Query psy3389
Match_columns 195
No_of_seqs 7 out of 9
Neff 1.5
Searched_HMMs 46136
Date Fri Aug 16 23:44:47 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy3389.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3389hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF04505 Dispanin: Interferon- 71.3 3 6.5E-05 30.1 1.9 25 142-166 33-61 (82)
2 PF07462 MSP1_C: Merozoite sur 69.3 13 0.00029 36.3 6.2 8 17-24 250-257 (574)
3 PF07174 FAP: Fibronectin-atta 68.8 31 0.00066 31.6 8.0 11 32-42 33-43 (297)
4 PRK14954 DNA polymerase III su 65.3 46 0.00099 32.0 8.8 12 3-15 348-359 (620)
5 PRK12270 kgd alpha-ketoglutara 65.2 33 0.00072 36.3 8.4 40 111-150 141-184 (1228)
6 KOG0559|consensus 60.4 39 0.00084 32.4 7.3 19 158-176 321-339 (457)
7 PRK02655 psbI photosystem II r 53.5 2.6 5.7E-05 28.5 -1.0 29 125-158 9-37 (38)
8 PRK14950 DNA polymerase III su 49.4 1.5E+02 0.0032 27.6 9.2 20 140-159 507-526 (585)
9 PF07174 FAP: Fibronectin-atta 46.7 93 0.002 28.6 7.2 6 80-85 88-93 (297)
10 KOG0559|consensus 42.9 93 0.002 30.0 6.9 6 110-115 228-233 (457)
11 PF05104 Rib_recp_KP_reg: Ribo 42.3 66 0.0014 27.0 5.2 23 82-105 127-149 (151)
12 PF03276 Gag_spuma: Spumavirus 40.8 2.1E+02 0.0045 28.5 9.0 12 157-168 352-363 (582)
13 PF02532 PsbI: Photosystem II 40.0 9.8 0.00021 25.5 0.1 21 124-149 8-28 (36)
14 COG3147 DedD Uncharacterized p 33.2 1.7E+02 0.0038 25.9 6.6 13 11-23 68-80 (226)
15 CHL00024 psbI photosystem II p 32.4 9.4 0.0002 25.6 -0.9 18 125-147 9-26 (36)
16 PF08120 Toxin_32: Tamulustoxi 32.3 16 0.00034 24.3 0.1 12 104-115 15-26 (35)
17 PRK12270 kgd alpha-ketoglutara 29.3 2.6E+02 0.0055 30.1 8.0 21 18-40 29-49 (1228)
18 PRK14950 DNA polymerase III su 29.1 3.2E+02 0.007 25.5 8.0 7 6-12 339-345 (585)
19 PRK07764 DNA polymerase III su 28.4 3.9E+02 0.0085 26.8 8.8 6 120-125 511-516 (824)
20 PF05104 Rib_recp_KP_reg: Ribo 28.0 2E+02 0.0043 24.3 5.8 8 73-80 127-134 (151)
21 PF14811 TPD: Protein of unkno 25.5 33 0.00072 27.7 0.9 16 168-189 109-124 (139)
22 KOG2154|consensus 24.6 86 0.0019 30.6 3.5 26 119-144 330-355 (505)
23 KOG0898|consensus 24.1 59 0.0013 27.4 2.1 19 139-157 38-56 (152)
24 PRK14948 DNA polymerase III su 23.2 3.9E+02 0.0085 25.6 7.6 7 119-125 602-608 (620)
25 KOG4491|consensus 21.4 60 0.0013 29.9 1.8 20 124-143 85-104 (323)
26 PRK00404 tatB sec-independent 20.9 2E+02 0.0044 23.6 4.5 6 16-21 58-63 (141)
No 1
>PF04505 Dispanin: Interferon-induced transmembrane protein; InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=71.33 E-value=3 Score=30.07 Aligned_cols=25 Identities=32% Similarity=0.547 Sum_probs=20.7
Q ss_pred HHHHH----HHHHHhhcccchhhhhcccc
Q psy3389 142 FGLAA----ARVQRRVNRGDLARAQDRSE 166 (195)
