346  Sum_probs=103.3

Q ss_pred             CCceeeeeecccCCcccccc--cceeeeecC---CeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHH
Q psy3356           9 SPSVTFDINIQKNPLVFIPA--CVFRFSVEN---EKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLN   83 (180)
Q Consensus         9 ~~~~~~~~~~~~~~~~~c~~--C~~~~~~~~---~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   83 (180)
                      ...+..|..........|+.  |+..|....   -+.|..|++.|. ...|..|+.+++  +++.|+ |+..+ ....|.
T Consensus       419 l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~  493 (567)
T PLN03086        419 SRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMV  493 (567)
T ss_pred             hhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHH
Confidence            44566677666666678984  999997443   556778999995 688999999975  789999 99755 668999


Q ss_pred             HHHHhccCCCcCCCcceeccccCcccC----------ChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHH
Q psy3356          84 THKRVHISYLHVKDKPYHCTECEATFS----------WKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus        84 ~H~~~~~~~~~~~~~~~~C~~C~~~~~----------~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      .|+..+     .+.+++.|+.|+..+.          ....|..|.... +.+++.|..|++.+..+ .|..|+-.
T Consensus       494 ~H~~th-----Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        494 QHQAST-----CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             hhhhcc-----CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHH
Confidence            999888     7889999999999884          235788998885 88999999999998665 47888765


No 13 
>PHA00733 hypothetical protein
Probab=99.16  E-value=6.3e-11  Score=75.14  Aligned_cols=85  Identities=21%  Similarity=0.336  Sum_probs=69.4

Q ss_pred             CCCCcccccchhhccChHHHHHH--HHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356          63 GERPFECDVCGKRFAQKSTLNTH--KRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus        63 ~~~~~~C~~C~~~f~~~~~l~~H--~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      .++++.|.+|+..+.....|..+  +..+.  ...+..++.|+.|++.|.....|..|+..+  ..+|.|..|++.|...
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~--~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLL--TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhc--ccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCH
Confidence            45779999999999988777776  22221  124578899999999999999999999876  3569999999999999


Q ss_pred             HHHHHHHHHcC
Q psy3356         141 SACNTHKRTHI  151 (180)
Q Consensus       141 ~~l~~H~~~h~  151 (180)
                      ..|..|+...|
T Consensus       113 ~sL~~H~~~~h  123 (128)
T PHA00733        113 DSTLDHVCKKH  123 (128)
T ss_pred             HHHHHHHHHhc
Confidence            99999998754


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.12  E-value=5.6e-11  Score=62.72  Aligned_cols=43  Identities=26%  Similarity=0.566  Sum_probs=36.3

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCccCC
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNL  179 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~~~L  179 (180)
                      .|.|+.||+.|.....|..|+++|        +  ++|+|..|++.|++.++|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H--------~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKH--------N--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhc--------C--CcccCCcccceeccccee
Confidence            378999999999999999999974        3  688899999999888776


No 15 
>PHA00733 hypothetical protein
Probab=98.99  E-value=2.2e-10  Score=72.66  Aligned_cols=75  Identities=21%  Similarity=0.350  Sum_probs=60.8

Q ss_pred             CCCcceeccccCcccCChhhHHHH--H---hhcCCCCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCC
Q psy3356          95 VKDKPYHCTECEATFSWKQNLEVH--M---RTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPAC  169 (180)
Q Consensus        95 ~~~~~~~C~~C~~~~~~~~~l~~H--~---~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C  169 (180)
                      +..+.+.|.+|...+.....|..+  +   ..+.+.+||.|+.|++.|.+...|..|++.        +  +.+|.|+.|
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~--------h--~~~~~C~~C  105 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRY--------T--EHSKVCPVC  105 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhc--------C--CcCccCCCC
Confidence            456788999999888887776665  2   133457899999999999999999999986        2  356999999


Q ss_pred             cccCCCccCC
Q psy3356         170 EGMFTTKQNL  179 (180)
Q Consensus       170 ~~~F~~~~~L  179 (180)
                      ++.|...+.|
T Consensus       106 gK~F~~~~sL  115 (128)
T PHA00733        106 GKEFRNTDST  115 (128)
T ss_pred             CCccCCHHHH
Confidence            9999987765


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.81  E-value=1.8e-09  Score=48.87  Aligned_cols=24  Identities=38%  Similarity=0.940  Sum_probs=16.2

Q ss_pred             HHHHHHHcCCCCCCcCCCCCCcccCCCcccCC
Q psy3356         143 CNTHKRTHIPYLPRVHPKDRPFHCPACEGMFT  174 (180)
Q Consensus       143 l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~  174 (180)
                      |..|+++        |++++||.|+.|+++|.
T Consensus         2 l~~H~~~--------H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRT--------HTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHH--------HSSSSSEEESSSSEEES
T ss_pred             HHHHhhh--------cCCCCCCCCCCCcCeeC
Confidence            5667665        56677777777777665


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.77  E-value=3.3e-09  Score=56.04  Aligned_cols=43  Identities=16%  Similarity=0.420  Sum_probs=29.9

Q ss_pred             ceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHH
Q psy3356          99 PYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSAC  143 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  143 (180)
                      .|.|+.||+.|.....|..|++.|+  ++++|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            4567777777777777777777776  567777777777655443


No 18 
>KOG3993|consensus
Probab=98.66  E-value=4.9e-09  Score=76.91  Aligned_cols=56  Identities=16%  Similarity=0.233  Sum_probs=44.6

Q ss_pred             cCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccC
Q psy3356          36 ENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHIS   91 (180)
Q Consensus        36 ~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~   91 (180)
                      .+++.|..|...|.+...|.+|.-.......|+|++|++.|.-..+|..|++.|.+
T Consensus       265 iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKP  320 (500)
T KOG3993|consen  265 IGDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKP  320 (500)
T ss_pred             HHHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCC
Confidence            34556666777777999999996544444569999999999999999999999864


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.65  E-value=2.2e-08  Score=45.26  Aligned_cols=25  Identities=72%  Similarity=1.362  Sum_probs=19.5

Q ss_pred             hHHHHHhhcCCCCceeccccccccC
Q psy3356         114 NLEVHMRTHTGERPYECEICGKRFS  138 (180)
Q Consensus       114 ~l~~H~~~h~~~~~~~C~~C~~~f~  138 (180)
                      +|..|++.|.+++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4677888888888888888888775


No 20 
>KOG3993|consensus
Probab=98.49  E-value=5e-08  Score=71.78  Aligned_cols=80  Identities=29%  Similarity=0.672  Sum_probs=69.0

Q ss_pred             cccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCC----------------------
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTG----------------------  124 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~----------------------  124 (180)
                      |.|..|...|...-.|.+|.-.-     .....|+|+.|+++|.-..+|..|.+.|--                      
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~R-----IV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~  342 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPR-----IVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEV  342 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCe-----eEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhh
Confidence            89999999999999999997543     345679999999999999999999998731                      


Q ss_pred             -----------CCceeccccccccCChHHHHHHHHHcC
Q psy3356         125 -----------ERPYECEICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       125 -----------~~~~~C~~C~~~f~~~~~l~~H~~~h~  151 (180)
                                 +..|.|..|++.|....-|..|+-+|+
T Consensus       343 ~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  343 QEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                       123999999999999999999988876


No 21 
>PHA00616 hypothetical protein
Probab=98.40  E-value=1.3e-07  Score=47.58  Aligned_cols=34  Identities=24%  Similarity=0.375  Sum_probs=21.6

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCC
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPA  168 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~  168 (180)
                      ||+|+.||+.|....+|..|++.        |.|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~--------~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLS--------VHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHH--------hcCCCccceeE
Confidence            46666677777777777777665        44556666554


No 22 
>PHA00732 hypothetical protein
Probab=98.29  E-value=6.8e-07  Score=51.69  Aligned_cols=45  Identities=29%  Similarity=0.507  Sum_probs=31.7

Q ss_pred             ceeccccCcccCChhhHHHHHhh-cCCCCceeccccccccCChHHHHHHHHH
Q psy3356          99 PYHCTECEATFSWKQNLEVHMRT-HTGERPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      ++.|..|++.|.....|..|++. |.   ++.|+.|++.|.   .+..|+++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            35688888888888888888774 43   257888888876   36666654


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.26  E-value=1.8e-06  Score=46.35  Aligned_cols=50  Identities=28%  Similarity=0.499  Sum_probs=26.1

Q ss_pred             cccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhc
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTH  122 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h  122 (180)
                      |.||.|++ ..+...|..|....|.   ...+.+.|++|...+.  .+|..|+..+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~---~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHR---SESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCc---CCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            56666666 3445566666555443   1233456666655322  2555555443


No 24 
>PHA00616 hypothetical protein
Probab=98.23  E-value=5.3e-07  Score=45.41  Aligned_cols=32  Identities=22%  Similarity=0.463  Sum_probs=15.7

Q ss_pred             eeccccCcccCChhhHHHHHhhcCCCCceecc
Q psy3356         100 YHCTECEATFSWKQNLEVHMRTHTGERPYECE  131 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~  131 (180)
                      |+|+.||+.|....++..|+..|++.+++.|+
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            44455555555555555555555544444443


No 25 
>PHA00732 hypothetical protein
Probab=98.13  E-value=1.9e-06  Score=49.83  Aligned_cols=48  Identities=23%  Similarity=0.520  Sum_probs=37.7

Q ss_pred             CcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcC
Q psy3356          66 PFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHT  123 (180)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~  123 (180)
                      ||.|.+|++.|.+...|..|++.+|    .   ++.|+.|++.|.   .+..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H----~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNH----T---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhccc----C---CCccCCCCCEeC---ChhhhhcccC
Confidence            5789999999999999999988532    2   247999999987   5777876543


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.03  E-value=4.2e-06  Score=36.52  Aligned_cols=22  Identities=55%  Similarity=1.026  Sum_probs=15.9

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy3356         128 YECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777764


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.99  E-value=1.3e-05  Score=42.98  Aligned_cols=49  Identities=18%  Similarity=0.376  Sum_probs=36.8

Q ss_pred             ceeccccCcccCChhhHHHHHhhcCC--CCceeccccccccCChHHHHHHHHHc
Q psy3356          99 PYHCTECEATFSWKQNLEVHMRTHTG--ERPYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~~h~~--~~~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      .|.||.|++ ..+...|..|....+.  .+.+.|++|...+.  .+|..|+..+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            478999999 5667888999865443  35688999998654  4888898874


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.83  E-value=1.2e-05  Score=35.06  Aligned_cols=22  Identities=45%  Similarity=1.020  Sum_probs=11.6

Q ss_pred             cccccchhhccChHHHHHHHHh
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRV   88 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~   88 (180)
                      |+|++|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455555555555555555543


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.82  E-value=1.9e-05  Score=34.56  Aligned_cols=23  Identities=52%  Similarity=1.041  Sum_probs=15.1

Q ss_pred             eeccccccccCChHHHHHHHHHc
Q psy3356         128 YECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      |.|+.|++.|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777777777777777777654


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.76  E-value=2.6e-05  Score=47.35  Aligned_cols=73  Identities=21%  Similarity=0.430  Sum_probs=19.5

Q ss_pred             ccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHH
Q psy3356          68 ECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHK  147 (180)
Q Consensus        68 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  147 (180)
                      +|..|+..|.+...|..|+...|...    .+     ....+.....+..++.... ...+.|..|+..|.+...|..|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~----~~-----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm   70 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD----IP-----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHM   70 (100)
T ss_dssp             ----------------------------------------------------------SSEEBSSSS-EESSHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccc----cc-----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHH
Confidence            37778888887777888876554321    11     0011112223333333221 22588888888888888888888


Q ss_pred             HHc
Q psy3356         148 RTH  150 (180)
Q Consensus       148 ~~h  150 (180)
                      +.+
T Consensus        71 ~~~   73 (100)
T PF12756_consen   71 RSK   73 (100)
T ss_dssp             HHT
T ss_pred             cCc
Confidence            864


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.73  E-value=2.3e-05  Score=35.59  Aligned_cols=24  Identities=58%  Similarity=1.122  Sum_probs=18.2

Q ss_pred             ceeccccccccCChHHHHHHHHHc
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      ||.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            467888888888888888887654


No 32 
>KOG2231|consensus
Probab=97.67  E-value=7.2e-05  Score=59.33  Aligned_cols=120  Identities=20%  Similarity=0.275  Sum_probs=84.0

Q ss_pred             cccccceee-eecCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccch---------hhccChHHHHHHHHhccCCCc
Q psy3356          25 FIPACVFRF-SVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCG---------KRFAQKSTLNTHKRVHISYLH   94 (180)
Q Consensus        25 ~c~~C~~~~-~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~---------~~f~~~~~l~~H~~~~~~~~~   94 (180)
                      +|.+|+..+ ...+..+|.+| ..|.....|+.|+...++  .+.|..|-         ...-+...|..|++.-.+--.
T Consensus       101 ~C~~C~~~~~~~~~~~~~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~  177 (669)
T KOG2231|consen  101 SCHICDRRFRALYNKKECLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDE  177 (669)
T ss_pred             hcCccccchhhhcccCCCccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCccc
Confidence            899999998 45668889999 888899999999954332  23344332         222344678888775432000


Q ss_pred             CCCcceeccccCcccCChhhHHHHHhhcCCCCceecccc------ccccCChHHHHHHHHHcC
Q psy3356          95 VKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEIC------GKRFSQKSACNTHKRTHI  151 (180)
Q Consensus        95 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~h~  151 (180)
                      .-.....|..|...|.+...|.+|+..++    |.|..|      +..|.....|..|.+.+|
T Consensus       178 s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  178 SCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            11224679999999999999999998665    455555      456788899999988765


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.61  E-value=4.7e-05  Score=33.25  Aligned_cols=23  Identities=52%  Similarity=1.089  Sum_probs=11.6

Q ss_pred             cccccchhhccChHHHHHHHHhc
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVH   89 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~   89 (180)
                      |.|++|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34555555555555555555543


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.47  E-value=6.1e-05  Score=54.04  Aligned_cols=56  Identities=23%  Similarity=0.665  Sum_probs=41.0

Q ss_pred             CCceeccc--cccccCChHHHHHHHHHcC--------CCC---CCcCCCCCCcccCCCcccCCCccCCC
Q psy3356         125 ERPYECEI--CGKRFSQKSACNTHKRTHI--------PYL---PRVHPKDRPFHCPACEGMFTTKQNLE  180 (180)
Q Consensus       125 ~~~~~C~~--C~~~f~~~~~l~~H~~~h~--------~~~---~~~h~~~~~~~C~~C~~~F~~~~~L~  180 (180)
                      ++||+|++  |.+.+.....|..|+..-|        |..   ...-...|||.|++|+++|..-..|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLK  415 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLK  415 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccce
Confidence            48899976  9999999999999976332        110   01122459999999999998877764


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.41  E-value=5.9e-05  Score=54.12  Aligned_cols=72  Identities=24%  Similarity=0.611  Sum_probs=46.3

Q ss_pred             CCCCccccc--chhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356          63 GERPFECDV--CGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus        63 ~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      +++||+|++  |.+.+.....|+-|+..-|...-..+.|  -+            ..+...-...+||.|++|++.++..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p--~p------------~~~~~F~~~~KPYrCevC~KRYKNl  411 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP--SP------------EKMNIFSAKDKPYRCEVCDKRYKNL  411 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCC--Cc------------cccccccccCCceeccccchhhccC
Confidence            358999998  9999999999999987543211011111  00            0111112346788888888888888


Q ss_pred             HHHHHHHH
Q psy3356         141 SACNTHKR  148 (180)
Q Consensus       141 ~~l~~H~~  148 (180)
                      ..|..|+.
T Consensus       412 NGLKYHr~  419 (423)
T COG5189         412 NGLKYHRK  419 (423)
T ss_pred             ccceeccc
Confidence            88877764


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.37  E-value=0.00019  Score=32.46  Aligned_cols=23  Identities=43%  Similarity=0.817  Sum_probs=11.4

Q ss_pred             eeccccCcccCChhhHHHHHhhc
Q psy3356         100 YHCTECEATFSWKQNLEVHMRTH  122 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~h  122 (180)
                      +.|..|++.|.+...|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            44555555555555555554443


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.34  E-value=0.00019  Score=43.45  Aligned_cols=72  Identities=22%  Similarity=0.318  Sum_probs=21.5

Q ss_pred             EeeeecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHh
Q psy3356          41 FFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMR  120 (180)
Q Consensus        41 ~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  120 (180)
                      |.+|+..|.....|..||...++...   +. ...+.....+..++..      .....+.|..|+..|.+...|..|+.
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~---~~-~~~l~~~~~~~~~~~~------~~~~~~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDI---PD-QKYLVDPNRLLNYLRK------KVKESFRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             ---------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccc---cc-cccccccccccccccc------ccCCCCCCCccCCCCcCHHHHHHHHc
Confidence            55666666699999999866543221   11 1111223333333332      12336899999999999999999998


Q ss_pred             hc
Q psy3356         121 TH  122 (180)
Q Consensus       121 ~h  122 (180)
                      .+
T Consensus        72 ~~   73 (100)
T PF12756_consen   72 SK   73 (100)
T ss_dssp             HT
T ss_pred             Cc
Confidence            65


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.14  E-value=0.00039  Score=30.71  Aligned_cols=23  Identities=57%  Similarity=0.983  Sum_probs=19.6

Q ss_pred             eeccccccccCChHHHHHHHHHc
Q psy3356         128 YECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57888999999999999998864


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=97.07  E-value=0.00044  Score=45.66  Aligned_cols=42  Identities=21%  Similarity=0.575  Sum_probs=34.4

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCccCC
Q psy3356         126 RPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTKQNL  179 (180)
Q Consensus       126 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~~~L  179 (180)
                      -+|.|. |+.   ....+.+|.++        |+++++|.|..|+..|....++
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri--------~~g~~~YrC~~C~~~l~~~~~~  159 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRV--------VRGEAVYRCRRCGETLVFKGEQ  159 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHH--------hcCCccEECCCCCceeEEeccc
Confidence            369998 987   66678899886        7899999999999998876554


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.94  E-value=0.00049  Score=30.39  Aligned_cols=22  Identities=36%  Similarity=0.863  Sum_probs=16.8

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy3356         128 YECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      |.|..|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5677888888888888888764


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.86  E-value=0.00076  Score=29.49  Aligned_cols=22  Identities=36%  Similarity=0.667  Sum_probs=13.1

Q ss_pred             eeccccccccCChHHHHHHHHHc
Q psy3356         128 YECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      |.|+.|..... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            56677776666 66677776654


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.81  E-value=0.0017  Score=33.58  Aligned_cols=20  Identities=30%  Similarity=0.645  Sum_probs=6.6

Q ss_pred             cccccchhhccChHHHHHHH
Q psy3356          67 FECDVCGKRFAQKSTLNTHK   86 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~   86 (180)
                      -+|++|+..+.+..+|..|+
T Consensus        25 atCP~C~a~~~~srnLrRHl   44 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHL   44 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHH
T ss_pred             CCCCcchhhccchhhHHHHH
Confidence            33333333333333333333


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.73  E-value=0.0015  Score=28.71  Aligned_cols=23  Identities=48%  Similarity=0.963  Sum_probs=14.7

Q ss_pred             cccccchhhccChHHHHHHHHhc
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVH   89 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~   89 (180)
                      |.|+.|++.|.....|..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666643


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.45  E-value=0.0038  Score=32.35  Aligned_cols=33  Identities=24%  Similarity=0.516  Sum_probs=24.2

Q ss_pred             CCCcceeccccCcccCChhhHHHHHhhcCCCCc
Q psy3356          95 VKDKPYHCTECEATFSWKQNLEVHMRTHTGERP  127 (180)
Q Consensus        95 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~  127 (180)
                      ..+.|-.|+.|+..+....+|.+|+...++.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            567889999999999999999999988887765


