Diaphorina citri psyllid: psy3374


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
IITGYRRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLAFAS
cccccccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccEEECccccccccc
**************KDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPD*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IITGYRRGNDSTGVKDRVVNQLLTELDGVEGLEGVYVVGATSRPDIIDPALLRPGRLGSSVHCTMPDLAFAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis factor 1 Involved in peroxisome biosynthesis.confidentQ54GX5
Peroxisome biosynthesis protein PAS1 Involved in peroxisome biosynthesis. May play a direct or indirect role in delivering membrane material to developing peroxisomes. It may also be involved in intracellular membrane movement.confidentP46463
Peroxisomal ATPase PEX1 Component of the peroxisomal protein import machinery. Together with PEX6, mediates the ATP-dependent relocation and recycling of the peroxisomal targeting signal-1 (PTS1) import receptor PEX5 from the peroxisomal membrane to the cytosol, where it is then available for another round of protein import into the organelle.confidentP24004

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016558 [BP]protein import into peroxisome matrixprobableGO:0033036, GO:0008104, GO:0072663, GO:0072662, GO:0051641, GO:0044699, GO:0071806, GO:0070727, GO:0006886, GO:0016043, GO:0051179, GO:0065002, GO:0071840, GO:0006810, GO:0071702, GO:0043574, GO:0034613, GO:0006625, GO:0017038, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0055085, GO:0044743, GO:0016482, GO:0006996, GO:0007031, GO:0046907, GO:0072594, GO:0015031, GO:0044763, GO:0009987
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0010259 [BP]multicellular organismal agingprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0044427 [CC]chromosomal partprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0032268 [BP]regulation of cellular protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0008540 [CC]proteasome regulatory particle, base subcomplexprobableGO:0043234, GO:0005838, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0000502, GO:0044424, GO:0032991
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0045732 [BP]positive regulation of protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0051247, GO:0042176, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0050789, GO:0010604
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CE7, chain A
Confidence level:very confident
Coverage over the Query: 12-71
View the alignment between query and template
View the model in PyMOL