Q Consensus 142 ~~~~~----~~~~~~~~~~~~~~~~~~~~ 166 (195)
||+.| .+|+.+..+||++.||.-|+
T Consensus 33 lGi~Ai~~s~kv~~~~~~Gd~~~A~~aS~ 61 (82)
T PF04505_consen 33 LGIVAIVYSSKVRSRYAAGDYEGARRASR 61 (82)
T ss_pred HHHHHheechhhHHHHHCCCHHHHHHHHH
Confidence 67654 78999999999999987664
No 2
>PF07462 MSP1_C: Merozoite surface protein 1 (MSP1) C-terminus; InterPro: IPR010901 This entry represents the C-terminal region of merozoite surface protein 1 (MSP1), which is found in a number of Plasmodium species. MSP-1 is a 200 kDa protein expressed on the surface of the Plasmodium vivax merozoite. MSP-1 of Plasmodium species is synthesised as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19 kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate [].; GO: 0009405 pathogenesis, 0016020 membrane
Probab=69.33 E-value=13 Score=36.34 Aligned_cols=8 Identities=13% Similarity=0.264 Sum_probs=3.5
Q ss_pred HHHHhhhc
Q psy3389 17 LTRQIRDL 24 (195)
Q Consensus 17 L~RQi~~L 24 (195)
-|.|-.+|
T Consensus 250 ALq~YqEL 257 (574)
T PF07462_consen 250 ALQAYQEL 257 (574)
T ss_pred HHHHHHHh
Confidence 34444444
No 3
>PF07174 FAP: Fibronectin-attachment protein (FAP); InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=68.80 E-value=31 Score=31.58 Aligned_cols=11 Identities=45% Similarity=0.757 Sum_probs=5.6
Q ss_pred CccccCCCCCC
Q psy3389 32 RPIIYKADPRP 42 (195)
Q Consensus 32 ~Ps~~KAAP~P 42 (195)
.|++-.|.|.|
T Consensus 33 LPa~A~AdPaP 43 (297)
T PF07174_consen 33 LPATAQADPAP 43 (297)
T ss_pred ccccccCCCCC
Confidence 35555555553
No 4
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional
Probab=65.27 E-value=46 Score=31.99 Aligned_cols=12 Identities=33% Similarity=0.493 Sum_probs=7.0
Q ss_pred hhhhhhccCCchh
Q psy3389 3 SARRELKSRPITY 15 (195)
Q Consensus 3 ~~~~~~~~~~~~~ 15 (195)
.+++.||+ -+..
T Consensus 348 e~d~~LKt-n~n~ 359 (620)
T PRK14954 348 KTQGELKF-QFEY 359 (620)
T ss_pred HHHHHHhh-CCCc
Confidence 45677777 4443
No 5
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed
Probab=65.23 E-value=33 Score=36.32 Aligned_cols=40 Identities=25% Similarity=0.277 Sum_probs=22.5
Q ss_pred ccccCCChhhHHHHHhhhhhhhccCchhhH----HHHHHHHHHH
Q psy3389 111 CSVKSPSPKTLAEFYSIVTFFLSSTHHTKF----LFGLAAARVQ 150 (195)
Q Consensus 111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~ 150 (195)
|||..-.-|.|.+++..+-=.|.-+|-.|. |+|.|.++.-
T Consensus 141 Tsvr~Ip~k~L~dnR~~In~~l~r~~GgKVSFThlI~kAvv~AL 184 (1228)
T PRK12270 141 TSVRAVPAKLLIDNRIVINNHLKRTRGGKVSFTHLIGYALVQAL 184 (1228)
T ss_pred eeeecccHHHHHHHHHHHHHHhhhccCCcccHHHHHHHHHHHHH
Confidence 455555667788888777544443333332 4566655443
No 6
>KOG0559|consensus