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.40  E-value=0.0026  Score=27.71  Aligned_cols=22  Identities=32%  Similarity=0.677  Sum_probs=10.9

Q ss_pred             cccccchhhccChHHHHHHHHhc
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVH   89 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~   89 (180)
                      |+|+.|+.... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            34555555555 55555555543


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.25  E-value=0.0041  Score=27.32  Aligned_cols=20  Identities=35%  Similarity=0.753  Sum_probs=10.1

Q ss_pred             eccccCcccCChhhHHHHHh
Q psy3356         101 HCTECEATFSWKQNLEVHMR  120 (180)
Q Consensus       101 ~C~~C~~~~~~~~~l~~H~~  120 (180)
                      .|..|+..|.+...+..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            45555555555555555543


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.18  E-value=0.001  Score=30.00  Aligned_cols=21  Identities=29%  Similarity=0.741  Sum_probs=16.7

Q ss_pred             eeccccccccCChHHHHHHHH
Q psy3356         128 YECEICGKRFSQKSACNTHKR  148 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~  148 (180)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            578888888888888887765


No 48 
>KOG2231|consensus
Probab=96.13  E-value=0.0054  Score=49.13  Aligned_cols=125  Identities=20%  Similarity=0.361  Sum_probs=83.3

Q ss_pred             cccccCCceeeeeecccCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhc-CCCC----CcccccchhhccC
Q psy3356           4 SKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTH-TGER----PFECDVCGKRFAQ   78 (180)
Q Consensus         4 ~~f~~~~~~~~~~~~~~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h-~~~~----~~~C~~C~~~f~~   78 (180)
                      ..|.+...|..|+...+... .|..|     ..+...+.++.+.| +...|..|+..- .++.    --.|..|...|..
T Consensus       122 ~~~~s~~~Lk~H~~~~H~~~-~c~lC-----~~~~kif~~e~k~Y-t~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld  194 (669)
T KOG2231|consen  122 TEFKSVENLKNHMRDQHKLH-LCSLC-----LQNLKIFINERKLY-TRAELNLHLMFGDPDDESCRGHPLCKFCHERFLD  194 (669)
T ss_pred             cchhHHHHHHHHHHHhhhhh-ccccc-----cccceeeeeeeehe-hHHHHHHHHhcCCCccccccCCccchhhhhhhcc
Confidence            56678888888887777766 78887     34444556677777 567777776542 2121    1359999999999


Q ss_pred             hHHHHHHHHhccCCCcCCCcceecccc------CcccCChhhHHHHHhhcCCCCceecc--ccc-cccCChHHHHHHHH
Q psy3356          79 KSTLNTHKRVHISYLHVKDKPYHCTEC------EATFSWKQNLEVHMRTHTGERPYECE--ICG-KRFSQKSACNTHKR  148 (180)
Q Consensus        79 ~~~l~~H~~~~~~~~~~~~~~~~C~~C------~~~~~~~~~l~~H~~~h~~~~~~~C~--~C~-~~f~~~~~l~~H~~  148 (180)
                      ...|..|++..|         +.|..|      +..|.....|..|.+..+    |.|.  .|. +.|.....+..+++
T Consensus       195 ~~el~rH~~~~h---------~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  195 DDELYRHLRFDH---------EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             HHHHHHhhccce---------eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhHHHHHHH
Confidence            999999988653         456666      355666778888877655    6665  454 33444434555555


No 49 
>KOG1146|consensus
Probab=96.03  E-value=0.0029  Score=53.78  Aligned_cols=100  Identities=19%  Similarity=0.380  Sum_probs=71.5

Q ss_pred             CCchhhhHhh-hcCCCCCcccccchhhccChHHHHHHHHhccCC--------------------CcCCCcceeccccCcc
Q psy3356          50 PLLVPQIHMR-THTGERPFECDVCGKRFAQKSTLNTHKRVHISY--------------------LHVKDKPYHCTECEAT  108 (180)
Q Consensus        50 ~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~--------------------~~~~~~~~~C~~C~~~  108 (180)
                      ....+..|+. .+...+.+.|+.|+..|.....|..|++..|..                    +..+.++|.|..|...
T Consensus       448 s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~s  527 (1406)
T KOG1146|consen  448 SKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYS  527 (1406)
T ss_pred             hhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeee
Confidence            3333444432 344457799999999999999999999884431                    2245667889999999


Q ss_pred             cCChhhHHHHHhhcCC-------------------------------------------CCceeccccccccCChHHHHH
Q psy3356         109 FSWKQNLEVHMRTHTG-------------------------------------------ERPYECEICGKRFSQKSACNT  145 (180)
Q Consensus       109 ~~~~~~l~~H~~~h~~-------------------------------------------~~~~~C~~C~~~f~~~~~l~~  145 (180)
                      +..+.+|.+|++....                                           .-.|.|.+|++...-..+|..
T Consensus       528 tttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlri  607 (1406)
T KOG1146|consen  528 TTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRI  607 (1406)
T ss_pred             eecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhcccc
Confidence            9999999999864210                                           012788888888888888888


Q ss_pred             HHHH
Q psy3356         146 HKRT  149 (180)
Q Consensus       146 H~~~  149 (180)
                      |+..
T Consensus       608 hmts  611 (1406)
T KOG1146|consen  608 HMTA  611 (1406)
T ss_pred             cccc
Confidence            8764


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=95.98  E-value=0.007  Score=40.07  Aligned_cols=39  Identities=33%  Similarity=0.767  Sum_probs=33.5

Q ss_pred             cceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356          98 KPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus        98 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      -+|.|. |+.   ....+.+|.+.+.++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            369998 987   677889999999999999999999987643


No 51 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.24  E-value=0.02  Score=25.24  Aligned_cols=21  Identities=29%  Similarity=0.836  Sum_probs=13.8

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy3356         128 YECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      ..|+.|++.| ....|..|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577777777 55567777653


No 52 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.72  E-value=0.011  Score=26.55  Aligned_cols=21  Identities=33%  Similarity=0.817  Sum_probs=12.5

Q ss_pred             eeccccCcccCChhhHHHHHh
Q psy3356         100 YHCTECEATFSWKQNLEVHMR  120 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~  120 (180)
                      |.|..|++.|.+...+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            346666666666666655554


No 53 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.61  E-value=0.031  Score=26.61  Aligned_cols=23  Identities=17%  Similarity=0.626  Sum_probs=18.6

Q ss_pred             ceeccccccccCChHHHHHHHHH
Q psy3356         127 PYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      +|.|+.|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888888888888753


No 54 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.12  E-value=0.046  Score=40.27  Aligned_cols=133  Identities=17%  Similarity=0.230  Sum_probs=82.7

Q ss_pred             CCcccccCCceeeeeecccCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcCCCC----Ccccccchhhcc
Q psy3356           2 CSSKWITSPSVTFDINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGER----PFECDVCGKRFA   77 (180)
Q Consensus         2 C~~~f~~~~~~~~~~~~~~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~----~~~C~~C~~~f~   77 (180)
                      |.+....+..+..|....+... .|.+|-..=.      -+-|....-++..|+.|...-..+.    -=.|..|...|.
T Consensus       159 c~~~C~~~k~lk~H~K~~H~~~-~C~~C~~nKk------~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FY  231 (493)
T COG5236         159 CHRRCGSLKELKKHYKAQHGFV-LCSECIGNKK------DFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFY  231 (493)
T ss_pred             hhhhhhhHHHHHHHHHhhcCcE-EhHhhhcCcc------cCccceeeeecccccccccCCccccCcCCCchhhhccceec
Confidence            5555566667777777777766 7777743211      1112223335566777754322221    125999999999


Q ss_pred             ChHHHHHHHHhccCCCcCCCcceeccccC----cccCChhhHHHHHhhcCCCCceeccc--cc----cccCChHHHHHHH
Q psy3356          78 QKSTLNTHKRVHISYLHVKDKPYHCTECE----ATFSWKQNLEVHMRTHTGERPYECEI--CG----KRFSQKSACNTHK  147 (180)
Q Consensus        78 ~~~~l~~H~~~~~~~~~~~~~~~~C~~C~----~~~~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~~~~l~~H~  147 (180)
                      ....|..|.+..      .+.-+.|.+-+    ..|.+...|..|.+..+    |.|.+  |.    ..|.....|+.|+
T Consensus       232 dDDEL~~HcR~~------HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         232 DDDELRRHCRLR------HEACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             ChHHHHHHHHhh------hhhhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHHHHHH
Confidence            999999998874      34555555543    33666777777776433    55532  32    4688999999998


Q ss_pred             HHcC
Q psy3356         148 RTHI  151 (180)
Q Consensus       148 ~~h~  151 (180)
                      ...|
T Consensus       302 ~~~h  305 (493)
T COG5236         302 TRFH  305 (493)
T ss_pred             HHHh
Confidence            6654


No 55 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.06  E-value=0.063  Score=33.10  Aligned_cols=48  Identities=19%  Similarity=0.436  Sum_probs=27.2

Q ss_pred             eccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHc
Q psy3356         101 HCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       101 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      .|..|...|........  ..-.....|.|+.|+..|=..-+...|...|
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhcc
Confidence            37777776654321100  0012234577877877777777777776665


No 56 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.65  E-value=0.24  Score=30.59  Aligned_cols=24  Identities=29%  Similarity=0.519  Sum_probs=21.9

Q ss_pred             eec----cccccccCChHHHHHHHHHcC
Q psy3356         128 YEC----EICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       128 ~~C----~~C~~~f~~~~~l~~H~~~h~  151 (180)
                      |.|    ..|++...+...+.+|.+.+|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            899    999999999999999998754


No 57 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.42  E-value=0.054  Score=25.63  Aligned_cols=9  Identities=44%  Similarity=1.530  Sum_probs=4.2

Q ss_pred             Cceeccccc
Q psy3356         126 RPYECEICG  134 (180)
Q Consensus       126 ~~~~C~~C~  134 (180)
                      .++.|+.|+
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            344455554


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.66  E-value=0.094  Score=25.00  Aligned_cols=11  Identities=27%  Similarity=0.848  Sum_probs=7.6

Q ss_pred             ceecccccccc
Q psy3356         127 PYECEICGKRF  137 (180)
Q Consensus       127 ~~~C~~C~~~f  137 (180)
                      .|.|..||..+
T Consensus         2 ~~~C~~CG~i~   12 (34)
T cd00729           2 VWVCPVCGYIH   12 (34)
T ss_pred             eEECCCCCCEe
Confidence            36788888664


No 59 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=92.64  E-value=0.14  Score=24.74  Aligned_cols=33  Identities=24%  Similarity=0.696  Sum_probs=17.8

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccC
Q psy3356         128 YECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMF  173 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F  173 (180)
                      ..|+.|+..|.-....             +-.+....+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-------------ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-------------IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-------------CCCCCcEEECCCCCCEe
Confidence            3566666666555442             12233346677776665


No 60 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.49  E-value=0.088  Score=24.98  Aligned_cols=22  Identities=23%  Similarity=0.694  Sum_probs=15.1

Q ss_pred             CcccccchhhccChHHHHHHHH
Q psy3356          66 PFECDVCGKRFAQKSTLNTHKR   87 (180)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~   87 (180)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            3567777777777767777754


No 61 
>KOG2482|consensus
Probab=91.96  E-value=0.15  Score=37.60  Aligned_cols=112  Identities=15%  Similarity=0.213  Sum_probs=66.5

Q ss_pred             CeeEeeeecccCCCchhhhHhhh--cCCCCC--------cccccchhhccChHHHHHHH--Hhc--cCC--------CcC
Q psy3356          38 EKRFFFFSFLFGPLLVPQIHMRT--HTGERP--------FECDVCGKRFAQKSTLNTHK--RVH--ISY--------LHV   95 (180)
Q Consensus        38 ~~~~~~C~~~~~~~~~l~~H~~~--h~~~~~--------~~C~~C~~~f~~~~~l~~H~--~~~--~~~--------~~~   95 (180)
                      ..+|.+|.+.|+.+.-|..||+.  |....|        |.-++-..+ ...+....+.  .+.  +..        ...
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~-ks~t~~~~e~dret~~d~~E~D~~wsDw~ed  273 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVG-KSWTIVHSEDDRETNEDINETDDTWSDWNED  273 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcC-CccchhhhhhhhhhhccccccccchhhhhcC
Confidence            78888999999999999999874  322211        211111110 1111111111  110  000        001


Q ss_pred             CCcc--eeccccCcccCChhhHHHHHhhcCC---------------------------CCceeccccccccCChHHHHHH
Q psy3356          96 KDKP--YHCTECEATFSWKQNLEVHMRTHTG---------------------------ERPYECEICGKRFSQKSACNTH  146 (180)
Q Consensus        96 ~~~~--~~C~~C~~~~~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H  146 (180)
                      +..+  ..|..|.....+...+..|++.-+.                           ...-.|-.|.-.|.....|..|
T Consensus       274 ~a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~h  353 (423)
T KOG2482|consen  274 DAEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIH  353 (423)
T ss_pred             CCCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhh
Confidence            1222  5899999988889999999875332                           0114688899999999999999


Q ss_pred             HHHc
Q psy3356         147 KRTH  150 (180)
Q Consensus       147 ~~~h  150 (180)
                      +..+
T Consensus       354 m~e~  357 (423)
T KOG2482|consen  354 MVED  357 (423)
T ss_pred             cccc
Confidence            8754


No 62 
>KOG2893|consensus
Probab=91.93  E-value=0.046  Score=38.11  Aligned_cols=44  Identities=18%  Similarity=0.417  Sum_probs=29.0

Q ss_pred             CeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHH
Q psy3356          38 EKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTH   85 (180)
Q Consensus        38 ~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H   85 (180)
                      .-+|++|+..|.....|.+|++.-    -|+|.+|-+...+--.|..|
T Consensus        10 kpwcwycnrefddekiliqhqkak----hfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   10 KPWCWYCNREFDDEKILIQHQKAK----HFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             Cceeeecccccchhhhhhhhhhhc----cceeeeehhhhccCCCceee
Confidence            346777777777777777776553    37787777665554445544


No 63 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=91.74  E-value=0.13  Score=34.23  Aligned_cols=23  Identities=35%  Similarity=0.977  Sum_probs=18.1

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCc
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACE  170 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~  170 (180)
                      .|+|++||+.                     +.|+.|-.||+||
T Consensus       134 ~~vC~vCGy~---------------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT---------------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc---------------------ccCCCCCcCCCCC
Confidence            5899999855                     4457788899998


No 64 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.37  E-value=0.2  Score=30.87  Aligned_cols=30  Identities=30%  Similarity=0.770  Sum_probs=18.2

Q ss_pred             eeccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356         100 YHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      ..|+.||..|-           -.++.|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFY-----------DLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFY-----------DLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhc-----------cCCCCCccCCCCCCccCcc
Confidence            45677776653           3445666677777666544


No 65 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=90.90  E-value=0.078  Score=23.60  Aligned_cols=23  Identities=22%  Similarity=0.271  Sum_probs=11.0

Q ss_pred             cccccceeeeecCCeeEeeeeccc
Q psy3356          25 FIPACVFRFSVENEKRFFFFSFLF   48 (180)
Q Consensus        25 ~c~~C~~~~~~~~~~~~~~C~~~~   48 (180)
                      .||.|+...+ .+...|..||..|
T Consensus         2 ~CP~C~~~V~-~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVP-ESAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCch-hhcCcCCCCCCCC
Confidence            4666666554 3333344444443


No 66 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.86  E-value=0.23  Score=24.10  Aligned_cols=34  Identities=26%  Similarity=0.647  Sum_probs=17.8

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCC
Q psy3356         128 YECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFT  174 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~  174 (180)
                      ..|+.|+..|.-..+-             +-.+....+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-------------l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-------------LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-------------cccCCcEEECCCCCcEee
Confidence            3566666666555431             112334466666666553


No 67 
>KOG4173|consensus
Probab=90.51  E-value=0.034  Score=37.85  Aligned_cols=76  Identities=24%  Similarity=0.517  Sum_probs=59.1

Q ss_pred             Cccccc--chhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhh-c---------CCCCceecc--
Q psy3356          66 PFECDV--CGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRT-H---------TGERPYECE--  131 (180)
Q Consensus        66 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~-h---------~~~~~~~C~--  131 (180)
                      .+.|++  |.+.|........|..+-|     +   -.|.+|.+.|.+...|..|+.. |         -|...|.|-  
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h-----~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvE  150 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLH-----G---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVE  150 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcc-----c---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHH
Confidence            367887  8888888888888876552     2   2599999999999999999853 2         234568894  


Q ss_pred             ccccccCChHHHHHHHHH
Q psy3356         132 ICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       132 ~C~~~f~~~~~l~~H~~~  149 (180)
                      .|+..|.+...-..|+-.
T Consensus       151 gCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  151 GCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhhhhhhhHHHH
Confidence            599999999999888877


No 68 
>KOG1146|consensus
Probab=90.38  E-value=0.17  Score=43.81  Aligned_cols=100  Identities=17%  Similarity=0.226  Sum_probs=53.6

Q ss_pred             cccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhh-----------------cCCCCcee
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRT-----------------HTGERPYE  129 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~-----------------h~~~~~~~  129 (180)
                      +.|..|++++.....+. ++        .....|.|.+|...|.....|..|.+.                 +....+| 
T Consensus      1261 ~~c~~~~~~~~~~~~~~-~l--------~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~- 1330 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGIS-TL--------DVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH- 1330 (1406)
T ss_pred             chhhhccccccCcccee-ec--------ccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-
Confidence            44555555554444433 22        123344555555555555555555431                 1122345 


Q ss_pred             ccccccccCChHHHHHHHHHcCCCC----------------CCcCCCCCCcccCCCcccCCCc
Q psy3356         130 CEICGKRFSQKSACNTHKRTHIPYL----------------PRVHPKDRPFHCPACEGMFTTK  176 (180)
Q Consensus       130 C~~C~~~f~~~~~l~~H~~~h~~~~----------------~~~h~~~~~~~C~~C~~~F~~~  176 (180)
                      |..|...|.....|++|+++-+...                ..++..+.-+.|+.|...|...
T Consensus      1331 c~~c~~~~~~~~alqihm~~~~~~~kt~~~~p~~~~~~t~~~tst~~~v~~a~~~~~~~~~es 1393 (1406)
T KOG1146|consen 1331 CLACEVLLSGREALQIHMRSSAHRRKTAPPQPGPPISITNAATSTSAAVAFAGSEARLPHTES 1393 (1406)
T ss_pred             chHHHhhcchhHHHHHHHHHhhhcccCCCCCCCCccccccccccccccccccccccccccccc
Confidence            8888888888888888887543111                1234444557777776666544


No 69 
>KOG1280|consensus
Probab=90.20  E-value=0.32  Score=35.99  Aligned_cols=81  Identities=17%  Similarity=0.163  Sum_probs=53.8

Q ss_pred             cccccccceeeeecCCeeEeeeec------ccCCCchhhhHhhhc----------------------CCCCCcccccchh
Q psy3356          23 LVFIPACVFRFSVENEKRFFFFSF------LFGPLLVPQIHMRTH----------------------TGERPFECDVCGK   74 (180)
Q Consensus        23 ~~~c~~C~~~~~~~~~~~~~~C~~------~~~~~~~l~~H~~~h----------------------~~~~~~~C~~C~~   74 (180)
                      .+.|..|++.--.-..++|..|..      -|.+......|-..|                      .....|+|++|+.
T Consensus         8 ~v~CdgC~k~~~t~rrYkCL~C~DyDlC~sCyen~~tt~~H~~dHPmqcil~~~dfeL~f~Ge~i~~y~~qSftCPyC~~   87 (381)
T KOG1280|consen    8 GVSCDGCGKTAFTFRRYKCLRCSDYDLCFSCYENGATTPIHDEDHPMQCILSRVDFELYFGGEPISHYDPQSFTCPYCGI   87 (381)
T ss_pred             CceeccccccceeeeeeEeeeecchhHHHHHhhcCCCCcccCCCCceeEEeeccceeeEecCccccccccccccCCcccc
Confidence            458999999888888999997644      233333333332111                      1233589999999


