BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3385
         (99 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl
           Acetyltransferase (E2)
          Length = 239

 Score = 27.7 bits (60), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 26  QRAFDYDLIITEVYTV-HWVISREVFAQWMEIFRQVAERPV 65
           ++ FD   +++   +  H V+   V AQW+  FR+  E+P+
Sbjct: 195 EKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPI 235


>pdb|1ND5|A Chain A, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|B Chain B, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|C Chain C, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|D Chain D, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|A Chain A, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|B Chain B, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|C Chain C, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|D Chain D, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
          Length = 354

 Score = 25.8 bits (55), Expect = 6.6,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 63  RPVPEHTLTLDEDERADTPWWKCKKW 88
           +P+P HT+ L ED+    P+  C ++
Sbjct: 107 QPIPVHTVPLSEDQLLYLPFRNCPRF 132


>pdb|1RPA|A Chain A, Three-Dimensional Structure Of Rat Acid Phosphatase In
           Complex With L(+) Tartrate
 pdb|1RPT|A Chain A, Crystal Structures Of Rat Acid Phosphatase Complexed With
           The Transitions State Analogs Vanadate And Molybdate:
           Implications For The Reaction Mechanism
          Length = 342

 Score = 25.8 bits (55), Expect = 7.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 63  RPVPEHTLTLDEDERADTPWWKCKKW 88
           +P+P HT++L ED     P+  C ++
Sbjct: 107 QPIPVHTVSLSEDRLLYLPFRDCPRF 132


>pdb|2HPA|A Chain A, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|B Chain B, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|C Chain C, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|D Chain D, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|1CVI|A Chain A, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|B Chain B, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|C Chain C, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|D Chain D, Crystal Structure Of Human Prostatic Acid Phosphatase
          Length = 342

 Score = 25.4 bits (54), Expect = 7.7,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 63  RPVPEHTLTLDEDERADTPWWKCKKW 88
           +P+P HT+ L ED+    P+  C ++
Sbjct: 107 QPIPVHTVPLSEDQLLYLPFRNCPRF 132


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.139    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,730,919
Number of Sequences: 62578
Number of extensions: 93413
Number of successful extensions: 231
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 227
Number of HSP's gapped (non-prelim): 4
length of query: 99
length of database: 14,973,337
effective HSP length: 65
effective length of query: 34
effective length of database: 10,905,767
effective search space: 370796078
effective search space used: 370796078
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)