Probab=60.39 E-value=39 Score=32.41 Aligned_cols=19 Identities=26% Similarity=0.291 Sum_probs=9.7
Q ss_pred hhhhhccccCccCCCccee
Q psy3389 158 LARAQDRSEGLLGPGPRLV 176 (195)
Q Consensus 158 ~~~~~~~~~~~~~~~~~~~ 176 (195)
+.-|-.-+.||.-|==|-+
T Consensus 321 ISvAVaTpkGLVvPViRna 339 (457)
T KOG0559|consen 321 ISVAVATPKGLVVPVIRNA 339 (457)
T ss_pred eEEEeecCCceeeeeeccc
Confidence 3344445566666544433
No 7
>PRK02655 psbI photosystem II reaction center I protein I; Provisional
Probab=53.50 E-value=2.6 Score=28.47 Aligned_cols=29 Identities=38% Similarity=0.731 Sum_probs=21.6
Q ss_pred HhhhhhhhccCchhhHHHHHHHHHHHHhhcccch
Q psy3389 125 YSIVTFFLSSTHHTKFLFGLAAARVQRRVNRGDL 158 (195)
Q Consensus 125 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 158 (195)
|.+|+||.| -|+||.....--|.-+|.||
T Consensus 9 y~vV~ffvs-----LFiFGflsnDP~RnP~rkd~ 37 (38)
T PRK02655 9 YIVVFFFVG-----LFVFGFLSSDPTRNPGRKDL 37 (38)
T ss_pred hhhHHHHHH-----HHHcccCCCCCCCCCCcccC
Confidence 788888886 58999887666666666665
No 8
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=49.37 E-value=1.5e+02 Score=27.64 Aligned_cols=20 Identities=15% Similarity=0.150 Sum_probs=8.6
Q ss_pred HHHHHHHHHHHHhhcccchh
Q psy3389 140 FLFGLAAARVQRRVNRGDLA 159 (195)
Q Consensus 140 ~~~~~~~~~~~~~~~~~~~~ 159 (195)
|..++...++.+--||..+.
T Consensus 507 ~~~~~~~~~~~~~~~r~~i~ 526 (585)
T PRK14950 507 FKSKFHKDKIEEPENRKITE 526 (585)
T ss_pred cCcHHHHHHhhchHHHHHHH
Confidence 33444454444433444433
No 9
>PF07174 FAP: Fibronectin-attachment protein (FAP); InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=46.73 E-value=93 Score=28.56 Aligned_cols=6 Identities=33% Similarity=0.412 Sum_probs=2.2
Q ss_pred CCCCCC
Q psy3389 80 TYKADP 85 (195)
Q Consensus 80 tyKAAP 85 (195)
+.-+++
T Consensus 88 dPna~~ 93 (297)
T PF07174_consen 88 DPNAAP 93 (297)
T ss_pred CCCCCC
Confidence 333333
No 10
>KOG0559|consensus
Probab=42.92 E-value=93 Score=29.98 Aligned_cols=6 Identities=50% Similarity=0.357 Sum_probs=3.5
Q ss_pred cccccC
Q psy3389 110 ECSVKS 115 (195)
Q Consensus 110 ~~~~~~ 115 (195)
|-.||-
T Consensus 228 E~RVkM 233 (457)
T KOG0559|consen 228 ERRVKM 233 (457)
T ss_pred hhhhhh
Confidence 666654
No 11
>PF05104 Rib_recp_KP_reg: Ribosome receptor lysine/proline rich region; InterPro: IPR007794 The ribosome receptor is an integral endoplasmic reticulum protein that has been suggested to be involved in secretion. This highly conserved region is found towards the C terminus of the transmembrane domain []. The function is unclear.; GO: 0015031 protein transport, 0030176 integral to endoplasmic reticulum membrane
Probab=42.25 E-value=66 Score=27.00 Aligned_cols=23 Identities=35% Similarity=0.556 Sum_probs=10.0