Q ss_pred             hccChHHHHHHHHhccCCCcCCCcceeccccC
Q psy3356          75 RFAQKSTLNTHKRVHISYLHVKDKPYHCTECE  106 (180)
Q Consensus        75 ~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~  106 (180)
                      +-.+...|..|+...|..+.   ....|++|.
T Consensus        88 ~Gfte~~f~~Hv~s~Hpda~---~~~icp~c~  116 (381)
T KOG1280|consen   88 MGFTERQFGTHVLSQHPEAS---TSVICPLCA  116 (381)
T ss_pred             cccchhHHHHHhhhcCcccC---cceeeeccc
Confidence            98889999999887765432   345677665


No 70 
>KOG4173|consensus
Probab=90.02  E-value=0.32  Score=33.29  Aligned_cols=77  Identities=22%  Similarity=0.370  Sum_probs=44.2

Q ss_pred             eecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccCC-----CcCCCcceeccc--cCcccCChhhHH
Q psy3356          44 FSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISY-----LHVKDKPYHCTE--CEATFSWKQNLE  116 (180)
Q Consensus        44 C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-----~~~~~~~~~C~~--C~~~~~~~~~l~  116 (180)
                      |-..|.....+..|..+-++   ..|..|.+.|.+...|..|+..-|..     ...|.-.|.|-+  |+..|.+...-.
T Consensus        87 c~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~Rk  163 (253)
T KOG4173|consen   87 CCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRK  163 (253)
T ss_pred             hHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhh
Confidence            44455555555555544332   24777777777777777776543311     113455577754  777777777777


Q ss_pred             HHHh-hcC
Q psy3356         117 VHMR-THT  123 (180)
Q Consensus       117 ~H~~-~h~  123 (180)
                      .|+. .|.
T Consensus       164 dH~I~~Hk  171 (253)
T KOG4173|consen  164 DHMIRMHK  171 (253)
T ss_pred             hHHHHhcc
Confidence            7763 443


No 71 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.00  E-value=0.21  Score=30.76  Aligned_cols=14  Identities=36%  Similarity=0.947  Sum_probs=7.8

Q ss_pred             CCcccCCCcccCCC
Q psy3356         162 RPFHCPACEGMFTT  175 (180)
Q Consensus       162 ~~~~C~~C~~~F~~  175 (180)
                      .|-.|+.||..|.-
T Consensus        25 ~PivCP~CG~~~~~   38 (108)
T PF09538_consen   25 DPIVCPKCGTEFPP   38 (108)
T ss_pred             CCccCCCCCCccCc
Confidence            44556666665543


No 72 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.93  E-value=0.27  Score=23.91  Aligned_cols=14  Identities=21%  Similarity=0.562  Sum_probs=7.7

Q ss_pred             eeccccccccCChH
Q psy3356         128 YECEICGKRFSQKS  141 (180)
Q Consensus       128 ~~C~~C~~~f~~~~  141 (180)
                      +.|+.|+..|.-..
T Consensus         3 ~~CP~C~~~~~v~~   16 (38)
T TIGR02098         3 IQCPNCKTSFRVVD   16 (38)
T ss_pred             EECCCCCCEEEeCH
Confidence            45666666555443


No 73 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.80  E-value=0.62  Score=28.82  Aligned_cols=91  Identities=16%  Similarity=0.171  Sum_probs=52.7

Q ss_pred             ccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcC-----CCC-------CcccccchhhccChHHHHHHHHhccC
Q psy3356          24 VFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHT-----GER-------PFECDVCGKRFAQKSTLNTHKRVHIS   91 (180)
Q Consensus        24 ~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~-----~~~-------~~~C~~C~~~f~~~~~l~~H~~~~~~   91 (180)
                      |.||.|+...- .-...|.+|+.+.-....|.+-...-.     .+.       .-.|--|...|........-  .   
T Consensus         2 Y~CPrC~skvC-~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~---   75 (112)
T TIGR00622         2 YFCPQCRAKVC-ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--E---   75 (112)
T ss_pred             ccCCCCCCCcc-CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccccc--c---
Confidence            57888877765 334667778877766666666421100     011       11377777777653211100  0   


Q ss_pred             CCcCCCcceeccccCcccCChhhHHHHHhhc
Q psy3356          92 YLHVKDKPYHCTECEATFSWKQNLEVHMRTH  122 (180)
Q Consensus        92 ~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h  122 (180)
                        ......|.|+.|...|-..-++..|...|
T Consensus        76 --~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        76 --LKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             --cccccceeCCCCCCccccccchhhhhhcc
Confidence              02345678888888888777777777665


No 74 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.80  E-value=0.15  Score=26.90  Aligned_cols=26  Identities=27%  Similarity=0.545  Sum_probs=14.8

Q ss_pred             CCCceeccccccccCChHHHHHHHHH
Q psy3356         124 GERPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       124 ~~~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      |+..+.|+-|+..|....++.+|...
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhH
Confidence            44445566666666666666666543


No 75 
>KOG2186|consensus
Probab=89.74  E-value=0.31  Score=34.48  Aligned_cols=46  Identities=24%  Similarity=0.626  Sum_probs=29.9

Q ss_pred             cccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHh
Q psy3356          67 FECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMR  120 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  120 (180)
                      |.|..||.+.... .+..|+...     .+ .-+.|..|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srC-----rn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRC-----RN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhc-----cC-CeeEEeeccccccc-chhhhhhh
Confidence            6677777776654 355677665     23 56777777777766 55666654


No 76 
>PHA00626 hypothetical protein
Probab=89.41  E-value=0.06  Score=28.47  Aligned_cols=14  Identities=36%  Similarity=0.598  Sum_probs=8.8

Q ss_pred             CceeccccccccCC
Q psy3356         126 RPYECEICGKRFSQ  139 (180)
Q Consensus       126 ~~~~C~~C~~~f~~  139 (180)
                      ..|.|+.|++.|..
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            45777777766643


No 77 
>KOG2893|consensus
Probab=89.37  E-value=0.099  Score=36.53  Aligned_cols=42  Identities=24%  Similarity=0.571  Sum_probs=26.9

Q ss_pred             ccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHH
Q psy3356          68 ECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVH  118 (180)
Q Consensus        68 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H  118 (180)
                      +|.+|.+.|..+.-|.+|++.         +.++|.+|.+...+-..|..|
T Consensus        12 wcwycnrefddekiliqhqka---------khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA---------KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhh---------ccceeeeehhhhccCCCceee
Confidence            377777777777777777553         456777776554444444444


No 78 
>KOG2482|consensus
Probab=89.32  E-value=0.57  Score=34.72  Aligned_cols=142  Identities=17%  Similarity=0.257  Sum_probs=76.7

Q ss_pred             CeeEeeeecccC-CCchhhhHhh-hcC---C------------------CCCcccccchhhccChHHHHHHHHhccCC-C
Q psy3356          38 EKRFFFFSFLFG-PLLVPQIHMR-THT---G------------------ERPFECDVCGKRFAQKSTLNTHKRVHISY-L   93 (180)
Q Consensus        38 ~~~~~~C~~~~~-~~~~l~~H~~-~h~---~------------------~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-~   93 (180)
                      ...|.||+..+. ....+..|+- .|.   |                  -..+.|-.|.+.|+.+..|+.||+..... .
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrri  223 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRI  223 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCccc
Confidence            578888887664 4444445532 221   0                  11478999999999999999999754211 1


Q ss_pred             cCCCcce----ec--cccCcccCC-hhhHHHHHhhc-------------CCCCc--eeccccccccCChHHHHHHHHHcC
Q psy3356          94 HVKDKPY----HC--TECEATFSW-KQNLEVHMRTH-------------TGERP--YECEICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus        94 ~~~~~~~----~C--~~C~~~~~~-~~~l~~H~~~h-------------~~~~~--~~C~~C~~~f~~~~~l~~H~~~h~  151 (180)
                      .+...-|    .=  ..-++.... ...+.+-....             .+..+  ..|-.|.........|..||++-|
T Consensus       224 nPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  224 NPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             CCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHHH
Confidence            0111111    00  001211111 11111000000             01122  589999999998999999999877


Q ss_pred             CCC-------------CC------cCCCCCCcccCCCcccCCCccCC
Q psy3356         152 PYL-------------PR------VHPKDRPFHCPACEGMFTTKQNL  179 (180)
Q Consensus       152 ~~~-------------~~------~h~~~~~~~C~~C~~~F~~~~~L  179 (180)
                      .+.             ++      +....+.-.|-.|...|-.+..|
T Consensus       304 e~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l  350 (423)
T KOG2482|consen  304 EFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGL  350 (423)
T ss_pred             HhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchh
Confidence            432             00      11122334578888888877665


No 79 
>KOG2186|consensus
Probab=88.48  E-value=0.41  Score=33.87  Aligned_cols=48  Identities=25%  Similarity=0.593  Sum_probs=38.6

Q ss_pred             ceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHH
Q psy3356          99 PYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      -+.|..||.... +..+.+|+....+ ..|.|..|+..|.. .++..|..-
T Consensus         3 ~FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            478999998754 6678889988877 56999999999988 678888764


No 80 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=88.35  E-value=0.41  Score=35.52  Aligned_cols=77  Identities=22%  Similarity=0.375  Sum_probs=40.8

Q ss_pred             Cccccc--chhhccChHHHHHHHHhccCCCcCCCcceeccccC---c------ccCChhhHHHHHhhcCCC----Cceec
Q psy3356          66 PFECDV--CGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECE---A------TFSWKQNLEVHMRTHTGE----RPYEC  130 (180)
Q Consensus        66 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~---~------~~~~~~~l~~H~~~h~~~----~~~~C  130 (180)
                      .|.|+.  |.........|..|.+..|.       .+.|..|-   +      ...+...|..|...-..+    ..-.|
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~-------~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C  223 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG-------FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLC  223 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC-------cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchh
Confidence            367876  77777777889999886543       12333331   1      112233444444322211    11246


Q ss_pred             cccccccCChHHHHHHHHH
Q psy3356         131 EICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       131 ~~C~~~f~~~~~l~~H~~~  149 (180)
                      ..|...|.+...|.+|++.
T Consensus       224 ~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         224 IFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hhccceecChHHHHHHHHh
Confidence            6666666666666666654


No 81 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.09  E-value=0.34  Score=25.63  Aligned_cols=30  Identities=23%  Similarity=0.455  Sum_probs=23.8

Q ss_pred             cCCCCCcccccchhhccChHHHHHHHHhcc
Q psy3356          61 HTGERPFECDVCGKRFAQKSTLNTHKRVHI   90 (180)
Q Consensus        61 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~   90 (180)
                      ..++..+.|+-|+..|....+...|+...|
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            345667889999999999888998886554


No 82 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.21  E-value=0.31  Score=24.39  Aligned_cols=11  Identities=18%  Similarity=0.298  Sum_probs=8.5

Q ss_pred             ccccccceeee
Q psy3356          24 VFIPACVFRFS   34 (180)
Q Consensus        24 ~~c~~C~~~~~   34 (180)
                      |.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            47888888877


No 83 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.80  E-value=0.15  Score=35.66  Aligned_cols=12  Identities=25%  Similarity=0.639  Sum_probs=8.8

Q ss_pred             eeccccccccCC
Q psy3356         128 YECEICGKRFSQ  139 (180)
Q Consensus       128 ~~C~~C~~~f~~  139 (180)
                      ..|+.||.++..
T Consensus        49 ~vCP~CgyA~~~   60 (214)
T PF09986_consen   49 WVCPHCGYAAFE   60 (214)
T ss_pred             EECCCCCCcccc
Confidence            578888887653


No 84 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=86.54  E-value=1.4  Score=28.80  Aligned_cols=14  Identities=21%  Similarity=0.733  Sum_probs=7.5

Q ss_pred             CceeccccccccCC
Q psy3356         126 RPYECEICGKRFSQ  139 (180)
Q Consensus       126 ~~~~C~~C~~~f~~  139 (180)
                      ..|.|+.|+..|..
T Consensus        98 ~~Y~Cp~C~~~y~~  111 (147)
T smart00531       98 AYYKCPNCQSKYTF  111 (147)
T ss_pred             cEEECcCCCCEeeH
Confidence            34556666555543


No 85 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=86.43  E-value=0.44  Score=25.66  Aligned_cols=10  Identities=40%  Similarity=1.434  Sum_probs=6.4

Q ss_pred             CCCcccCCCc
Q psy3356         161 DRPFHCPACE  170 (180)
Q Consensus       161 ~~~~~C~~C~  170 (180)
                      ..+|.|+.||
T Consensus        48 g~~Y~Cp~CG   57 (61)
T COG2888          48 GNPYRCPKCG   57 (61)
T ss_pred             CCceECCCcC
Confidence            3457777776


No 86 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=86.07  E-value=0.28  Score=37.52  Aligned_cols=47  Identities=34%  Similarity=0.700  Sum_probs=38.1

Q ss_pred             eeecccCCCchhhhHhh--hcCCC--CCcccc--cchhhccChHHHHHHHHhc
Q psy3356          43 FFSFLFGPLLVPQIHMR--THTGE--RPFECD--VCGKRFAQKSTLNTHKRVH   89 (180)
Q Consensus        43 ~C~~~~~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~   89 (180)
                      .|...|.....+..|..  .|.++  +++.|+  .|++.|.....+..|...+
T Consensus       294 ~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  346 (467)
T COG5048         294 QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLH  346 (467)
T ss_pred             cccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccc
Confidence            34455558888888988  78888  889999  7999999988888888776


No 87 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.70  E-value=0.75  Score=29.02  Aligned_cols=31  Identities=19%  Similarity=0.400  Sum_probs=20.7

Q ss_pred             ceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356          99 PYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      ...|+.|+..|-           -.++.|..|+.||..|...
T Consensus         9 Kr~Cp~cg~kFY-----------DLnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         9 KRICPNTGSKFY-----------DLNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cccCCCcCcccc-----------ccCCCCccCCCcCCccCcc
Confidence            356777777763           3456777788888776544


No 88 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=85.26  E-value=2.9  Score=25.73  Aligned_cols=26  Identities=27%  Similarity=0.567  Sum_probs=23.0

Q ss_pred             ceec----cccCcccCChhhHHHHHhhcCC
Q psy3356          99 PYHC----TECEATFSWKQNLEVHMRTHTG  124 (180)
Q Consensus        99 ~~~C----~~C~~~~~~~~~l~~H~~~h~~  124 (180)
                      .|.|    ..|+..+.+...+.+|+..+++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999987764


No 89 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.70  E-value=1  Score=24.30  Aligned_cols=11  Identities=36%  Similarity=1.132  Sum_probs=7.6

Q ss_pred             CCCcccCCCcc
Q psy3356         161 DRPFHCPACEG  171 (180)
Q Consensus       161 ~~~~~C~~C~~  171 (180)
                      ..+|.|+.||.
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            35688888874


No 90 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.49  E-value=1.1  Score=29.74  Aligned_cols=18  Identities=22%  Similarity=0.253  Sum_probs=8.5

Q ss_pred             CceeccccccccCChHHH
Q psy3356         126 RPYECEICGKRFSQKSAC  143 (180)
Q Consensus       126 ~~~~C~~C~~~f~~~~~l  143 (180)
                      .-|.|+.|+..|.....+
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             CeEECCCCCcEeeHHHHH
Confidence            335555555544444443


No 91 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=83.69  E-value=0.85  Score=23.51  Aligned_cols=14  Identities=21%  Similarity=0.534  Sum_probs=9.9

Q ss_pred             ccccccceeeeecC
Q psy3356          24 VFIPACVFRFSVEN   37 (180)
Q Consensus        24 ~~c~~C~~~~~~~~   37 (180)
                      +.|..|+..+....
T Consensus         2 y~C~~CgyvYd~~~   15 (47)
T PF00301_consen    2 YQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEETTTSBEEETTT
T ss_pred             cCCCCCCEEEcCCc
Confidence            57888888887433


No 92 
>KOG2071|consensus
Probab=83.11  E-value=0.99  Score=36.02  Aligned_cols=16  Identities=31%  Similarity=0.816  Sum_probs=13.5

Q ss_pred             CCCcccCCCcccCCCc
Q psy3356         161 DRPFHCPACEGMFTTK  176 (180)
Q Consensus       161 ~~~~~C~~C~~~F~~~  176 (180)
                      +++..|++|+..|..-
T Consensus       511 e~~~~C~IC~EkFe~v  526 (579)
T KOG2071|consen  511 ERQASCPICQEKFEVV  526 (579)
T ss_pred             ccccCCccccccccee
Confidence            7889999999988653


No 93 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=81.54  E-value=0.84  Score=23.28  Aligned_cols=10  Identities=30%  Similarity=1.225  Sum_probs=5.3

Q ss_pred             cccccchhhc
Q psy3356          67 FECDVCGKRF   76 (180)
Q Consensus        67 ~~C~~C~~~f   76 (180)
                      |.|+.|+..+
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 94 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=80.67  E-value=1.6  Score=29.63  Aligned_cols=16  Identities=31%  Similarity=0.569  Sum_probs=7.6

Q ss_pred             ceeccccccccCChHH
Q psy3356         127 PYECEICGKRFSQKSA  142 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~  142 (180)
                      .|.|+.|+..|.....
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            3555555554444433


No 95 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.74  E-value=0.28  Score=32.31  Aligned_cols=12  Identities=25%  Similarity=0.664  Sum_probs=6.0

Q ss_pred             eeccccCcccCC
Q psy3356         100 YHCTECEATFSW  111 (180)
Q Consensus       100 ~~C~~C~~~~~~  111 (180)
                      ++|+.||+.|.+
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            445555555444


No 96 
>KOG2785|consensus
Probab=79.66  E-value=3  Score=31.53  Aligned_cols=51  Identities=24%  Similarity=0.382  Sum_probs=43.4

Q ss_pred             eeccccCcccCChhhHHHHHhhcCCC-----------------------Cceeccccc---cccCChHHHHHHHHHc
Q psy3356         100 YHCTECEATFSWKQNLEVHMRTHTGE-----------------------RPYECEICG---KRFSQKSACNTHKRTH  150 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~h  150 (180)
                      -.|..|+..+.+...-..|+..+++-                       ..+.|..|+   +.|.+....+.||...
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            57889999999999999999887762                       238999999   9999999999999753


No 97 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.24  E-value=2.1  Score=27.98  Aligned_cols=38  Identities=16%  Similarity=0.705  Sum_probs=20.3

Q ss_pred             CCcceeccccCcccCChhhHHHHHhhcCCCCceecccccccc
Q psy3356          96 KDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRF  137 (180)
Q Consensus        96 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  137 (180)
                      ...-|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            4456777777776664332211   011 2337777777654


No 98 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=78.63  E-value=1.5  Score=22.89  Aligned_cols=13  Identities=8%  Similarity=0.179  Sum_probs=9.5

Q ss_pred             ccccccceeeeec
Q psy3356          24 VFIPACVFRFSVE   36 (180)
Q Consensus        24 ~~c~~C~~~~~~~   36 (180)
                      +.|..||+.+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            5788888888743


No 99 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.62  E-value=2.1  Score=18.90  Aligned_cols=19  Identities=21%  Similarity=0.593  Sum_probs=13.9

Q ss_pred             eccccccccCChHHHHHHHH
Q psy3356         129 ECEICGKRFSQKSACNTHKR  148 (180)
Q Consensus       129 ~C~~C~~~f~~~~~l~~H~~  148 (180)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            588888877 5567777765


