Query         psy3389
Match_columns 195
No_of_seqs    7 out of 9
Neff          1.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:44:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3389.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3389hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04505 Dispanin:  Interferon-  71.3       3 6.5E-05   30.1   1.9   25  142-166    33-61  (82)
  2 PF07462 MSP1_C:  Merozoite sur  69.3      13 0.00029   36.3   6.2    8   17-24    250-257 (574)
  3 PF07174 FAP:  Fibronectin-atta  68.8      31 0.00066   31.6   8.0   11   32-42     33-43  (297)
  4 PRK14954 DNA polymerase III su  65.3      46 0.00099   32.0   8.8   12    3-15    348-359 (620)
  5 PRK12270 kgd alpha-ketoglutara  65.2      33 0.00072   36.3   8.4   40  111-150   141-184 (1228)
  6 KOG0559|consensus               60.4      39 0.00084   32.4   7.3   19  158-176   321-339 (457)
  7 PRK02655 psbI photosystem II r  53.5     2.6 5.7E-05   28.5  -1.0   29  125-158     9-37  (38)
  8 PRK14950 DNA polymerase III su  49.4 1.5E+02  0.0032   27.6   9.2   20  140-159   507-526 (585)
  9 PF07174 FAP:  Fibronectin-atta  46.7      93   0.002   28.6   7.2    6   80-85     88-93  (297)
 10 KOG0559|consensus               42.9      93   0.002   30.0   6.9    6  110-115   228-233 (457)
 11 PF05104 Rib_recp_KP_reg:  Ribo  42.3      66  0.0014   27.0   5.2   23   82-105   127-149 (151)
 12 PF03276 Gag_spuma:  Spumavirus  40.8 2.1E+02  0.0045   28.5   9.0   12  157-168   352-363 (582)
 13 PF02532 PsbI:  Photosystem II   40.0     9.8 0.00021   25.5   0.1   21  124-149     8-28  (36)
 14 COG3147 DedD Uncharacterized p  33.2 1.7E+02  0.0038   25.9   6.6   13   11-23     68-80  (226)
 15 CHL00024 psbI photosystem II p  32.4     9.4  0.0002   25.6  -0.9   18  125-147     9-26  (36)
 16 PF08120 Toxin_32:  Tamulustoxi  32.3      16 0.00034   24.3   0.1   12  104-115    15-26  (35)
 17 PRK12270 kgd alpha-ketoglutara  29.3 2.6E+02  0.0055   30.1   8.0   21   18-40     29-49  (1228)
 18 PRK14950 DNA polymerase III su  29.1 3.2E+02   0.007   25.5   8.0    7    6-12    339-345 (585)
 19 PRK07764 DNA polymerase III su  28.4 3.9E+02  0.0085   26.8   8.8    6  120-125   511-516 (824)
 20 PF05104 Rib_recp_KP_reg:  Ribo  28.0   2E+02  0.0043   24.3   5.8    8   73-80    127-134 (151)
 21 PF14811 TPD:  Protein of unkno  25.5      33 0.00072   27.7   0.9   16  168-189   109-124 (139)
 22 KOG2154|consensus               24.6      86  0.0019   30.6   3.5   26  119-144   330-355 (505)
 23 KOG0898|consensus               24.1      59  0.0013   27.4   2.1   19  139-157    38-56  (152)
 24 PRK14948 DNA polymerase III su  23.2 3.9E+02  0.0085   25.6   7.6    7  119-125   602-608 (620)
 25 KOG4491|consensus               21.4      60  0.0013   29.9   1.8   20  124-143    85-104 (323)
 26 PRK00404 tatB sec-independent   20.9   2E+02  0.0044   23.6   4.5    6   16-21     58-63  (141)

No 1  
>PF04505 Dispanin:  Interferon-induced transmembrane protein;  InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=71.33  E-value=3  Score=30.07  Aligned_cols=25  Identities=32%  Similarity=0.547  Sum_probs=20.7