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCC
Q psy3389 82 KADPRPSTYKADPRPIIYKADPRP 105 (195)
Q Consensus 82 KAAP~PstykAAP~P~~ykaaP~P 105 (195)
|..|.|+.-...| =..-+++|++
T Consensus 127 KvePaP~~~~~~p-v~~~k~ap~~ 149 (151)
T PF05104_consen 127 KVEPAPSPAVPSP-VSASKSAPVP 149 (151)
T ss_pred ccCCCCcccCCCc-ccccccCCCC
Confidence 4455554444443 2333444443
No 12
>PF03276 Gag_spuma: Spumavirus gag protein; InterPro: IPR004957 The Spumavirus gag protein is a core viral polyprotein that undergoes specific enzymatic cleavages in vivo to yield the mature protein.; GO: 0019028 viral capsid
Probab=40.82 E-value=2.1e+02 Score=28.51 Aligned_cols=12 Identities=33% Similarity=0.578 Sum_probs=6.0
Q ss_pred chhhhhccccCc
Q psy3389 157 DLARAQDRSEGL 168 (195)
Q Consensus 157 ~~~~~~~~~~~~ 168 (195)
|.-+.-..+||+
T Consensus 352 ~vL~~ia~~EGv 363 (582)
T PF03276_consen 352 DVLRGIANQEGV 363 (582)
T ss_pred HHHHHHhhhhhH
Confidence 334444556665
No 13
>PF02532 PsbI: Photosystem II reaction centre I protein (PSII 4.8 kDa protein); InterPro: IPR003686 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection []. This family represents the low molecular weight transmembrane protein PsbI, which is tightly associated with the D1/D2 heterodimer in PSII. The function of PsbI is unknown, but it may be involved in the assembly, dimerisation or stabilisation of PSII dimers [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_i 3ARC_I 3A0B_i 3BZ2_I 3PRQ_I 3KZI_I 3PRR_I 2AXT_i 4FBY_I 1S5L_i ....
Probab=39.97 E-value=9.8 Score=25.49 Aligned_cols=21 Identities=38% Similarity=0.858 Sum_probs=15.4
Q ss_pred HHhhhhhhhccCchhhHHHHHHHHHH
Q psy3389 124 FYSIVTFFLSSTHHTKFLFGLAAARV 149 (195)
Q Consensus 124 ~~~~~~~~~~~~~~~~~~~~~~~~~~ 149 (195)
-|.+|.||.| -|+||+...--
T Consensus 8 Vy~vV~ffv~-----LFifGflsnDp 28 (36)
T PF02532_consen 8 VYTVVIFFVS-----LFIFGFLSNDP 28 (36)
T ss_dssp HHHHHHHHHH-----HHHHHHHTTCT
T ss_pred ehhhHHHHHH-----HHhccccCCCC
Confidence 3788888876 58999876433
No 14
>COG3147 DedD Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.24 E-value=1.7e+02 Score=25.93 Aligned_cols=13 Identities=15% Similarity=0.274 Sum_probs=8.9
Q ss_pred CCchhhHHHHhhh
Q psy3389 11 RPITYNLTRQIRD 23 (195)
Q Consensus 11 ~~~~~NL~RQi~~ 23 (195)
++-+.|...||+|
T Consensus 68 ~~~pegva~ei~d 80 (226)
T COG3147 68 TQPPEGVAQEIQD 80 (226)
T ss_pred CCCCcccchhhhc
Confidence 3456677788876
No 15
>CHL00024 psbI photosystem II protein I
Probab=32.45 E-value=9.4 Score=25.58 Aligned_cols=18 Identities=44% Similarity=1.038 Sum_probs=14.1
Q ss_pred HhhhhhhhccCchhhHHHHHHHH
Q psy3389 125 YSIVTFFLSSTHHTKFLFGLAAA 147 (195)
Q Consensus 125 ~~~~~~~~~~~~~~~~~~~~~~~ 147 (195)
|.+|+||.| -|+||....