No 100
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=78.06  E-value=0.76  Score=35.17  Aligned_cols=53  Identities=38%  Similarity=0.823  Sum_probs=36.8

Q ss_pred             ceeccccCcccCChhhHHHHHh--hcCCC--Cceecc--ccccccCChHHHHHHHHHcC
Q psy3356          99 PYHCTECEATFSWKQNLEVHMR--THTGE--RPYECE--ICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~  151 (180)
                      .+.|..|...|.....+..|..  .|.++  +++.|+  .|++.|.....+..|...|.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc
Confidence            4666667777777777777777  56666  677777  57777777777777766543


No 101
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.70  E-value=3.4  Score=27.44  Aligned_cols=34  Identities=18%  Similarity=0.573  Sum_probs=24.3

Q ss_pred             CCCcceeccccCcccCChhhHHHHHhhcCCCCceecccccccc
Q psy3356          95 VKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRF  137 (180)
Q Consensus        95 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  137 (180)
                      ....-|.|+.|+..|+....+.         ..|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            3456688988888877666653         248899998764


No 102
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.63  E-value=1.4  Score=21.57  Aligned_cols=11  Identities=18%  Similarity=0.271  Sum_probs=8.6

Q ss_pred             ccccccceeee
Q psy3356          24 VFIPACVFRFS   34 (180)
Q Consensus        24 ~~c~~C~~~~~   34 (180)
                      +.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            47888888877


No 103
>PF14353 CpXC:  CpXC protein
Probab=77.62  E-value=3.9  Score=25.95  Aligned_cols=19  Identities=32%  Similarity=0.711  Sum_probs=12.4

Q ss_pred             CCcccccchhhccChHHHH
Q psy3356          65 RPFECDVCGKRFAQKSTLN   83 (180)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~   83 (180)
                      ..++|+.||..+.-...+.
T Consensus        37 ~~~~CP~Cg~~~~~~~p~l   55 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLL   55 (128)
T ss_pred             CEEECCCCCCceecCCCEE
Confidence            3477888888776544433


No 104
>KOG2785|consensus
Probab=76.96  E-value=4.5  Score=30.68  Aligned_cols=56  Identities=21%  Similarity=0.383  Sum_probs=42.9

Q ss_pred             CcccccchhhccChHHHHHHHHhccCCCcCC------------------CcceeccccC---cccCChhhHHHHHhh
Q psy3356          66 PFECDVCGKRFAQKSTLNTHKRVHISYLHVK------------------DKPYHCTECE---ATFSWKQNLEVHMRT  121 (180)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~------------------~~~~~C~~C~---~~~~~~~~l~~H~~~  121 (180)
                      |-.|-.|+..+.+...-..||..+|++.-+.                  ...+.|..|+   +.|.+......|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4668888888888888888888887653221                  2336788888   999999999999974


No 105
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=76.58  E-value=2.4  Score=21.49  Aligned_cols=10  Identities=40%  Similarity=0.883  Sum_probs=4.7

Q ss_pred             eeccccCccc
Q psy3356         100 YHCTECEATF  109 (180)
Q Consensus       100 ~~C~~C~~~~  109 (180)
                      |.|..||..+
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4455555443


No 106
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=76.22  E-value=1.2  Score=37.08  Aligned_cols=54  Identities=15%  Similarity=0.137  Sum_probs=31.1

Q ss_pred             eecccCCcccccccceeeeecCCeeEeeeecccC---CCchhhhHhhhcCCCCCcccccchhh
Q psy3356          16 INIQKNPLVFIPACVFRFSVENEKRFFFFSFLFG---PLLVPQIHMRTHTGERPFECDVCGKR   75 (180)
Q Consensus        16 ~~~~~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~---~~~~l~~H~~~h~~~~~~~C~~C~~~   75 (180)
                      .+....+...|..||+.+.      |..|+..+.   ....|.=|.-.+....|..|+.|+-.
T Consensus       428 nRRGys~~l~C~~Cg~v~~------Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         428 NRRGYAPLLLCRDCGYIAE------CPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             ccCCccceeecccCCCccc------CCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            3455677779999999988      555554432   11223333333344455666666654


No 107
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=75.05  E-value=12  Score=24.83  Aligned_cols=53  Identities=17%  Similarity=0.297  Sum_probs=30.2

Q ss_pred             cceeccccCcccCChhhHHHHHhhcCCCCceeccc--cccccCChHHHHHHHHHcCC
Q psy3356          98 KPYHCTECEATFSWKQNLEVHMRTHTGERPYECEI--CGKRFSQKSACNTHKRTHIP  152 (180)
Q Consensus        98 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~  152 (180)
                      ..+.|+.|.-......-+ ...+.+...|+-.|..  |... .+...|.+|.+..||
T Consensus        79 ~~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP  133 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHP  133 (162)
T ss_pred             ccccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCC
Confidence            457899996332221111 2233344445556643  5543 578899999998654


No 108
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=74.54  E-value=2.9  Score=29.96  Aligned_cols=18  Identities=22%  Similarity=0.652  Sum_probs=10.8

Q ss_pred             CCCcccCCCcccCCCccC
Q psy3356         161 DRPFHCPACEGMFTTKQN  178 (180)
Q Consensus       161 ~~~~~C~~C~~~F~~~~~  178 (180)
                      .+++.||.|+..-+...+
T Consensus       207 ~k~~PCPKCg~et~eTkd  224 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKD  224 (314)
T ss_pred             CCCCCCCCCCCccccccc
Confidence            366778887765444333


No 109
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=73.77  E-value=3.6  Score=22.04  Aligned_cols=21  Identities=24%  Similarity=0.621  Sum_probs=9.7

Q ss_pred             hhhHHHHHhhcCCCCceeccc
Q psy3356         112 KQNLEVHMRTHTGERPYECEI  132 (180)
Q Consensus       112 ~~~l~~H~~~h~~~~~~~C~~  132 (180)
                      ...|..|+...-..++..|+.
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHHccCCCCcEECCC
Confidence            445555555433344455555


No 110
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=73.72  E-value=1.6  Score=25.64  Aligned_cols=31  Identities=23%  Similarity=0.537  Sum_probs=16.8

Q ss_pred             cceeccccCcccCChhhHHHHHhhcCCCCceeccccccccC
Q psy3356          98 KPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFS  138 (180)
Q Consensus        98 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  138 (180)
                      ..+.|+.|++.-        +.  -.+...|.|..|+..|.
T Consensus        34 ~~~~Cp~C~~~~--------Vk--R~a~GIW~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRTT--------VK--RIATGIWKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCcc--------ee--eeccCeEEcCCCCCeec
Confidence            446677776541        11  12334567777776664


No 111
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=73.30  E-value=4  Score=27.73  Aligned_cols=34  Identities=21%  Similarity=0.761  Sum_probs=23.6

Q ss_pred             CCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccC
Q psy3356          96 KDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFS  138 (180)
Q Consensus        96 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  138 (180)
                      ...-|.|+.|+..|+....+.         ..|.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            445688888888877665442         2488999987653


No 112
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=72.24  E-value=4.1  Score=20.39  Aligned_cols=23  Identities=26%  Similarity=0.573  Sum_probs=10.7

Q ss_pred             CceeccccccccCC----hHHHHHHHH
Q psy3356         126 RPYECEICGKRFSQ----KSACNTHKR  148 (180)
Q Consensus       126 ~~~~C~~C~~~f~~----~~~l~~H~~  148 (180)
                      ....|..|++.+..    ...|..|++
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            33556666655544    255666664


No 113
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=71.93  E-value=1.1  Score=23.35  Aligned_cols=10  Identities=50%  Similarity=1.301  Sum_probs=4.2

Q ss_pred             eeccccCccc
Q psy3356         100 YHCTECEATF  109 (180)
Q Consensus       100 ~~C~~C~~~~  109 (180)
                      |.|..|+..|
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            3444444433


No 114
>KOG2593|consensus
Probab=71.90  E-value=4.5  Score=31.24  Aligned_cols=38  Identities=26%  Similarity=0.600  Sum_probs=26.6

Q ss_pred             CCCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCccc
Q psy3356         124 GERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGM  172 (180)
Q Consensus       124 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~  172 (180)
                      ....|.|+.|.+.|.+...++.-           -...-.|.|..|+--
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L~-----------~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQLL-----------DNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccCCccccchhhhHHHHhh-----------cccCceEEEecCCCc
Confidence            34569999999998887766542           223456899999853


No 115
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=70.16  E-value=2.1  Score=18.61  Aligned_cols=9  Identities=56%  Similarity=1.516  Sum_probs=5.4

Q ss_pred             CCcccCCCc
Q psy3356         162 RPFHCPACE  170 (180)
Q Consensus       162 ~~~~C~~C~  170 (180)
                      .+|.|+.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            346666665


No 116
>KOG2807|consensus
Probab=69.42  E-value=9.5  Score=28.42  Aligned_cols=26  Identities=27%  Similarity=0.549  Sum_probs=17.9

Q ss_pred             CCceeccccccccCChHHHHHHHHHc
Q psy3356         125 ERPYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       125 ~~~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      ...|.|..|...|-..-+...|-..|
T Consensus       343 ~~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  343 SGRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CCcEEchhccceeeccchHHHHhhhh
Confidence            34577777777777777777776665


No 117
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=69.03  E-value=0.8  Score=25.97  Aligned_cols=20  Identities=30%  Similarity=0.537  Sum_probs=11.5

Q ss_pred             CCCCceecc--ccccccCChHH
Q psy3356         123 TGERPYECE--ICGKRFSQKSA  142 (180)
Q Consensus       123 ~~~~~~~C~--~C~~~f~~~~~  142 (180)
                      ..+..+.|.  .||..|.....
T Consensus        23 ~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678         23 TKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             hheeeeecCCCCCCCEEEEEEE
Confidence            334556675  67776655443


No 118
>KOG2807|consensus
Probab=68.51  E-value=9.6  Score=28.41  Aligned_cols=91  Identities=21%  Similarity=0.425  Sum_probs=50.8

Q ss_pred             cccccchhhccChHHHHHH-HHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHHHHH
Q psy3356          67 FECDVCGKRFAQKSTLNTH-KRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNT  145 (180)
Q Consensus        67 ~~C~~C~~~f~~~~~l~~H-~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  145 (180)
                      ..|+.=..+|++......- .-..|..  .....|.|++|....-              .-|..|+.|+....+...|.+
T Consensus       245 ~~~sLvkmGFP~~~~e~~ps~C~CH~~--~~~~Gy~CP~CkakvC--------------sLP~eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  245 KECSLVKMGFPSRSPEDTPSFCACHSE--LSGGGYFCPQCKAKVC--------------SLPIECPICSLTLVSSPHLAR  308 (378)
T ss_pred             cCCceEEecCCCcccccCcchheeccc--cccCceeCCcccCeee--------------cCCccCCccceeEecchHHHH
Confidence            3466666777754322211 1222221  3445688998875422              346789999988888777766


Q ss_pred             HHHHcCCCC-------------------CCcCCCCCCcccCCCcccC
Q psy3356         146 HKRTHIPYL-------------------PRVHPKDRPFHCPACEGMF  173 (180)
Q Consensus       146 H~~~h~~~~-------------------~~~h~~~~~~~C~~C~~~F  173 (180)
                      -.+.--|..                   ...-.+...|.|..|-..|
T Consensus       309 SyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~F  355 (378)
T KOG2807|consen  309 SYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVF  355 (378)
T ss_pred             HHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhcccee
Confidence            443221221                   0111233458899988776


No 119
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=67.51  E-value=5.6  Score=27.88  Aligned_cols=31  Identities=16%  Similarity=0.360  Sum_probs=22.0

Q ss_pred             CCCcceeccccCcccCChhhHHHHHhhcCCC
Q psy3356          95 VKDKPYHCTECEATFSWKQNLEVHMRTHTGE  125 (180)
Q Consensus        95 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~  125 (180)
                      ..+..|.|+.|++.|.....+.+|+..-|.+
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            3556688999999999999999998765543


No 120
>PF12907 zf-met2:  Zinc-binding
Probab=66.87  E-value=4.9  Score=19.90  Aligned_cols=22  Identities=23%  Similarity=0.628  Sum_probs=13.7

Q ss_pred             eecccccccc---CChHHHHHHHHH
Q psy3356         128 YECEICGKRF---SQKSACNTHKRT  149 (180)
Q Consensus       128 ~~C~~C~~~f---~~~~~l~~H~~~  149 (180)
                      ++|.+|...|   .....|..|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            4677777444   345667777665


No 121
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=65.78  E-value=1.7  Score=22.86  Aligned_cols=14  Identities=21%  Similarity=0.365  Sum_probs=5.0

Q ss_pred             CCcccccccceeee
Q psy3356          21 NPLVFIPACVFRFS   34 (180)
Q Consensus        21 ~~~~~c~~C~~~~~   34 (180)
                      ...+.|+.|...|-
T Consensus        19 ~~~y~C~~C~~~FC   32 (51)
T PF07975_consen   19 SSRYRCPKCKNHFC   32 (51)
T ss_dssp             -EEE--TTTT--B-
T ss_pred             CCeEECCCCCCccc
Confidence            34556777766665


No 122
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=65.70  E-value=9.4  Score=28.23  Aligned_cols=83  Identities=20%  Similarity=0.423  Sum_probs=44.8

Q ss_pred             CcccccchhhccChHHHHHHHHhccC-----CCcCC--CcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccC
Q psy3356          66 PFECDVCGKRFAQKSTLNTHKRVHIS-----YLHVK--DKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFS  138 (180)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~~~~-----~~~~~--~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  138 (180)
                      |..|+.|.-.......|.+-....-+     +...+  -+.-.|-.|.-.|.....-  ..-..+....|.|+.|+..|-
T Consensus       322 Pi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~--~~~~~~ss~rY~Ce~CK~~FC  399 (421)
T COG5151         322 PISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVS--PFDESTSSGRYQCELCKSTFC  399 (421)
T ss_pred             CccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCC--cccccccccceechhhhhhhh
Confidence            45677777665544444433221100     00011  1223466676666543221  011223345699999999999


Q ss_pred             ChHHHHHHHHHc
Q psy3356         139 QKSACNTHKRTH  150 (180)
Q Consensus       139 ~~~~l~~H~~~h  150 (180)
                      ..-+...|-..|
T Consensus       400 ~dCdvfiHe~Lh  411 (421)
T COG5151         400 SDCDVFIHETLH  411 (421)
T ss_pred             hhhHHHHHHHHh
Confidence            888888887764


No 123
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=65.01  E-value=2.9  Score=19.24  Aligned_cols=9  Identities=33%  Similarity=0.844  Sum_probs=4.6

Q ss_pred             ceecccccc
Q psy3356         127 PYECEICGK  135 (180)
Q Consensus       127 ~~~C~~C~~  135 (180)
                      .+.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            355555543


No 124
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=63.66  E-value=6.2  Score=19.93  Aligned_cols=24  Identities=33%  Similarity=0.545  Sum_probs=18.5

Q ss_pred             ceeccccCcccCChhhHHHHHhhc
Q psy3356          99 PYHCTECEATFSWKQNLEVHMRTH  122 (180)
Q Consensus        99 ~~~C~~C~~~~~~~~~l~~H~~~h  122 (180)
                      .|.|-+|.++...++.|..|++..
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHHH
Confidence            477888888888888888887754


No 125
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=63.13  E-value=3.2  Score=21.56  Aligned_cols=12  Identities=8%  Similarity=-0.078  Sum_probs=8.2

Q ss_pred             cccccccceeee
Q psy3356          23 LVFIPACVFRFS   34 (180)
Q Consensus        23 ~~~c~~C~~~~~   34 (180)
                      .|.|..||..+.
T Consensus         6 ~Y~C~~Cg~~~~   17 (49)
T COG1996           6 EYKCARCGREVE   17 (49)
T ss_pred             EEEhhhcCCeee
Confidence            457777777775


No 126
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=62.66  E-value=1.3  Score=21.92  Aligned_cols=8  Identities=50%  Similarity=1.410  Sum_probs=3.2

Q ss_pred             eecccccc
Q psy3356         128 YECEICGK  135 (180)
Q Consensus       128 ~~C~~C~~  135 (180)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            34444433


No 127
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=61.89  E-value=4.2  Score=19.95  Aligned_cols=11  Identities=36%  Similarity=1.111  Sum_probs=8.4

Q ss_pred             CcccCCCcccC
Q psy3356         163 PFHCPACEGMF  173 (180)
Q Consensus       163 ~~~C~~C~~~F  173 (180)
                      ||.|..|++.|
T Consensus        12 ~f~C~~C~~~F   22 (39)
T smart00154       12 GFKCRHCGNLF   22 (39)
T ss_pred             CeECCccCCcc
Confidence            67788888776


No 128
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=61.83  E-value=5.6  Score=21.17  Aligned_cols=11  Identities=18%  Similarity=0.301  Sum_probs=6.8

Q ss_pred             ccccccceeee
Q psy3356          24 VFIPACVFRFS   34 (180)
Q Consensus        24 ~~c~~C~~~~~   34 (180)
                      +.||.||..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            35666666655


No 129
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=61.71  E-value=7.8  Score=32.48  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=9.0

Q ss_pred             CCCCcccCCCccc
Q psy3356         160 KDRPFHCPACEGM  172 (180)
Q Consensus       160 ~~~~~~C~~C~~~  172 (180)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            4556778888764


No 130
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=61.59  E-value=4.3  Score=29.93  Aligned_cols=99  Identities=15%  Similarity=0.216  Sum_probs=57.4

Q ss_pred             eeecccCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhh----------hcCC--CCCcccccchhhccChHHH
Q psy3356          15 DINIQKNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMR----------THTG--ERPFECDVCGKRFAQKSTL   82 (180)
Q Consensus        15 ~~~~~~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~----------~h~~--~~~~~C~~C~~~f~~~~~l   82 (180)
                      |....... |.||.|....- .-...|.+|+...-....|.+-+.          ...+  .+.-.|-.|+-.|+....-
T Consensus       301 Hs~~~~gG-y~CP~CktkVC-sLPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~  378 (421)
T COG5151         301 HSEVKGGG-YECPVCKTKVC-SLPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVS  378 (421)
T ss_pred             eeeeccCc-eeCCcccceee-cCCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCC
Confidence            34444444 48888866654 445677788765433333333211          1111  1223477788777654210


Q ss_pred             HHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhc
Q psy3356          83 NTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTH  122 (180)
Q Consensus        83 ~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h  122 (180)
                      ..-       .......|.|+.|...|-..-+.-.|...|
T Consensus       379 ~~~-------~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         379 PFD-------ESTSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccc-------ccccccceechhhhhhhhhhhHHHHHHHHh
Confidence            000       013456799999999999998988888776


No 131
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=60.97  E-value=10  Score=18.76  Aligned_cols=12  Identities=25%  Similarity=0.517  Sum_probs=9.7

Q ss_pred             cccccccceeee
Q psy3356          23 LVFIPACVFRFS   34 (180)
Q Consensus        23 ~~~c~~C~~~~~   34 (180)
                      ..+|+.||..+.
T Consensus        13 ~~~C~~CgM~Y~   24 (41)
T PF13878_consen   13 ATTCPTCGMLYS   24 (41)
T ss_pred             CcCCCCCCCEEC
Confidence            458999998887


No 132
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=60.40  E-value=4.4  Score=18.96  Aligned_cols=8  Identities=38%  Similarity=1.041  Sum_probs=3.5

Q ss_pred             eeccccCc
Q psy3356         100 YHCTECEA  107 (180)
Q Consensus       100 ~~C~~C~~  107 (180)
                      ..|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            44555543


No 133
>KOG3408|consensus
Probab=58.18  E-value=7.4  Score=24.42  Aligned_cols=27  Identities=30%  Similarity=0.550  Sum_probs=22.2

Q ss_pred             CCCceeccccccccCChHHHHHHHHHc
Q psy3356         124 GERPYECEICGKRFSQKSACNTHKRTH  150 (180)
Q Consensus       124 ~~~~~~C~~C~~~f~~~~~l~~H~~~h  150 (180)
                      |...|-|..|.+.|.+...|..|.++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhcc
Confidence            444588999999999999999998753


No 134
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=57.55  E-value=8.8  Score=26.91  Aligned_cols=27  Identities=26%  Similarity=0.538  Sum_probs=21.3

Q ss_pred             CCceeccccccccCChHHHHHHHHHcC
Q psy3356         125 ERPYECEICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       125 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  151 (180)
                      +.-|.|+.|++.|....=..+|+...|
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            445999999999999999999998766


No 135
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=57.21  E-value=5.7  Score=25.42  Aligned_cols=16  Identities=25%  Similarity=0.831  Sum_probs=11.2

Q ss_pred             CCCcccCCCcccCCCc
Q psy3356         161 DRPFHCPACEGMFTTK  176 (180)
Q Consensus       161 ~~~~~C~~C~~~F~~~  176 (180)
                      ...|.|+.|++.|+..
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4557788887777654


No 136
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.85  E-value=4.9  Score=25.94  Aligned_cols=11  Identities=27%  Similarity=0.875  Sum_probs=5.4

Q ss_pred             eeccccCcccC
Q psy3356         100 YHCTECEATFS  110 (180)
Q Consensus       100 ~~C~~C~~~~~  110 (180)
                      +.|..||..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            45555554443


No 137
>KOG2593|consensus
Probab=55.00  E-value=16  Score=28.36  Aligned_cols=37  Identities=16%  Similarity=0.547  Sum_probs=21.9

Q ss_pred             CCCCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCc
Q psy3356          63 GERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEA  107 (180)
Q Consensus        63 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~  107 (180)
                      ...-|.|+.|++.|....   .-+...     .....+.|..|+-
T Consensus       125 ~~~~Y~Cp~C~kkyt~Le---a~~L~~-----~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLE---ALQLLD-----NETGEFHCENCGG  161 (436)
T ss_pred             ccccccCCccccchhhhH---HHHhhc-----ccCceEEEecCCC
Confidence            345588888888875533   333322     2345677887763


No 138
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=54.47  E-value=12  Score=19.31  Aligned_cols=21  Identities=38%  Similarity=0.792  Sum_probs=13.3

Q ss_pred             eeccccccccCCh-----HHHHHHHH
Q psy3356         128 YECEICGKRFSQK-----SACNTHKR  148 (180)
Q Consensus       128 ~~C~~C~~~f~~~-----~~l~~H~~  148 (180)
                      -.|..|++.+...     +.|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666665443     57777776


No 139
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=53.54  E-value=5.1  Score=20.01  Aligned_cols=12  Identities=42%  Similarity=0.916  Sum_probs=9.0

Q ss_pred             ccCCCcccCCCc
Q psy3356         165 HCPACEGMFTTK  176 (180)
Q Consensus       165 ~C~~C~~~F~~~  176 (180)
                      .|.+|++.|+.+
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            488888888754


No 140
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=53.52  E-value=1.8  Score=22.35  Aligned_cols=23  Identities=9%  Similarity=-0.039  Sum_probs=9.7

Q ss_pred             ccccceeeeecCCeeEeeeeccc
Q psy3356          26 IPACVFRFSVENEKRFFFFSFLF   48 (180)
Q Consensus        26 c~~C~~~~~~~~~~~~~~C~~~~   48 (180)
                      |.+|+..........|..|+..|
T Consensus         2 C~vC~~~~~~~~~i~C~~C~~~~   24 (51)
T PF00628_consen    2 CPVCGQSDDDGDMIQCDSCNRWY   24 (51)
T ss_dssp             BTTTTSSCTTSSEEEBSTTSCEE
T ss_pred             CcCCCCcCCCCCeEEcCCCChhh
Confidence            44555533333334444444433


No 141
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=53.10  E-value=10  Score=18.64  Aligned_cols=16  Identities=19%  Similarity=0.403  Sum_probs=7.4

Q ss_pred             eeccccccccCChHHH
Q psy3356         128 YECEICGKRFSQKSAC  143 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l  143 (180)
                      +.|+.|+-.+.+...|
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            3455555444444443


No 142
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=52.34  E-value=2.8  Score=18.95  Aligned_cols=19  Identities=26%  Similarity=0.726  Sum_probs=10.1

Q ss_pred             eeccccccccCChHHHHHHH
Q psy3356         128 YECEICGKRFSQKSACNTHK  147 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~  147 (180)
                      |.|..|++.| .......|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            4577777777 444444443


No 143
>KOG2907|consensus
Probab=51.94  E-value=9.9  Score=23.54  Aligned_cols=12  Identities=17%  Similarity=0.252  Sum_probs=8.2

Q ss_pred             cccccceeeeec
Q psy3356          25 FIPACVFRFSVE   36 (180)
Q Consensus        25 ~c~~C~~~~~~~   36 (180)
                      .|++||......
T Consensus         9 FC~~CG~ll~~~   20 (116)
T KOG2907|consen    9 FCSDCGSLLEEP   20 (116)
T ss_pred             hhhhhhhhcccc
Confidence            777887776633


No 144
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=51.45  E-value=5.3  Score=17.51  Aligned_cols=8  Identities=38%  Similarity=0.812  Sum_probs=5.5

Q ss_pred             ccccccee
Q psy3356          25 FIPACVFR   32 (180)
Q Consensus        25 ~c~~C~~~   32 (180)
                      .|+.||..
T Consensus         4 ~Cp~Cg~~   11 (26)
T PF13248_consen    4 FCPNCGAE   11 (26)
T ss_pred             CCcccCCc
Confidence            67777773


No 145
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=50.57  E-value=3.9  Score=20.46  Aligned_cols=12  Identities=42%  Similarity=1.063  Sum_probs=6.2

Q ss_pred             CCcccCCCcccC
Q psy3356         162 RPFHCPACEGMF  173 (180)
Q Consensus       162 ~~~~C~~C~~~F  173 (180)
                      -|+.|+.|++.|
T Consensus        12 ~~~~C~~C~~~F   23 (43)
T PF01428_consen   12 LPFKCKHCGKSF   23 (43)
T ss_dssp             SHEE-TTTS-EE
T ss_pred             CCeECCCCCccc
Confidence            356677776665


No 146
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=50.54  E-value=14  Score=23.78  Aligned_cols=27  Identities=33%  Similarity=0.544  Sum_probs=15.5

Q ss_pred             CcceeccccCcccCChhhHHHHHhhcCCCC
Q psy3356          97 DKPYHCTECEATFSWKQNLEVHMRTHTGER  126 (180)
Q Consensus        97 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~  126 (180)
                      .....|-.||+.|...   .+|+..|+|-.
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-S-
T ss_pred             cCeeEEccCCcccchH---HHHHHHccCCC
Confidence            3347888899888653   88888887643


No 147
>KOG4167|consensus
Probab=49.98  E-value=4.2  Score=33.61  Aligned_cols=25  Identities=36%  Similarity=0.679  Sum_probs=22.8

Q ss_pred             ceeccccccccCChHHHHHHHHHcC
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~  151 (180)
                      .|.|.+|++.|..-.++..||+.|-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4999999999999999999999874


No 148
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=49.72  E-value=9  Score=22.71  Aligned_cols=13  Identities=31%  Similarity=0.736  Sum_probs=7.6

Q ss_pred             ceeccccCcccCC
Q psy3356          99 PYHCTECEATFSW  111 (180)
Q Consensus        99 ~~~C~~C~~~~~~  111 (180)
                      |-.|..||+.|.+
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4456666666655


No 149
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=49.63  E-value=5.4  Score=23.70  Aligned_cols=33  Identities=18%  Similarity=0.052  Sum_probs=18.5

Q ss_pred             eecccCCcccccccceeee---ecCCeeEeeeeccc
Q psy3356          16 INIQKNPLVFIPACVFRFS---VENEKRFFFFSFLF   48 (180)
Q Consensus        16 ~~~~~~~~~~c~~C~~~~~---~~~~~~~~~C~~~~   48 (180)
                      |+......+.||.|++.--   ..+.|.|.-|++.|
T Consensus        29 ie~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~   64 (90)
T PTZ00255         29 IEISQHAKYFCPFCGKHAVKRQAVGIWRCKGCKKTV   64 (90)
T ss_pred             HHHHHhCCccCCCCCCCceeeeeeEEEEcCCCCCEE
Confidence            4444555669999975432   11245555555554


No 150
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=49.46  E-value=19  Score=17.28  Aligned_cols=10  Identities=20%  Similarity=0.487  Sum_probs=7.3

Q ss_pred             cccccceeee
Q psy3356          25 FIPACVFRFS   34 (180)
Q Consensus        25 ~c~~C~~~~~   34 (180)
                      +|+.||..|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            6777777776


No 151
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=48.38  E-value=5.6  Score=20.97  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=4.0

Q ss_pred             ccCCCcccCC
Q psy3356         165 HCPACEGMFT  174 (180)
Q Consensus       165 ~C~~C~~~F~  174 (180)
                      .||+|++.|.
T Consensus        22 ~CPlC~r~l~   31 (54)
T PF04423_consen   22 CCPLCGRPLD   31 (54)
T ss_dssp             E-TTT--EE-
T ss_pred             cCCCCCCCCC
Confidence            5777776654


No 152
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=47.94  E-value=15  Score=19.09  Aligned_cols=14  Identities=36%  Similarity=0.949  Sum_probs=7.2

Q ss_pred             cceeccccCcccCC
Q psy3356          98 KPYHCTECEATFSW  111 (180)
Q Consensus        98 ~~~~C~~C~~~~~~  111 (180)
                      +.+.|..||..|..
T Consensus         3 k~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    3 KTLTCKDCGAEFVF   16 (49)
T ss_pred             eeEEcccCCCeEEE
Confidence            34555555555443


No 153
>KOG1280|consensus
Probab=47.93  E-value=23  Score=26.70  Aligned_cols=27  Identities=19%  Similarity=0.353  Sum_probs=19.5

Q ss_pred             CCceeccccccccCChHHHHHHHHHcC
Q psy3356         125 ERPYECEICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       125 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  151 (180)
                      ...|.|++|+..=.+...|..|....|
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~H  103 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQH  103 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcC
Confidence            345788888877667777888877644


No 154
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.12  E-value=14  Score=22.77  Aligned_cols=27  Identities=19%  Similarity=0.220  Sum_probs=19.1

Q ss_pred             eeccccCcccCChhhHHHHHhhcCCCCceecccccccc
Q psy3356         100 YHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRF  137 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  137 (180)
                      ..|+.|++.|-           -....|..|+.||++|
T Consensus        10 ridPetg~KFY-----------DLNrdPiVsPytG~s~   36 (129)
T COG4530          10 RIDPETGKKFY-----------DLNRDPIVSPYTGKSY   36 (129)
T ss_pred             ccCccccchhh-----------ccCCCccccCcccccc
Confidence            45777777663           3456778888888887


No 156
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.60  E-value=19  Score=19.68  Aligned_cols=16  Identities=25%  Similarity=0.453  Sum_probs=10.5

Q ss_pred             ccCCcccccccceeee
Q psy3356          19 QKNPLVFIPACVFRFS   34 (180)
Q Consensus        19 ~~~~~~~c~~C~~~~~   34 (180)
                      ..+..+.||+|+..|.
T Consensus        44 g~~gev~CPYC~t~y~   59 (62)
T COG4391          44 GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             CCCCcEecCccccEEE
Confidence            3444457888887775


No 157
>KOG0717|consensus
Probab=45.40  E-value=15  Score=28.89  Aligned_cols=22  Identities=23%  Similarity=0.638  Sum_probs=19.9

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy3356         128 YECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       128 ~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      +.|.+|.+.|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999764


No 158
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=45.40  E-value=15  Score=28.61  Aligned_cols=13  Identities=23%  Similarity=0.560  Sum_probs=8.1

Q ss_pred             CcccCCCcccCCC
Q psy3356         163 PFHCPACEGMFTT  175 (180)
Q Consensus       163 ~~~C~~C~~~F~~  175 (180)
                      -|+|+.|+..+..
T Consensus       367 g~rC~kCg~~~~~  379 (421)
T COG1571         367 GFRCKKCGTRARE  379 (421)
T ss_pred             CcccccccccCCc
Confidence            4666666666554


No 159
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=45.32  E-value=18  Score=18.97  Aligned_cols=10  Identities=40%  Similarity=1.089  Sum_probs=4.3

Q ss_pred             eecccccccc
Q psy3356         128 YECEICGKRF  137 (180)
Q Consensus       128 ~~C~~C~~~f  137 (180)
                      +.|..||..|
T Consensus        19 ~~Cr~Cg~~~   28 (57)
T cd00065          19 HHCRNCGRIF   28 (57)
T ss_pred             cccCcCcCCc
Confidence            3444444443


No 160
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=45.27  E-value=28  Score=17.24  Aligned_cols=11  Identities=36%  Similarity=0.646  Sum_probs=9.1

Q ss_pred             cccccccceee
Q psy3356          23 LVFIPACVFRF   33 (180)
Q Consensus        23 ~~~c~~C~~~~   33 (180)
                      ...|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45999999887


No 161
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=45.08  E-value=6.1  Score=23.52  Aligned_cols=33  Identities=18%  Similarity=0.078  Sum_probs=19.0

Q ss_pred             eecccCCcccccccceeee---ecCCeeEeeeeccc
Q psy3356          16 INIQKNPLVFIPACVFRFS---VENEKRFFFFSFLF   48 (180)
Q Consensus        16 ~~~~~~~~~~c~~C~~~~~---~~~~~~~~~C~~~~   48 (180)
                      |+......+.||.|++.--   ....|.|.-|++.|
T Consensus        28 ie~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~   63 (91)
T TIGR00280        28 IEIQQKAKYVCPFCGKKTVKRGSTGIWTCRKCGAKF   63 (91)
T ss_pred             HHHHHhcCccCCCCCCCceEEEeeEEEEcCCCCCEE
Confidence            3444555669999975432   22346666666655


No 162
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=45.07  E-value=12  Score=19.34  Aligned_cols=12  Identities=33%  Similarity=0.736  Sum_probs=6.9

Q ss_pred             Ccccccchhhcc
Q psy3356          66 PFECDVCGKRFA   77 (180)
Q Consensus        66 ~~~C~~C~~~f~   77 (180)
                      .+.|+.|+..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            456666665543


No 163
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=45.04  E-value=0.71  Score=22.70  Aligned_cols=8  Identities=50%  Similarity=1.261  Sum_probs=3.5

Q ss_pred             eecccccc
Q psy3356         128 YECEICGK  135 (180)
Q Consensus       128 ~~C~~C~~  135 (180)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (39)
T PF01096_consen   29 YVCCNCGH   36 (39)
T ss_dssp             EEESSSTE
T ss_pred             EEeCCCCC
Confidence            44444443


No 164
>PF12773 DZR:  Double zinc ribbon
Probab=44.67  E-value=8.7  Score=19.69  Aligned_cols=7  Identities=43%  Similarity=1.122  Sum_probs=3.2

Q ss_pred             ccccchh
Q psy3356          68 ECDVCGK   74 (180)
Q Consensus        68 ~C~~C~~   74 (180)
                      .|+.|+.
T Consensus        31 ~C~~Cg~   37 (50)
T PF12773_consen   31 ICPNCGA   37 (50)
T ss_pred             CCcCCcC
Confidence            3444444


No 165
>KOG2817|consensus
Probab=43.90  E-value=21  Score=27.41  Aligned_cols=71  Identities=15%  Similarity=0.282  Sum_probs=43.5

Q ss_pred             CCcccccCCceeeeeecc----cCCcccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhh
Q psy3356           2 CSSKWITSPSVTFDINIQ----KNPLVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKR   75 (180)
Q Consensus         2 C~~~f~~~~~~~~~~~~~----~~~~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~   75 (180)
                      |...|++..+|-..++..    ..+.+.||+=.....++|.---..||-+.. +.+|.+-.+  .+...|+||+|...
T Consensus       309 ~~~~W~~~deLPveIeL~~~~~fHSvF~CPVlKeqtsdeNPPm~L~CGHVIS-kdAlnrLS~--ng~~sfKCPYCP~e  383 (394)
T KOG2817|consen  309 KHGEWNTKDELPVEIELGKEYHFHSVFICPVLKEQTSDENPPMMLICGHVIS-KDALNRLSK--NGSQSFKCPYCPVE  383 (394)
T ss_pred             hccCccccccCccceeccccccccceeecccchhhccCCCCCeeeeccceec-HHHHHHHhh--CCCeeeeCCCCCcc
Confidence            456788888887777754    345678998877777666555556766552 233333222  22335778887764


No 166
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=43.35  E-value=36  Score=27.05  Aligned_cols=33  Identities=24%  Similarity=0.528  Sum_probs=25.2

Q ss_pred             HhhcCCCCceeccccccccCChHHHHHHHHHcC
Q psy3356         119 MRTHTGERPYECEICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       119 ~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  151 (180)
                      .+.+...+-+.|+.|.+.|.+...+..|+...|
T Consensus        49 ak~n~sWrFWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   49 AKENKSWRFWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             HHhcCceeEeeCCcccceeCCHHHHHHHHHHhh
Confidence            344556677888888888888888888887654


No 167
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=43.29  E-value=8.9  Score=16.32  Aligned_cols=9  Identities=22%  Similarity=0.508  Sum_probs=4.7

Q ss_pred             ccccceeee
Q psy3356          26 IPACVFRFS   34 (180)
Q Consensus        26 c~~C~~~~~   34 (180)
                      |+.||....
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            555555544


No 168
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=42.98  E-value=19  Score=19.88  Aligned_cols=13  Identities=31%  Similarity=0.823  Sum_probs=7.1

Q ss_pred             CCceecccccccc
Q psy3356         125 ERPYECEICGKRF  137 (180)
Q Consensus       125 ~~~~~C~~C~~~f  137 (180)
                      .+.|.|+.||..+
T Consensus        44 ~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   44 GRVFTCPNCGFEM   56 (69)
T ss_pred             cceEEcCCCCCEE
Confidence            3446666666553


No 169
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=42.95  E-value=16  Score=32.62  Aligned_cols=37  Identities=19%  Similarity=0.199  Sum_probs=25.3

Q ss_pred             cccccccceeeeecCCeeEeeeecccCCCchhhhHhhhcCCCCCcccccchhhcc
Q psy3356          23 LVFIPACVFRFSVENEKRFFFFSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFA   77 (180)
Q Consensus        23 ~~~c~~C~~~~~~~~~~~~~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   77 (180)
                      ...||.||....   ...|..||....               .+|.|+.|+....
T Consensus       667 ~rkCPkCG~~t~---~~fCP~CGs~te---------------~vy~CPsCGaev~  703 (1337)
T PRK14714        667 RRRCPSCGTETY---ENRCPDCGTHTE---------------PVYVCPDCGAEVP  703 (1337)
T ss_pred             EEECCCCCCccc---cccCcccCCcCC---------------CceeCccCCCccC
Confidence            469999998643   247777876642               2467888888643


No 170
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.74  E-value=13  Score=29.76  Aligned_cols=18  Identities=6%  Similarity=0.150  Sum_probs=12.0

Q ss_pred             ecccCCcccccccceeee
Q psy3356          17 NIQKNPLVFIPACVFRFS   34 (180)
Q Consensus        17 ~~~~~~~~~c~~C~~~~~   34 (180)
                      +....+...|..||+...
T Consensus       207 rrGya~~~~C~~Cg~~~~  224 (505)
T TIGR00595       207 RRGYSKNLLCRSCGYILC  224 (505)
T ss_pred             CCcCCCeeEhhhCcCccC
Confidence            344556667888877765