T Consensus 9 y~vV~ffvs-----LFifGFlsn 26 (36)
T CHL00024 9 YTVVIFFVS-----LFIFGFLSN 26 (36)
T ss_pred hhHHHHHHH-----HHHccccCC
Confidence 778888876 589998754
No 16
>PF08120 Toxin_32: Tamulustoxin family; InterPro: IPR012636 This family consists of the tamulustoxins, which are found in the venom of Mesobuthus tamulus (Eastern Indian scorpion) (Buthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=32.34 E-value=16 Score=24.32 Aligned_cols=12 Identities=58% Similarity=1.124 Sum_probs=9.3
Q ss_pred CCCCCccccccC
Q psy3389 104 RPSTYGECSVKS 115 (195)
Q Consensus 104 ~P~syg~~~~~~ 115 (195)
.|-+||||.-|.
T Consensus 15 spgtygecvkke 26 (35)
T PF08120_consen 15 SPGTYGECVKKE 26 (35)
T ss_pred CCCchhhhhhhc
Confidence 578999997653
No 17
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed
Probab=29.33 E-value=2.6e+02 Score=30.14 Aligned_cols=21 Identities=14% Similarity=0.137 Sum_probs=10.6
Q ss_pred HHHhhhcccCCCCCCccccCCCC
Q psy3389 18 TRQIRDLSYYKADPRPIIYKADP 40 (195)
Q Consensus 18 ~RQi~~LS~~Ka~s~Ps~~KAAP 40 (195)
.++| +.++...+.+....++.
T Consensus 29 W~~~--f~~~~~~~~~~~~~~~~ 49 (1228)
T PRK12270 29 WREF--FADYGPGSTAAPTAAAA 49 (1228)
T ss_pred HHHH--HhhcCCCCCCCCCCCCc
Confidence 3455 56666555554444333
No 18
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=29.08 E-value=3.2e+02 Score=25.50 Aligned_cols=7 Identities=14% Similarity=0.330 Sum_probs=3.3
Q ss_pred hhhccCC
Q psy3389 6 RELKSRP 12 (195)
Q Consensus 6 ~~~~~~~ 12 (195)
..+|+-.
T Consensus 339 ~~lK~~~ 345 (585)
T PRK14950 339 FQLRTTS 345 (585)
T ss_pred HHHhcCC
Confidence 4455544
No 19
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=28.41 E-value=3.9e+02 Score=26.76 Aligned_cols=6 Identities=50% Similarity=0.578 Sum_probs=2.4
Q ss_pred hHHHHH
Q psy3389 120 TLAEFY 125 (195)
Q Consensus 120 ~~~~~~ 125 (195)
+|.+-+
T Consensus 511 ~lr~~W 516 (824)
T PRK07764 511 TLRERW 516 (824)
T ss_pred HHHHHH
Confidence 444433
No 20
>PF05104 Rib_recp_KP_reg: Ribosome receptor lysine/proline rich region; InterPro: IPR007794 The ribosome receptor is an integral endoplasmic reticulum protein that has been suggested to be involved in secretion. This highly conserved region is found towards the C terminus of the transmembrane domain []. The function is unclear.; GO: 0015031 protein transport, 0030176 integral to endoplasmic reticulum membrane
Probab=27.97 E-value=2e+02 Score=24.25 Aligned_cols=8 Identities=63% Similarity=1.090 Sum_probs=3.1
Q ss_pred CCCCCCCC
Q psy3389 73 KVDPRPST 80 (195)
Q Consensus 73 KaAP~Pst 80 (195)
|+.|.|+.
T Consensus 127 KvePaP~~ 134 (151)
T PF05104_consen 127 KVEPAPSP 134 (151)
T ss_pred ccCCCCcc
Confidence 33333333
No 21
>PF14811 TPD: Protein of unknown function TPD sequence-motif
Probab=25.52 E-value=33 Score=27.70 Aligned_cols=16 Identities=56% Similarity=1.288 Sum_probs=12.2
Q ss_pred ccCCCcceeeeeeehhccccCC
Q psy3389 168 LLGPGPRLVRLVSYWAFGFEGN 189 (195)
Q Consensus 168 ~~~~~~~~~~~~~~~~~~~~~~ 189 (195)
.+||| +|-|| |||.-.