No 171
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.71  E-value=4.4  Score=24.06  Aligned_cols=31  Identities=13%  Similarity=-0.023  Sum_probs=16.7

Q ss_pred             cccCCcccccccceeee---ecCCeeEeeeeccc
Q psy3356          18 IQKNPLVFIPACVFRFS---VENEKRFFFFSFLF   48 (180)
Q Consensus        18 ~~~~~~~~c~~C~~~~~---~~~~~~~~~C~~~~   48 (180)
                      ......+.||.||+.--   ..+.|.|.-|++.|
T Consensus        30 ~~q~~ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~   63 (90)
T PF01780_consen   30 ISQHAKYTCPFCGKTSVKRVATGIWKCKKCGKKF   63 (90)
T ss_dssp             HHHHS-BEESSSSSSEEEEEETTEEEETTTTEEE
T ss_pred             HHHhCCCcCCCCCCceeEEeeeEEeecCCCCCEE
Confidence            33444558999987654   12245555555544


No 172
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=40.53  E-value=5.5  Score=22.47  Aligned_cols=9  Identities=33%  Similarity=1.069  Sum_probs=4.5

Q ss_pred             CcccCCCcc
Q psy3356         163 PFHCPACEG  171 (180)
Q Consensus       163 ~~~C~~C~~  171 (180)
                      .|.|+.|+.
T Consensus        61 ~~~C~~C~~   69 (71)
T PF05495_consen   61 DYFCPICGL   69 (71)
T ss_dssp             SEEETTTTE
T ss_pred             CccCcCcCC
Confidence            355555543


No 173
>PRK12496 hypothetical protein; Provisional
Probab=40.51  E-value=10  Score=25.34  Aligned_cols=26  Identities=4%  Similarity=0.024  Sum_probs=16.7

Q ss_pred             cccccccceeeeec-CCeeEeeeeccc
Q psy3356          23 LVFIPACVFRFSVE-NEKRFFFFSFLF   48 (180)
Q Consensus        23 ~~~c~~C~~~~~~~-~~~~~~~C~~~~   48 (180)
                      .+.|+.|+..|+.. ....|..||...
T Consensus       127 ~~~C~gC~~~~~~~~~~~~C~~CG~~~  153 (164)
T PRK12496        127 RKVCKGCKKKYPEDYPDDVCEICGSPV  153 (164)
T ss_pred             eEECCCCCccccCCCCCCcCCCCCChh
Confidence            35799999998743 334566665443


No 174
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=40.18  E-value=8.1  Score=22.98  Aligned_cols=33  Identities=12%  Similarity=-0.084  Sum_probs=19.1

Q ss_pred             eecccCCcccccccceeee---ecCCeeEeeeeccc
Q psy3356          16 INIQKNPLVFIPACVFRFS---VENEKRFFFFSFLF   48 (180)
Q Consensus        16 ~~~~~~~~~~c~~C~~~~~---~~~~~~~~~C~~~~   48 (180)
                      |+......+.||.|++.--   ....|.|.-|++.|
T Consensus        29 ie~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~   64 (90)
T PRK03976         29 IEEKMRAKHVCPVCGRPKVKRVGTGIWECRKCGAKF   64 (90)
T ss_pred             HHHHHhcCccCCCCCCCceEEEEEEEEEcCCCCCEE
Confidence            4444555669999965433   22346666666655


No 175
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=39.95  E-value=5.6  Score=32.88  Aligned_cols=75  Identities=15%  Similarity=0.293  Sum_probs=46.9

Q ss_pred             cccccccceeeeecCCeeEee-------eecccCCCchhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccCCCcC
Q psy3356          23 LVFIPACVFRFSVENEKRFFF-------FSFLFGPLLVPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHV   95 (180)
Q Consensus        23 ~~~c~~C~~~~~~~~~~~~~~-------C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~   95 (180)
                      ..+|+.|....-+.+..++.+       ||=.|+-...|---...-+-...-.|+.|.+.|....+=+-|          
T Consensus       101 ~a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfH----------  170 (750)
T COG0068         101 AATCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFH----------  170 (750)
T ss_pred             hhhhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccccccc----------
Confidence            348999988887777666553       777776555544432222212223499999988776543222          


Q ss_pred             CCcceeccccCcc
Q psy3356          96 KDKPYHCTECEAT  108 (180)
Q Consensus        96 ~~~~~~C~~C~~~  108 (180)
                       .++..|+.||-.
T Consensus       171 -AQp~aCp~CGP~  182 (750)
T COG0068         171 -AQPIACPKCGPH  182 (750)
T ss_pred             -cccccCcccCCC
Confidence             456789999853


No 176
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=39.87  E-value=14  Score=19.65  Aligned_cols=14  Identities=29%  Similarity=0.812  Sum_probs=9.0

Q ss_pred             cccCCCcccCCCcc
Q psy3356         164 FHCPACEGMFTTKQ  177 (180)
Q Consensus       164 ~~C~~C~~~F~~~~  177 (180)
                      ..|+.|++.|....
T Consensus         6 ~~C~~Cg~~~~~~d   19 (54)
T PF14446_consen    6 CKCPVCGKKFKDGD   19 (54)
T ss_pred             ccChhhCCcccCCC
Confidence            35777777776443


No 177
>PF14369 zf-RING_3:  zinc-finger
Probab=39.83  E-value=31  Score=16.39  Aligned_cols=13  Identities=31%  Similarity=0.327  Sum_probs=9.4

Q ss_pred             Ccccccccceeee
Q psy3356          22 PLVFIPACVFRFS   34 (180)
Q Consensus        22 ~~~~c~~C~~~~~   34 (180)
                      ....||.|+..|-
T Consensus        20 ~~~~CP~C~~gFv   32 (35)
T PF14369_consen   20 SDVACPRCHGGFV   32 (35)
T ss_pred             CCcCCcCCCCcEe
Confidence            3336999988875


No 178
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=39.50  E-value=8.8  Score=18.85  Aligned_cols=8  Identities=25%  Similarity=0.854  Sum_probs=3.3

Q ss_pred             CcccCCCc
Q psy3356         163 PFHCPACE  170 (180)
Q Consensus       163 ~~~C~~C~  170 (180)
                      .+.|+.|+
T Consensus        24 ~w~C~~C~   31 (40)
T PF04810_consen   24 TWICNFCG   31 (40)
T ss_dssp             EEEETTT-
T ss_pred             EEECcCCC
Confidence            34444444


No 179
>COG1773 Rubredoxin [Energy production and conversion]
Probab=39.44  E-value=12  Score=19.99  Aligned_cols=12  Identities=17%  Similarity=0.797  Sum_probs=7.6

Q ss_pred             CcccCCCcccCC
Q psy3356         163 PFHCPACEGMFT  174 (180)
Q Consensus       163 ~~~C~~C~~~F~  174 (180)
                      .|+|.+||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            466777776554


No 180
>KOG4377|consensus
Probab=39.35  E-value=13  Score=28.61  Aligned_cols=104  Identities=21%  Similarity=0.392  Sum_probs=61.8

Q ss_pred             eeecccCCCchhhhHhhhcCCCC------------Ccccc--cchhhccChHHHHHHHHhccCCCcC--CCcceeccccC
Q psy3356          43 FFSFLFGPLLVPQIHMRTHTGER------------PFECD--VCGKRFAQKSTLNTHKRVHISYLHV--KDKPYHCTECE  106 (180)
Q Consensus        43 ~C~~~~~~~~~l~~H~~~h~~~~------------~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~--~~~~~~C~~C~  106 (180)
                      .|+..+.++..+.+|...|....            .|.|.  .|.+   +..++..|-..|-.....  ....+.|..++
T Consensus       278 ~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~GfrrthfhC~r~g  354 (480)
T KOG4377|consen  278 YCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHFHCQRIG  354 (480)
T ss_pred             cccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceecceeEEeccC
Confidence            37777777899999988775422            24564  4777   334555565544221112  22457888877


Q ss_pred             cccCChhhHHHHHhhcCCC----------------------------Cceecc--ccccccCChHHHHHHHHHcC
Q psy3356         107 ATFSWKQNLEVHMRTHTGE----------------------------RPYECE--ICGKRFSQKSACNTHKRTHI  151 (180)
Q Consensus       107 ~~~~~~~~l~~H~~~h~~~----------------------------~~~~C~--~C~~~f~~~~~l~~H~~~h~  151 (180)
                      =++..+  ...|...|...                            ..|.|.  .|+..+.+.+++..|.+.|.
T Consensus       355 CTdtfK--~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  355 CTDTFK--DSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             Cccccc--cccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhhhhhh
Confidence            222222  33444433221                            115563  48999999999999998875


No 181
>PRK04023 DNA polymerase II large subunit; Validated
Probab=39.29  E-value=26  Score=30.59  Aligned_cols=21  Identities=19%  Similarity=0.080  Sum_probs=14.2

Q ss_pred             ccccccceeeeecCCeeEeeeecc
Q psy3356          24 VFIPACVFRFSVENEKRFFFFSFL   47 (180)
Q Consensus        24 ~~c~~C~~~~~~~~~~~~~~C~~~   47 (180)
                      ..|+.||...   ....|..||..
T Consensus       627 RfCpsCG~~t---~~frCP~CG~~  647 (1121)
T PRK04023        627 RKCPSCGKET---FYRRCPFCGTH  647 (1121)
T ss_pred             ccCCCCCCcC---CcccCCCCCCC
Confidence            3888888774   44666667655


No 182
>KOG1842|consensus
Probab=38.66  E-value=34  Score=26.82  Aligned_cols=26  Identities=15%  Similarity=0.340  Sum_probs=16.4

Q ss_pred             cceeccccCcccCChhhHHHHHhhcC
Q psy3356          98 KPYHCTECEATFSWKQNLEVHMRTHT  123 (180)
Q Consensus        98 ~~~~C~~C~~~~~~~~~l~~H~~~h~  123 (180)
                      ..+.||.|..-|.....|..|...-+
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhc
Confidence            34667777777776677777665433


No 183
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=38.55  E-value=9.4  Score=23.80  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=3.9

Q ss_pred             cccccchhh
Q psy3356          67 FECDVCGKR   75 (180)
Q Consensus        67 ~~C~~C~~~   75 (180)
                      +.|.-|+..
T Consensus        23 l~C~kCgye   31 (113)
T COG1594          23 LVCRKCGYE   31 (113)
T ss_pred             EECCCCCcc
Confidence            444444444


No 184
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=37.91  E-value=14  Score=24.36  Aligned_cols=35  Identities=26%  Similarity=0.780  Sum_probs=22.4

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCccc
Q psy3356         125 ERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGM  172 (180)
Q Consensus       125 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~  172 (180)
                      .-+|.|. |+..+.+..-   |-.        +-.|+ .|.|..|+..
T Consensus       115 ~~~Y~C~-C~q~~l~~RR---hn~--------~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIRR---HNT--------VRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchhhh---ccc--------ccccc-eEEeccCCce
Confidence            4468999 9988655432   211        23456 7999999854


No 185
>PRK14873 primosome assembly protein PriA; Provisional
Probab=37.68  E-value=16  Score=30.38  Aligned_cols=27  Identities=7%  Similarity=-0.198  Sum_probs=18.2

Q ss_pred             eeecccCCcccccccceeeeecCCeeEeeeecc
Q psy3356          15 DINIQKNPLVFIPACVFRFSVENEKRFFFFSFL   47 (180)
Q Consensus        15 ~~~~~~~~~~~c~~C~~~~~~~~~~~~~~C~~~   47 (180)
                      ..+....+...|..||+...      |..|+..
T Consensus       375 lnRrGyap~l~C~~Cg~~~~------C~~C~~~  401 (665)
T PRK14873        375 VPRRGYVPSLACARCRTPAR------CRHCTGP  401 (665)
T ss_pred             ecCCCCCCeeEhhhCcCeeE------CCCCCCc
Confidence            34455667779999988876      5555543


No 186
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=37.41  E-value=23  Score=16.66  Aligned_cols=12  Identities=17%  Similarity=0.105  Sum_probs=6.1

Q ss_pred             Ccccccccceee
Q psy3356          22 PLVFIPACVFRF   33 (180)
Q Consensus        22 ~~~~c~~C~~~~   33 (180)
                      .++.|+.|+..|
T Consensus        20 ~~~~C~~Cg~~~   31 (33)
T PF08792_consen   20 DYEVCIFCGSSF   31 (33)
T ss_pred             CeEEcccCCcEe
Confidence            334555555554


No 187
>PRK05580 primosome assembly protein PriA; Validated
Probab=36.39  E-value=20  Score=30.01  Aligned_cols=17  Identities=12%  Similarity=0.257  Sum_probs=11.2

Q ss_pred             cccCCcccccccceeee
Q psy3356          18 IQKNPLVFIPACVFRFS   34 (180)
Q Consensus        18 ~~~~~~~~c~~C~~~~~   34 (180)
                      ....+...|..||+...
T Consensus       376 rGy~~~~~C~~Cg~~~~  392 (679)
T PRK05580        376 RGYAPFLLCRDCGWVAE  392 (679)
T ss_pred             CCCCCceEhhhCcCccC
Confidence            44556667888877654


No 188
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=36.12  E-value=26  Score=16.86  Aligned_cols=13  Identities=31%  Similarity=0.659  Sum_probs=7.5

Q ss_pred             ccCCCcccCCCcc
Q psy3356         165 HCPACEGMFTTKQ  177 (180)
Q Consensus       165 ~C~~C~~~F~~~~  177 (180)
                      .|+.|+++|-..+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            5777887776544


No 189
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=36.09  E-value=8.9  Score=25.16  Aligned_cols=12  Identities=33%  Similarity=0.733  Sum_probs=6.3

Q ss_pred             eccccCcccCCh
Q psy3356         101 HCTECEATFSWK  112 (180)
Q Consensus       101 ~C~~C~~~~~~~  112 (180)
                      .|+.|+..|++.
T Consensus        30 eC~~C~~RFTTf   41 (156)
T COG1327          30 ECLECGERFTTF   41 (156)
T ss_pred             cccccccccchh
Confidence            455555555543


No 190
>KOG2636|consensus
Probab=36.03  E-value=32  Score=26.99  Aligned_cols=29  Identities=31%  Similarity=0.657  Sum_probs=23.9

Q ss_pred             hhcCCCCceeccccc-cccCChHHHHHHHH
Q psy3356         120 RTHTGERPYECEICG-KRFSQKSACNTHKR  148 (180)
Q Consensus       120 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  148 (180)
                      +.|.-...|.|.+|| +++..+..+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            356666779999999 88999999999975


No 191
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=36.02  E-value=15  Score=17.73  Aligned_cols=11  Identities=18%  Similarity=0.791  Sum_probs=5.5

Q ss_pred             CCcccCCCccc
Q psy3356         162 RPFHCPACEGM  172 (180)
Q Consensus       162 ~~~~C~~C~~~  172 (180)
                      ..|+|.+||.-
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            34888888853


No 192
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=35.68  E-value=52  Score=22.40  Aligned_cols=8  Identities=50%  Similarity=1.468  Sum_probs=4.1

Q ss_pred             cccCCCcc
Q psy3356         164 FHCPACEG  171 (180)
Q Consensus       164 ~~C~~C~~  171 (180)
                      |.||.||.
T Consensus       133 F~Cp~Cg~  140 (176)
T COG1675         133 FTCPKCGE  140 (176)
T ss_pred             CCCCCCCc
Confidence            45555553


No 193
>KOG4167|consensus
Probab=35.63  E-value=13  Score=31.03  Aligned_cols=26  Identities=35%  Similarity=0.645  Sum_probs=23.2

Q ss_pred             CCcccccchhhccChHHHHHHHHhcc
Q psy3356          65 RPFECDVCGKRFAQKSTLNTHKRVHI   90 (180)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~~H~~~~~   90 (180)
                      ..|.|.+|++.|....++..||++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            35899999999999999999999884


No 194
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=35.28  E-value=13  Score=23.02  Aligned_cols=28  Identities=14%  Similarity=0.008  Sum_probs=16.6

Q ss_pred             cCCcccccccceeeeecC-CeeEeeeecc
Q psy3356          20 KNPLVFIPACVFRFSVEN-EKRFFFFSFL   47 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~~~~-~~~~~~C~~~   47 (180)
                      +...+.||.|++.....+ ...|.+|+..
T Consensus        66 kav~V~CP~C~K~TKmLGr~D~CM~C~~p   94 (114)
T PF11023_consen   66 KAVQVECPNCGKQTKMLGRVDACMHCKEP   94 (114)
T ss_pred             cceeeECCCCCChHhhhchhhccCcCCCc
Confidence            334568999998876333 3345555443


No 196
>PHA02998 RNA polymerase subunit; Provisional
Probab=34.83  E-value=8.7  Score=25.93  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=5.3

Q ss_pred             cccCCCcccC
Q psy3356         164 FHCPACEGMF  173 (180)
Q Consensus       164 ~~C~~C~~~F  173 (180)
                      |.|..|+..|
T Consensus       172 YkC~~CG~~w  181 (195)
T PHA02998        172 HACRDCKKHF  181 (195)
T ss_pred             EEcCCCCCcc
Confidence            5555555544


No 197
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=34.74  E-value=8.5  Score=25.15  Aligned_cols=14  Identities=29%  Similarity=0.655  Sum_probs=7.7

Q ss_pred             eeccccCcccCChh
Q psy3356         100 YHCTECEATFSWKQ  113 (180)
Q Consensus       100 ~~C~~C~~~~~~~~  113 (180)
                      -.|..|++.|++..
T Consensus        29 ReC~~C~~RFTTyE   42 (147)
T TIGR00244        29 RECLECHERFTTFE   42 (147)
T ss_pred             ccCCccCCccceee
Confidence            34666666665543


No 198
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=34.30  E-value=24  Score=26.32  Aligned_cols=14  Identities=14%  Similarity=0.408  Sum_probs=9.6

Q ss_pred             CCCcccCCCcccCC
Q psy3356         161 DRPFHCPACEGMFT  174 (180)
Q Consensus       161 ~~~~~C~~C~~~F~  174 (180)
                      .+...|..|+.-..
T Consensus       250 ~r~e~C~~C~~YlK  263 (309)
T PRK03564        250 VKAESCGDCGTYLK  263 (309)
T ss_pred             eEeeecccccccce
Confidence            45678999986443


No 199
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=34.22  E-value=27  Score=21.57  Aligned_cols=29  Identities=14%  Similarity=0.623  Sum_probs=17.0

Q ss_pred             eccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356         101 HCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus       101 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      .|+.|+..|.+.           ....|.|+.|+..+...
T Consensus         4 ~CP~C~seytY~-----------dg~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYH-----------DGTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEe-----------cCCeeECcccccccccc
Confidence            467776665432           22347777777766544


No 200
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=33.53  E-value=13  Score=19.90  Aligned_cols=15  Identities=27%  Similarity=0.837  Sum_probs=10.2

Q ss_pred             CCcccccchhhccCh
Q psy3356          65 RPFECDVCGKRFAQK   79 (180)
Q Consensus        65 ~~~~C~~C~~~f~~~   79 (180)
                      ..|-|..|.......
T Consensus        30 ~tYmC~eC~~RI~~~   44 (56)
T PF09963_consen   30 HTYMCDECKERIREE   44 (56)
T ss_pred             cceeChhHHHHHhHH
Confidence            348888888765443


No 201
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=33.42  E-value=70  Score=16.05  Aligned_cols=10  Identities=30%  Similarity=0.929  Sum_probs=5.2

Q ss_pred             CCcccCCCcc
Q psy3356         162 RPFHCPACEG  171 (180)
Q Consensus       162 ~~~~C~~C~~  171 (180)
                      ..|.|..|.+
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            3455655543


No 202
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=33.31  E-value=18  Score=19.48  Aligned_cols=12  Identities=25%  Similarity=0.210  Sum_probs=6.7

Q ss_pred             ccccccceeeee
Q psy3356          24 VFIPACVFRFSV   35 (180)
Q Consensus        24 ~~c~~C~~~~~~   35 (180)
                      +.||.|++.+.-
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            479999998884


No 203
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=33.28  E-value=20  Score=21.73  Aligned_cols=13  Identities=38%  Similarity=1.145  Sum_probs=9.3

Q ss_pred             CCcccCCCcccCC
Q psy3356         162 RPFHCPACEGMFT  174 (180)
Q Consensus       162 ~~~~C~~C~~~F~  174 (180)
                      +++.|+.||.-|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            5777777777664


No 204
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=33.19  E-value=36  Score=28.35  Aligned_cols=23  Identities=17%  Similarity=0.258  Sum_probs=15.7

Q ss_pred             cccccceeeeecCCeeEeeeeccc
Q psy3356          25 FIPACVFRFSVENEKRFFFFSFLF   48 (180)
Q Consensus        25 ~c~~C~~~~~~~~~~~~~~C~~~~   48 (180)
                      .||.||...+ .+..-|..||..+
T Consensus         3 ~Cp~Cg~~n~-~~akFC~~CG~~l   25 (645)
T PRK14559          3 ICPQCQFENP-NNNRFCQKCGTSL   25 (645)
T ss_pred             cCCCCCCcCC-CCCccccccCCCC
Confidence            7888888765 4444577777665


No 205
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=33.01  E-value=37  Score=22.32  Aligned_cols=11  Identities=36%  Similarity=0.866  Sum_probs=7.3

Q ss_pred             Cceeccccccc
Q psy3356         126 RPYECEICGKR  136 (180)
Q Consensus       126 ~~~~C~~C~~~  136 (180)
                      ..|.|..||..
T Consensus       111 G~l~C~~Cg~~  121 (146)
T PF07295_consen  111 GTLVCENCGHE  121 (146)
T ss_pred             ceEecccCCCE
Confidence            34777777754


No 206
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=32.93  E-value=16  Score=17.29  Aligned_cols=9  Identities=33%  Similarity=0.866  Sum_probs=4.9

Q ss_pred             cccccchhh
Q psy3356          67 FECDVCGKR   75 (180)
Q Consensus        67 ~~C~~C~~~   75 (180)
                      +.|+.|+..
T Consensus        23 ~vC~~Cg~I   31 (34)
T PF14803_consen   23 LVCPACGFI   31 (34)
T ss_dssp             EEETTTTEE
T ss_pred             eECCCCCCE
Confidence            556666543


No 207
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=32.68  E-value=22  Score=16.88  Aligned_cols=12  Identities=25%  Similarity=0.697  Sum_probs=3.9

Q ss_pred             ccCCCcccCCCc
Q psy3356         165 HCPACEGMFTTK  176 (180)
Q Consensus       165 ~C~~C~~~F~~~  176 (180)
                      .|..|++.|.++
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            355555555443


No 208
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.29  E-value=11  Score=26.70  Aligned_cols=9  Identities=33%  Similarity=0.622  Sum_probs=6.2

Q ss_pred             eeccccccc
Q psy3356         128 YECEICGKR  136 (180)
Q Consensus       128 ~~C~~C~~~  136 (180)
                      ..||.|..+
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            568888753


No 209
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=32.20  E-value=30  Score=24.87  Aligned_cols=60  Identities=20%  Similarity=0.486  Sum_probs=31.8

Q ss_pred             CCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCChHH
Q psy3356          65 RPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSA  142 (180)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  142 (180)
                      ..|.|..|+..-      .+  +.-     ..+....|..|.+.|.-...     ..-.|-.-|.|+.|+..|.....
T Consensus       111 rqFaC~~Cd~~W------wR--rvp-----~rKeVSRCr~C~~rYDPVP~-----dkmwG~aef~C~~C~h~F~G~~q  170 (278)
T PF15135_consen  111 RQFACSSCDHMW------WR--RVP-----QRKEVSRCRKCRKRYDPVPC-----DKMWGIAEFHCPKCRHNFRGFAQ  170 (278)
T ss_pred             eeeeccccchHH------Hh--ccC-----cccccccccccccccCCCcc-----ccccceeeeecccccccchhhhh
Confidence            567888886531      11  111     23445567777766543221     01122334788888888875543


No 210
>PRK10220 hypothetical protein; Provisional
Probab=31.31  E-value=32  Score=21.23  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=6.8

Q ss_pred             ceeccccCcccC
Q psy3356          99 PYHCTECEATFS  110 (180)
Q Consensus        99 ~~~C~~C~~~~~  110 (180)
                      .+.|+.|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            466666665544


No 211
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=31.21  E-value=24  Score=21.93  Aligned_cols=12  Identities=8%  Similarity=0.055  Sum_probs=9.3

Q ss_pred             cccccccceeee
Q psy3356          23 LVFIPACVFRFS   34 (180)
Q Consensus        23 ~~~c~~C~~~~~   34 (180)
                      ...|+.||..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (113)
T PRK12380         70 QAWCWDCSQVVE   81 (113)
T ss_pred             EEEcccCCCEEe
Confidence            448888888877


No 212
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=31.17  E-value=34  Score=18.80  Aligned_cols=9  Identities=33%  Similarity=0.992  Sum_probs=2.3

Q ss_pred             eccccCccc
Q psy3356         101 HCTECEATF  109 (180)
Q Consensus       101 ~C~~C~~~~  109 (180)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            344454444


No 213
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=30.56  E-value=33  Score=27.37  Aligned_cols=17  Identities=12%  Similarity=0.337  Sum_probs=10.9

Q ss_pred             cCCcccccccceeeeec
Q psy3356          20 KNPLVFIPACVFRFSVE   36 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~~~   36 (180)
                      ....+.|..||+.+...
T Consensus       422 ~~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCCeEEECCCCeEECCC
Confidence            44556777777777733


No 214
>PRK04351 hypothetical protein; Provisional
Probab=30.48  E-value=25  Score=23.14  Aligned_cols=34  Identities=29%  Similarity=0.879  Sum_probs=22.4

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCCCc
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFTTK  176 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~~~  176 (180)
                      .|.|..|+..+.+.      ++.          +...|.|..|+..+...
T Consensus       112 ~Y~C~~Cg~~~~r~------Rr~----------n~~~yrCg~C~g~L~~~  145 (149)
T PRK04351        112 LYECQSCGQQYLRK------RRI----------NTKRYRCGKCRGKLKLI  145 (149)
T ss_pred             EEECCCCCCEeeee------eec----------CCCcEEeCCCCcEeeec
Confidence            48998898766432      221          34669999998766443


No 215
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=30.30  E-value=27  Score=22.75  Aligned_cols=33  Identities=30%  Similarity=0.842  Sum_probs=20.9

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCC
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFT  174 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~  174 (180)
                      .|.|..|+..+.      .+.+         +.....|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~------~~rr---------~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR---------SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCc------eEcc---------ccCcceEEcCCCCCEEE
Confidence            588988987764      2222         22225689999987653


No 216
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=30.01  E-value=27  Score=22.50  Aligned_cols=14  Identities=36%  Similarity=0.529  Sum_probs=10.7

Q ss_pred             hhhhHhhhcCCCCC
Q psy3356          53 VPQIHMRTHTGERP   66 (180)
Q Consensus        53 ~l~~H~~~h~~~~~   66 (180)
                      +|.+|+.+|.+-.|
T Consensus        88 SLKRHL~t~~gmTP  101 (148)
T COG4957          88 SLKRHLTTHYGLTP  101 (148)
T ss_pred             HHHHHHhcccCCCH
Confidence            68899999876543


No 217
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=30.00  E-value=18  Score=16.56  Aligned_cols=11  Identities=27%  Similarity=0.984  Sum_probs=4.9

Q ss_pred             CCcccCCCccc
Q psy3356         162 RPFHCPACEGM  172 (180)
Q Consensus       162 ~~~~C~~C~~~  172 (180)
                      ..|.|+.|+..
T Consensus        12 ~kY~Cp~C~~~   22 (30)
T PF04438_consen   12 AKYRCPRCGAR   22 (30)
T ss_dssp             ESEE-TTT--E
T ss_pred             CEEECCCcCCc
Confidence            34677777654


No 218
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=29.70  E-value=6.5  Score=32.54  Aligned_cols=56  Identities=27%  Similarity=0.620  Sum_probs=33.0

Q ss_pred             eccccCcccCChhhHHHHHhhcCCCCc-eeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcc
Q psy3356         101 HCTECEATFSWKQNLEVHMRTHTGERP-YECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEG  171 (180)
Q Consensus       101 ~C~~C~~~~~~~~~l~~H~~~h~~~~~-~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~  171 (180)
                      .|..||-.|+....|--= +..+.-.. -.|+.|.+.+.++.+-+-|.              .|..|+.||=
T Consensus       125 ~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfHA--------------Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFHA--------------QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCcccccccc--------------ccccCcccCC
Confidence            477788777765433111 11222222 35888888888877655543              3467888884


No 219
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=29.57  E-value=18  Score=18.80  Aligned_cols=8  Identities=38%  Similarity=1.194  Sum_probs=4.0

Q ss_pred             eecccccc
Q psy3356         128 YECEICGK  135 (180)
Q Consensus       128 ~~C~~C~~  135 (180)
                      +-|-.|++
T Consensus        38 ~~CGkCgy   45 (51)
T COG1998          38 WACGKCGY   45 (51)
T ss_pred             eEeccccc
Confidence            45555544


No 220
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=29.56  E-value=43  Score=20.89  Aligned_cols=12  Identities=17%  Similarity=0.022  Sum_probs=9.4

Q ss_pred             cccccccceeee
Q psy3356          23 LVFIPACVFRFS   34 (180)
Q Consensus        23 ~~~c~~C~~~~~   34 (180)
                      ...|+.|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (115)
T TIGR00100        70 ECECEDCSEEVS   81 (115)
T ss_pred             EEEcccCCCEEe
Confidence            348888988887


No 221
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=29.26  E-value=14  Score=24.12  Aligned_cols=32  Identities=25%  Similarity=0.833  Sum_probs=20.2

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcccCC
Q psy3356         127 PYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEGMFT  174 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~~F~  174 (180)
                      .|.|..|+..+.....+                +...|.|..|+..|.
T Consensus       123 ~~~C~~C~~~~~r~~~~----------------~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRHRRS----------------KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeeeccc----------------chhhEECCCCCCEEE
Confidence            48888898776333221                233488999986653


No 222
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=29.09  E-value=52  Score=24.60  Aligned_cols=13  Identities=23%  Similarity=0.726  Sum_probs=8.9

Q ss_pred             CCCcccCCCcccC
Q psy3356         161 DRPFHCPACEGMF  173 (180)
Q Consensus       161 ~~~~~C~~C~~~F  173 (180)
                      .+-..|..|+.-.
T Consensus       250 ~r~e~C~~C~~Yl  262 (305)
T TIGR01562       250 LKAETCDSCQGYL  262 (305)
T ss_pred             eEEeeccccccch
Confidence            4557798888543


No 223
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.51  E-value=25  Score=19.38  Aligned_cols=14  Identities=21%  Similarity=0.150  Sum_probs=10.6

Q ss_pred             CCcccccccceeee
Q psy3356          21 NPLVFIPACVFRFS   34 (180)
Q Consensus        21 ~~~~~c~~C~~~~~   34 (180)
                      ...+.||.||+...
T Consensus         5 ~~~v~CP~Cgkpv~   18 (65)
T COG3024           5 RITVPCPTCGKPVV   18 (65)
T ss_pred             cccccCCCCCCccc
Confidence            34568999998877


No 224
>PRK05978 hypothetical protein; Provisional
Probab=28.20  E-value=20  Score=23.60  Aligned_cols=10  Identities=40%  Similarity=1.285  Sum_probs=5.3

Q ss_pred             eccccccccC
Q psy3356         129 ECEICGKRFS  138 (180)
Q Consensus       129 ~C~~C~~~f~  138 (180)
                      .|+.|+..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4555555543


No 225
>PF14122 YokU:  YokU-like protein
Probab=28.13  E-value=51  Score=19.43  Aligned_cols=29  Identities=21%  Similarity=0.402  Sum_probs=22.1

Q ss_pred             CCceeeeeecccCCcccccccceeeeecC
Q psy3356           9 SPSVTFDINIQKNPLVFIPACVFRFSVEN   37 (180)
Q Consensus         9 ~~~~~~~~~~~~~~~~~c~~C~~~~~~~~   37 (180)
                      .+.-..-|.+...|...|..||..+.+.+
T Consensus        21 LpdGtraIeI~~tP~i~C~~CgmvYq~d~   49 (87)
T PF14122_consen   21 LPDGTRAIEITDTPAIICSNCGMVYQDDE   49 (87)
T ss_pred             cCCCceEEEecCCceeeecCCCcEEehhH
Confidence            34445567788889889999999988544


No 226
>PRK00420 hypothetical protein; Validated
Probab=27.27  E-value=31  Score=21.50  Aligned_cols=11  Identities=18%  Similarity=0.404  Sum_probs=8.0

Q ss_pred             ccccccceeee
Q psy3356          24 VFIPACVFRFS   34 (180)
Q Consensus        24 ~~c~~C~~~~~   34 (180)
                      ..||.||..+-
T Consensus        24 ~~CP~Cg~pLf   34 (112)
T PRK00420         24 KHCPVCGLPLF   34 (112)
T ss_pred             CCCCCCCCcce
Confidence            37888887655


No 227
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=26.77  E-value=83  Score=14.80  Aligned_cols=21  Identities=14%  Similarity=0.521  Sum_probs=10.4

Q ss_pred             eeccccCcccCChhhHHHHHhh
Q psy3356         100 YHCTECEATFSWKQNLEVHMRT  121 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~~  121 (180)
                      +.|+.|++... ...+..|+..
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLek   25 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLEK   25 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHHH
Confidence            45666665532 4455555543


No 228
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=26.58  E-value=49  Score=14.79  Aligned_cols=13  Identities=23%  Similarity=0.411  Sum_probs=5.4

Q ss_pred             cccccceeeeecC
Q psy3356          25 FIPACVFRFSVEN   37 (180)
Q Consensus        25 ~c~~C~~~~~~~~   37 (180)
                      .||.|+.......
T Consensus         1 ~CP~C~s~l~~~~   13 (28)
T PF03119_consen    1 TCPVCGSKLVREE   13 (28)
T ss_dssp             B-TTT--BEEE-C
T ss_pred             CcCCCCCEeEcCC
Confidence            3777877665333


No 229
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=25.91  E-value=43  Score=17.90  Aligned_cols=12  Identities=33%  Similarity=0.772  Sum_probs=8.0

Q ss_pred             ccCCCcccCCCc
Q psy3356         165 HCPACEGMFTTK  176 (180)
Q Consensus       165 ~C~~C~~~F~~~  176 (180)
                      -|+.|+..|...
T Consensus        41 gCPfC~~~~~~~   52 (55)
T PF14447_consen   41 GCPFCGTPFEFD   52 (55)
T ss_pred             CCCCCCCcccCC
Confidence            477777777553


No 230
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.56  E-value=26  Score=18.06  Aligned_cols=17  Identities=29%  Similarity=0.899  Sum_probs=12.2

Q ss_pred             eccccCcccCChhhHHH
Q psy3356         101 HCTECEATFSWKQNLEV  117 (180)
Q Consensus       101 ~C~~C~~~~~~~~~l~~  117 (180)
                      .|++|++.|.....+.+
T Consensus        14 ICpvCqRPFsWRkKW~~   30 (54)
T COG4338          14 ICPVCQRPFSWRKKWAR   30 (54)
T ss_pred             hhhhhcCchHHHHHHHH
Confidence            68889888877655443


No 231
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=25.55  E-value=54  Score=20.43  Aligned_cols=12  Identities=8%  Similarity=0.196  Sum_probs=9.2

Q ss_pred             cccccccceeee
Q psy3356          23 LVFIPACVFRFS   34 (180)
Q Consensus        23 ~~~c~~C~~~~~   34 (180)
                      ...|..|+..|+
T Consensus        70 ~~~C~~Cg~~~~   81 (114)
T PRK03681         70 ECWCETCQQYVT   81 (114)
T ss_pred             EEEcccCCCeee
Confidence            348888888877


No 232
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=24.88  E-value=38  Score=16.76  Aligned_cols=9  Identities=33%  Similarity=1.136  Sum_probs=5.4

Q ss_pred             cccCCCccc
Q psy3356         164 FHCPACEGM  172 (180)
Q Consensus       164 ~~C~~C~~~  172 (180)
                      |.|+.|+..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            456666654


No 233
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=24.79  E-value=35  Score=21.20  Aligned_cols=11  Identities=27%  Similarity=0.890  Sum_probs=4.9

Q ss_pred             eeccccCcccC
Q psy3356         100 YHCTECEATFS  110 (180)
Q Consensus       100 ~~C~~C~~~~~  110 (180)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            34555555543


No 234
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.72  E-value=46  Score=19.10  Aligned_cols=11  Identities=55%  Similarity=1.313  Sum_probs=6.6

Q ss_pred             ceeccccCccc
Q psy3356          99 PYHCTECEATF  109 (180)
Q Consensus        99 ~~~C~~C~~~~  109 (180)
                      .|.|..|+..|
T Consensus        12 ~Y~c~~cg~~~   22 (82)
T COG2331          12 SYECTECGNRF   22 (82)
T ss_pred             EEeecccchHH
Confidence            36677776554


No 235
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=24.70  E-value=36  Score=16.85  Aligned_cols=8  Identities=13%  Similarity=0.530  Sum_probs=4.1

Q ss_pred             ccccceee
Q psy3356          26 IPACVFRF   33 (180)
Q Consensus        26 c~~C~~~~   33 (180)
                      |+.|...+
T Consensus         2 C~~C~~~~    9 (44)
T PF14634_consen    2 CNICFEKY    9 (44)
T ss_pred             CcCcCccc
Confidence            45555555


No 236
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=24.68  E-value=44  Score=17.62  Aligned_cols=10  Identities=20%  Similarity=0.212  Sum_probs=8.2

Q ss_pred             cccccceeee
Q psy3356          25 FIPACVFRFS   34 (180)
Q Consensus        25 ~c~~C~~~~~   34 (180)
                      .||.||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            6888888877


No 237
>KOG0782|consensus
Probab=24.37  E-value=17  Score=29.44  Aligned_cols=50  Identities=24%  Similarity=0.423  Sum_probs=29.1

Q ss_pred             hhhhHhhhcCCCCCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccCCh
Q psy3356          53 VPQIHMRTHTGERPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFSWK  112 (180)
Q Consensus        53 ~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~~~  112 (180)
                      .|.+|--+|.....-+|..|+++|.++-.+..          .......|.+|...|..+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~Fhs----------KEivAisCSWCKqayH~K  289 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFFHS----------KEIVAISCSWCKQAYHLK  289 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheeecc----------ccEEEEEehHHHHHhhcc
Confidence            45566555555555668888888766533221          122346677777666554


No 238
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=24.31  E-value=39  Score=17.57  Aligned_cols=11  Identities=27%  Similarity=0.754  Sum_probs=7.1

Q ss_pred             Ccccccchhhc
Q psy3356          66 PFECDVCGKRF   76 (180)
Q Consensus        66 ~~~C~~C~~~f   76 (180)
                      .+.|..|+.++
T Consensus        37 r~~C~~Cgyt~   47 (50)
T PRK00432         37 RWHCGKCGYTE   47 (50)
T ss_pred             cEECCCcCCEE
Confidence            46677777654


No 239
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=24.09  E-value=26  Score=24.28  Aligned_cols=28  Identities=32%  Similarity=0.673  Sum_probs=0.0