T Consensus 109 rfGpG-----~VIyw-~G~~~~ 124 (139)
T PF14811_consen 109 RFGPG-----AVIYW-FGFIDE 124 (139)
T ss_pred HhCCc-----eEEEe-ccchhh
Confidence 47888 78899 788644
No 22
>KOG2154|consensus
Probab=24.60 E-value=86 Score=30.59 Aligned_cols=26 Identities=38% Similarity=0.616 Sum_probs=21.7
Q ss_pred hhHHHHHhhhhhhhccCchhhHHHHH
Q psy3389 119 KTLAEFYSIVTFFLSSTHHTKFLFGL 144 (195)
Q Consensus 119 ~~~~~~~~~~~~~~~~~~~~~~~~~~ 144 (195)
|.-|.|+-..-.||||||--..|..-
T Consensus 330 KyRarff~L~D~FLSSTHLpa~LvAs 355 (505)
T KOG2154|consen 330 KYRARFFRLADLFLSSTHLPAYLVAS 355 (505)
T ss_pred HHHHHHHHHHHHHhhcccchHHHHHH
Confidence 67789999999999999988776533
No 23
>KOG0898|consensus
Probab=24.07 E-value=59 Score=27.41 Aligned_cols=19 Identities=47% Similarity=0.580 Sum_probs=14.8
Q ss_pred hHHHHHHHHHHHHhhcccc
Q psy3389 139 KFLFGLAAARVQRRVNRGD 157 (195)
Q Consensus 139 ~~~~~~~~~~~~~~~~~~~ 157 (195)
.-|.-|.-+|++||+|||-
T Consensus 38 ~~~~~l~~ar~rrR~~RGL 56 (152)
T KOG0898|consen 38 EQLVKLFPARQRRRLNRGL 56 (152)
T ss_pred HHHHHHHHHHHHHHHHccc
Confidence 3455667799999999984
No 24
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional
Probab=23.23 E-value=3.9e+02 Score=25.62 Aligned_cols=7 Identities=57% Similarity=1.184 Sum_probs=3.3
Q ss_pred hhHHHHH
Q psy3389 119 KTLAEFY 125 (195)
Q Consensus 119 ~~~~~~~ 125 (195)
|.||+||
T Consensus 602 ~~~a~~f 608 (620)
T PRK14948 602 KNLADFF 608 (620)
T ss_pred HHHHHHc
Confidence 3445554
No 25
>KOG4491|consensus
Probab=21.44 E-value=60 Score=29.87 Aligned_cols=20 Identities=50% Similarity=0.640 Sum_probs=17.4
Q ss_pred HHhhhhhhhccCchhhHHHH
Q psy3389 124 FYSIVTFFLSSTHHTKFLFG 143 (195)
Q Consensus 124 ~~~~~~~~~~~~~~~~~~~~ 143 (195)
|-|++.||+||..-|||-.+
T Consensus 85 f~sl~~fF~sss~~tkfr~~ 104 (323)
T KOG4491|consen 85 FTSLLMFFLSSSKLTKFRGE 104 (323)
T ss_pred HHHHHHHHHccchhhhHHHH
Confidence 57889999999999999755
No 26
>PRK00404 tatB sec-independent translocase; Provisional
Probab=20.87 E-value=2e+02 Score=23.59 Aligned_cols=6 Identities=33% Similarity=0.761 Sum_probs=2.2
Q ss_pred hHHHHh
Q psy3389 16 NLTRQI 21 (195)
Q Consensus 16 NL~RQi 21 (195)
.|-+|+
T Consensus 58 elr~~l 63 (141)
T PRK00404 58 EIRRQL 63 (141)
T ss_pred HHHHHH
Confidence 333333
Done!