Q ss_pred             hcCCCCceecccccc-ccCChHHHHHHHH
Q psy3356         121 THTGERPYECEICGK-RFSQKSACNTHKR  148 (180)
Q Consensus       121 ~h~~~~~~~C~~C~~-~f~~~~~l~~H~~  148 (180)
                      .|.-.+.|.|.+||. ++.-+..+.+|..
T Consensus        95 LhGL~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   95 LHGLGVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -----------------------------
T ss_pred             HhCCCCeeeeEeCCCcceecHHHHHHhcC
Confidence            344456699999985 6678888888864


No 240
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=23.90  E-value=38  Score=21.73  Aligned_cols=15  Identities=40%  Similarity=0.986  Sum_probs=9.3

Q ss_pred             ceeccccccccCChH
Q psy3356         127 PYECEICGKRFSQKS  141 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~  141 (180)
                      |++|..||+.|.+-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            356777777776543


No 241
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.90  E-value=67  Score=23.70  Aligned_cols=10  Identities=20%  Similarity=0.840  Sum_probs=6.9

Q ss_pred             eecccccccc
Q psy3356         128 YECEICGKRF  137 (180)
Q Consensus       128 ~~C~~C~~~f  137 (180)
                      |.|++|.-.|
T Consensus       256 yvCs~Clsi~  265 (279)
T TIGR00627       256 FVCSVCLSVL  265 (279)
T ss_pred             EECCCccCCc
Confidence            7777777655


No 242
>PLN02294 cytochrome c oxidase subunit Vb
Probab=23.88  E-value=39  Score=22.77  Aligned_cols=15  Identities=33%  Similarity=1.012  Sum_probs=11.7

Q ss_pred             CCCcccCCCcccCCC
Q psy3356         161 DRPFHCPACEGMFTT  175 (180)
Q Consensus       161 ~~~~~C~~C~~~F~~  175 (180)
                      .+|+.|+.||..|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            368889999988753


No 243
>PLN02748 tRNA dimethylallyltransferase
Probab=23.77  E-value=58  Score=26.00  Aligned_cols=25  Identities=28%  Similarity=0.562  Sum_probs=21.3

Q ss_pred             CCceecccccc-ccCChHHHHHHHHH
Q psy3356         125 ERPYECEICGK-RFSQKSACNTHKRT  149 (180)
Q Consensus       125 ~~~~~C~~C~~-~f~~~~~l~~H~~~  149 (180)
                      .+.|.|..|+. .+.....+..|++.
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhcc
Confidence            35689999997 89999999999864


No 244
>PRK02935 hypothetical protein; Provisional
Probab=23.67  E-value=38  Score=20.78  Aligned_cols=29  Identities=14%  Similarity=0.116  Sum_probs=18.7

Q ss_pred             cCCcccccccceeeeecC-CeeEeeeeccc
Q psy3356          20 KNPLVFIPACVFRFSVEN-EKRFFFFSFLF   48 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~~~~-~~~~~~C~~~~   48 (180)
                      +...+.||.|++..+-.+ ...|.+|+.-.
T Consensus        67 kavqV~CP~C~K~TKmLGrvD~CM~C~~PL   96 (110)
T PRK02935         67 KAVQVICPSCEKPTKMLGRVDACMHCNQPL   96 (110)
T ss_pred             cceeeECCCCCchhhhccceeecCcCCCcC
Confidence            445569999988877544 44555665543


No 245
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=23.60  E-value=46  Score=26.38  Aligned_cols=26  Identities=27%  Similarity=0.553  Sum_probs=17.6

Q ss_pred             CcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccC
Q psy3356          66 PFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFS  110 (180)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~  110 (180)
                      .|.|..|+...                   .+..++|+.|+.+=+
T Consensus         7 ~y~C~~Cg~~~-------------------~~~~g~Cp~C~~w~t   32 (454)
T TIGR00416         7 KFVCQHCGADS-------------------PKWQGKCPACHAWNT   32 (454)
T ss_pred             eEECCcCCCCC-------------------ccccEECcCCCCccc
Confidence            48888888763                   345567888876533


No 246
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=23.45  E-value=41  Score=18.49  Aligned_cols=13  Identities=23%  Similarity=0.202  Sum_probs=9.6

Q ss_pred             Ccccccccceeee
Q psy3356          22 PLVFIPACVFRFS   34 (180)
Q Consensus        22 ~~~~c~~C~~~~~   34 (180)
                      ..+.||.|++...
T Consensus         5 ~~v~CP~C~k~~~   17 (62)
T PRK00418          5 ITVNCPTCGKPVE   17 (62)
T ss_pred             ccccCCCCCCccc
Confidence            3458999988754


No 247
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=23.27  E-value=23  Score=19.10  Aligned_cols=11  Identities=18%  Similarity=0.467  Sum_probs=5.9

Q ss_pred             cccccccceee
Q psy3356          23 LVFIPACVFRF   33 (180)
Q Consensus        23 ~~~c~~C~~~~   33 (180)
                      ..+||.|...+
T Consensus        44 ~PVCP~Ck~iy   54 (58)
T PF11238_consen   44 FPVCPECKEIY   54 (58)
T ss_pred             CCCCcCHHHHH
Confidence            44666665444


No 248
>KOG0978|consensus
Probab=23.12  E-value=28  Score=29.07  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=6.5

Q ss_pred             ceeccccCcc
Q psy3356          99 PYHCTECEAT  108 (180)
Q Consensus        99 ~~~C~~C~~~  108 (180)
                      .+.|+.|+..
T Consensus       643 ~LkCs~Cn~R  652 (698)
T KOG0978|consen  643 LLKCSVCNTR  652 (698)
T ss_pred             ceeCCCccCc
Confidence            3678887743


No 249
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=23.00  E-value=63  Score=16.91  Aligned_cols=7  Identities=43%  Similarity=1.369  Sum_probs=2.6

Q ss_pred             ecccccc
Q psy3356         129 ECEICGK  135 (180)
Q Consensus       129 ~C~~C~~  135 (180)
                      +|+.|+.
T Consensus        30 ~C~~Cgh   36 (55)
T PF14311_consen   30 KCPKCGH   36 (55)
T ss_pred             ECCCCCC
Confidence            3333333


No 250
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=22.89  E-value=62  Score=25.79  Aligned_cols=26  Identities=19%  Similarity=0.425  Sum_probs=22.3

Q ss_pred             CcccccchhhccChHHHHHHHHhccC
Q psy3356          66 PFECDVCGKRFAQKSTLNTHKRVHIS   91 (180)
Q Consensus        66 ~~~C~~C~~~f~~~~~l~~H~~~~~~   91 (180)
                      .+.|+.|.+.|.....+..|+...|.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhh
Confidence            47799999999999999999976553


No 251
>PRK12722 transcriptional activator FlhC; Provisional
Probab=22.68  E-value=66  Score=22.16  Aligned_cols=47  Identities=19%  Similarity=0.422  Sum_probs=26.5

Q ss_pred             ccCChhhHHHHHhhcCCCCceeccccccccCChHHHHHHHHHcCCCCCCcCCCCCCcccCCCcc
Q psy3356         108 TFSWKQNLEVHMRTHTGERPYECEICGKRFSQKSACNTHKRTHIPYLPRVHPKDRPFHCPACEG  171 (180)
Q Consensus       108 ~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~h~~~~~~~C~~C~~  171 (180)
                      .+.....|.+...... -....|..|+-.|....                +.....|.|+.|.-
T Consensus       116 s~tRAw~LvRf~~s~~-L~l~~C~~Cgg~fv~~~----------------~e~~~~f~CplC~~  162 (187)
T PRK12722        116 SLTRAWTLVRFVDSGM-LQLSSCNCCGGHFVTHA----------------HDPVGSFVCGLCQP  162 (187)
T ss_pred             cHHHHHHHHHHHhcCc-EeeccCCCCCCCeeccc----------------cccCCCCcCCCCCC
Confidence            3444455555544332 22356888888776442                22345688999875


No 252
>PRK11823 DNA repair protein RadA; Provisional
Probab=22.68  E-value=49  Score=26.14  Aligned_cols=27  Identities=26%  Similarity=0.532  Sum_probs=17.9

Q ss_pred             CCcccccchhhccChHHHHHHHHhccCCCcCCCcceeccccCcccC
Q psy3356          65 RPFECDVCGKRFAQKSTLNTHKRVHISYLHVKDKPYHCTECEATFS  110 (180)
Q Consensus        65 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~C~~C~~~~~  110 (180)
                      ..|.|..|+...                   .+...+|+.|+.+-+
T Consensus         6 ~~y~C~~Cg~~~-------------------~~~~g~Cp~C~~w~t   32 (446)
T PRK11823          6 TAYVCQECGAES-------------------PKWLGRCPECGAWNT   32 (446)
T ss_pred             CeEECCcCCCCC-------------------cccCeeCcCCCCccc
Confidence            348888888763                   345567888875533


No 253
>KOG0717|consensus
Probab=22.59  E-value=59  Score=25.81  Aligned_cols=21  Identities=24%  Similarity=0.562  Sum_probs=17.5

Q ss_pred             eeccccCcccCChhhHHHHHh
Q psy3356         100 YHCTECEATFSWKQNLEVHMR  120 (180)
Q Consensus       100 ~~C~~C~~~~~~~~~l~~H~~  120 (180)
                      +-|.+|++.|.+...+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            778888888888888888865


No 254
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=22.50  E-value=46  Score=20.39  Aligned_cols=8  Identities=38%  Similarity=1.041  Sum_probs=3.8

Q ss_pred             cccccchh
Q psy3356          67 FECDVCGK   74 (180)
Q Consensus        67 ~~C~~C~~   74 (180)
                      -.|+.|+.
T Consensus         3 ~~CpYCg~   10 (102)
T PF11672_consen    3 IICPYCGG   10 (102)
T ss_pred             cccCCCCC
Confidence            34555544


No 255
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=22.49  E-value=9.6  Score=28.04  Aligned_cols=13  Identities=23%  Similarity=0.432  Sum_probs=8.5

Q ss_pred             CCCCcccCCCccc
Q psy3356         160 KDRPFHCPACEGM  172 (180)
Q Consensus       160 ~~~~~~C~~C~~~  172 (180)
                      +.+-+.|..|+.-
T Consensus       235 ~~rve~C~~C~~Y  247 (290)
T PF04216_consen  235 AYRVEVCESCGSY  247 (290)
T ss_dssp             SEEEEEETTTTEE
T ss_pred             cEEEEECCcccch
Confidence            4455778888753


No 256
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=22.32  E-value=23  Score=15.90  Aligned_cols=10  Identities=20%  Similarity=0.262  Sum_probs=3.8

Q ss_pred             cccccceeee
Q psy3356          25 FIPACVFRFS   34 (180)
Q Consensus        25 ~c~~C~~~~~   34 (180)
                      .|+.|+....
T Consensus         3 ~C~rC~~~~~   12 (30)
T PF06827_consen    3 KCPRCWNYIE   12 (30)
T ss_dssp             B-TTT--BBE
T ss_pred             cCccCCCcce
Confidence            4566655554


No 257
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.20  E-value=75  Score=15.49  Aligned_cols=15  Identities=20%  Similarity=0.465  Sum_probs=10.9

Q ss_pred             cCCcccccccceeee
Q psy3356          20 KNPLVFIPACVFRFS   34 (180)
Q Consensus        20 ~~~~~~c~~C~~~~~   34 (180)
                      ..|...|+.||..+-
T Consensus        29 ~vp~~~C~~CGE~~~   43 (46)
T TIGR03831        29 NVPALVCPQCGEEYL   43 (46)
T ss_pred             CCCccccccCCCEee
Confidence            446668888887765


No 258
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=21.62  E-value=9.8  Score=19.43  Aligned_cols=13  Identities=31%  Similarity=0.743  Sum_probs=6.3

Q ss_pred             Cceeccc--cccccC
Q psy3356         126 RPYECEI--CGKRFS  138 (180)
Q Consensus       126 ~~~~C~~--C~~~f~  138 (180)
                      ..+.|..  ||..|.
T Consensus        24 ~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   24 LYCQCTNPECGHTFV   38 (47)
T ss_pred             EEEEECCCcCCCEEE
Confidence            3355543  555553


No 259
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=21.50  E-value=16  Score=22.19  Aligned_cols=10  Identities=30%  Similarity=0.647  Sum_probs=5.1

Q ss_pred             cccccceeee
Q psy3356          25 FIPACVFRFS   34 (180)
Q Consensus        25 ~c~~C~~~~~   34 (180)
                      .|+.||..+.
T Consensus         2 fC~~Cg~~l~   11 (104)
T TIGR01384         2 FCPKCGSLMT   11 (104)
T ss_pred             CCcccCcccc
Confidence            3555555543


No 260
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=21.31  E-value=48  Score=20.33  Aligned_cols=24  Identities=25%  Similarity=0.401  Sum_probs=18.8

Q ss_pred             CceeccccccccCChHHHHHHHHH
Q psy3356         126 RPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       126 ~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      ..+-|..|.+-|.+...|..|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            346788888888888888888764


No 261
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=21.27  E-value=67  Score=19.14  Aligned_cols=22  Identities=18%  Similarity=0.489  Sum_probs=16.5

Q ss_pred             eecccCCcccccccceeeeecC
Q psy3356          16 INIQKNPLVFIPACVFRFSVEN   37 (180)
Q Consensus        16 ~~~~~~~~~~c~~C~~~~~~~~   37 (180)
                      +.....|...|+.||..+-+.+
T Consensus        28 IvIknVPa~~C~~CGe~y~~de   49 (89)
T TIGR03829        28 IEIKETPSISCSHCGMEYQDDT   49 (89)
T ss_pred             EEEecCCcccccCCCcEeecHH
Confidence            4456778889999999988443


No 262
>PRK01343 zinc-binding protein; Provisional
Probab=21.23  E-value=1e+02  Score=16.63  Aligned_cols=10  Identities=30%  Similarity=0.640  Sum_probs=5.2

Q ss_pred             cccCCCcccC
Q psy3356         164 FHCPACEGMF  173 (180)
Q Consensus       164 ~~C~~C~~~F  173 (180)
                      ..|++|++.|
T Consensus        10 ~~CP~C~k~~   19 (57)
T PRK01343         10 RPCPECGKPS   19 (57)
T ss_pred             CcCCCCCCcC
Confidence            3455555544


No 263
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=21.21  E-value=45  Score=20.29  Aligned_cols=12  Identities=33%  Similarity=0.957  Sum_probs=7.8

Q ss_pred             CCCCcccCCCcc
Q psy3356         160 KDRPFHCPACEG  171 (180)
Q Consensus       160 ~~~~~~C~~C~~  171 (180)
                      -++.|.|+.|+.
T Consensus        19 L~k~FtCp~Cgh   30 (104)
T COG4888          19 LPKTFTCPRCGH   30 (104)
T ss_pred             CCceEecCccCC
Confidence            355677777775


No 264
>KOG4727|consensus
Probab=21.11  E-value=58  Score=21.98  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=19.3

Q ss_pred             ceeccccccccCChHHHHHHHH
Q psy3356         127 PYECEICGKRFSQKSACNTHKR  148 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~  148 (180)
                      -|-|.+|.-.|.+..++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4889999999999999998875


No 265
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=21.11  E-value=91  Score=23.11  Aligned_cols=26  Identities=27%  Similarity=0.415  Sum_probs=22.9

Q ss_pred             CCCceeccccccccCChHHHHHHHHH
Q psy3356         124 GERPYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       124 ~~~~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      ....|.|..|-+-|.+...|.+|+..
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHHh
Confidence            35679999999999999999999874


No 266
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=20.90  E-value=1.4e+02  Score=15.97  Aligned_cols=13  Identities=31%  Similarity=0.874  Sum_probs=4.9

Q ss_pred             ceeccccccccCC
Q psy3356         127 PYECEICGKRFSQ  139 (180)
Q Consensus       127 ~~~C~~C~~~f~~  139 (180)
                      |.....|+..|..
T Consensus        24 PV~s~~C~H~fek   36 (57)
T PF11789_consen   24 PVKSKKCGHTFEK   36 (57)
T ss_dssp             EEEESSS--EEEH
T ss_pred             CcCcCCCCCeecH
Confidence            3444445555533


No 267
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=20.69  E-value=50  Score=24.54  Aligned_cols=34  Identities=18%  Similarity=0.316  Sum_probs=21.5

Q ss_pred             cceeccccCcccCChhhHHHHHhhcCCCCceeccccccccCCh
Q psy3356          98 KPYHCTECEATFSWKQNLEVHMRTHTGERPYECEICGKRFSQK  140 (180)
Q Consensus        98 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  140 (180)
                      .-.+|+.|+.....     +.+    .+..+.|+.|+..|.-.
T Consensus        37 lw~kc~~C~~~~~~-----~~l----~~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         37 LWVQCENCYGLNYK-----KFL----KSKMNICEQCGYHLKMS   70 (296)
T ss_pred             CeeECCCccchhhH-----HHH----HHcCCCCCCCCCCcCCC
Confidence            45678888876321     222    23347899999888654


No 268
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=20.55  E-value=62  Score=24.94  Aligned_cols=8  Identities=38%  Similarity=0.937  Sum_probs=3.8

Q ss_pred             eeccccCc
Q psy3356         100 YHCTECEA  107 (180)
Q Consensus       100 ~~C~~C~~  107 (180)
                      .+|+.|+.
T Consensus        15 g~cp~c~~   22 (372)
T cd01121          15 GKCPECGE   22 (372)
T ss_pred             EECcCCCC
Confidence            44555543


No 269
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=20.32  E-value=21  Score=18.80  Aligned_cols=15  Identities=27%  Similarity=0.631  Sum_probs=7.0

Q ss_pred             CCCCcccCCCcccCC
Q psy3356         160 KDRPFHCPACEGMFT  174 (180)
Q Consensus       160 ~~~~~~C~~C~~~F~  174 (180)
                      +...|+|.+|++.|.
T Consensus        32 ~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   32 EPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTCEEEETTT--EEE
T ss_pred             CCCEEEeeCCCCEec
Confidence            344466666665543


No 270
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=20.12  E-value=68  Score=14.41  Aligned_cols=8  Identities=25%  Similarity=0.816  Sum_probs=4.3

Q ss_pred             ccCCCccc
Q psy3356         165 HCPACEGM  172 (180)
Q Consensus       165 ~C~~C~~~  172 (180)
                      .|.+|++.
T Consensus         2 ~C~~C~~~    9 (30)
T PF03107_consen    2 WCDVCRRK    9 (30)
T ss_pred             CCCCCCCC
Confidence            45555554


No 271
>PTZ00448 hypothetical protein; Provisional
Probab=20.11  E-value=80  Score=24.28  Aligned_cols=23  Identities=22%  Similarity=0.456  Sum_probs=20.4

Q ss_pred             ceeccccccccCChHHHHHHHHH
Q psy3356         127 PYECEICGKRFSQKSACNTHKRT  149 (180)
Q Consensus       127 ~~~C~~C~~~f~~~~~l~~H~~~  149 (180)
                      .|.|..|+-.|.+......|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999999999999874


No 272
>KOG0402|consensus
Probab=20.07  E-value=15  Score=21.36  Aligned_cols=18  Identities=17%  Similarity=0.124  Sum_probs=12.2

Q ss_pred             ecccCCcccccccceeee
Q psy3356          17 NIQKNPLVFIPACVFRFS   34 (180)
Q Consensus        17 ~~~~~~~~~c~~C~~~~~   34 (180)
                      .++....+.|+.||+.--
T Consensus        30 ei~Qhaky~CsfCGK~~v   47 (92)
T KOG0402|consen   30 EIQQHAKYTCSFCGKKTV   47 (92)
T ss_pred             HHHHhhhhhhhhcchhhh
Confidence            344555668999987754


Done!