Q ss_pred             HHHHH----HHHHHhhcccchhhhhcccc
Q psy3389         142 FGLAA----ARVQRRVNRGDLARAQDRSE  166 (195)
Q Consensus       142 ~~~~~----~~~~~~~~~~~~~~~~~~~~  166 (195)
                      ||+.|    .+|+.+..+||++.||.-|+
T Consensus        33 lGi~Ai~~s~kv~~~~~~Gd~~~A~~aS~   61 (82)
T PF04505_consen   33 LGIVAIVYSSKVRSRYAAGDYEGARRASR   61 (82)
T ss_pred             HHHHHheechhhHHHHHCCCHHHHHHHHH
Confidence            67654    78999999999999987664


No 2  
>PF07462 MSP1_C:  Merozoite surface protein 1 (MSP1) C-terminus;  InterPro: IPR010901 This entry represents the C-terminal region of merozoite surface protein 1 (MSP1), which is found in a number of Plasmodium species. MSP-1 is a 200 kDa protein expressed on the surface of the Plasmodium vivax merozoite. MSP-1 of Plasmodium species is synthesised as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19 kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate [].; GO: 0009405 pathogenesis, 0016020 membrane
Probab=69.33  E-value=13  Score=36.34  Aligned_cols=8  Identities=13%  Similarity=0.264  Sum_probs=3.5

Q ss_pred             HHHHhhhc
Q psy3389          17 LTRQIRDL   24 (195)
Q Consensus        17 L~RQi~~L   24 (195)
                      -|.|-.+|
T Consensus       250 ALq~YqEL  257 (574)
T PF07462_consen  250 ALQAYQEL  257 (574)
T ss_pred             HHHHHHHh
Confidence            34444444


No 3  
>PF07174 FAP:  Fibronectin-attachment protein (FAP);  InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=68.80  E-value=31  Score=31.58  Aligned_cols=11  Identities=45%  Similarity=0.757  Sum_probs=5.6

Q ss_pred             CccccCCCCCC
Q psy3389          32 RPIIYKADPRP   42 (195)
Q Consensus        32 ~Ps~~KAAP~P   42 (195)
                      .|++-.|.|.|
T Consensus        33 LPa~A~AdPaP   43 (297)
T PF07174_consen   33 LPATAQADPAP   43 (297)
T ss_pred             ccccccCCCCC
Confidence            35555555553


No 4  
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional
Probab=65.27  E-value=46  Score=31.99  Aligned_cols=12  Identities=33%  Similarity=0.493  Sum_probs=7.0

Q ss_pred             hhhhhhccCCchh
Q psy3389           3 SARRELKSRPITY   15 (195)
Q Consensus         3 ~~~~~~~~~~~~~   15 (195)
                      .+++.||+ -+..
T Consensus       348 e~d~~LKt-n~n~  359 (620)
T PRK14954        348 KTQGELKF-QFEY  359 (620)
T ss_pred             HHHHHHhh-CCCc
Confidence            45677777 4443


No 5  
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed
Probab=65.23  E-value=33  Score=36.32  Aligned_cols=40  Identities=25%  Similarity=0.277  Sum_probs=22.5

Q ss_pred             ccccCCChhhHHHHHhhhhhhhccCchhhH----HHHHHHHHHH
Q psy3389         111 CSVKSPSPKTLAEFYSIVTFFLSSTHHTKF----LFGLAAARVQ  150 (195)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~  150 (195)
                      |||..-.-|.|.+++..+-=.|.-+|-.|.    |+|.|.++.-
T Consensus       141 Tsvr~Ip~k~L~dnR~~In~~l~r~~GgKVSFThlI~kAvv~AL  184 (1228)
T PRK12270        141 TSVRAVPAKLLIDNRIVINNHLKRTRGGKVSFTHLIGYALVQAL  184 (1228)
T ss_pred             eeeecccHHHHHHHHHHHHHHhhhccCCcccHHHHHHHHHHHHH
Confidence            455555667788888777544443333332    4566655443


No 6  
>KOG0559|consensus
Probab=60.39  E-value=39  Score=32.41  Aligned_cols=19  Identities=26%  Similarity=0.291  Sum_probs=9.7

Q ss_pred             hhhhhccccCccCCCccee
Q psy3389         158 LARAQDRSEGLLGPGPRLV  176 (195)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~  176 (195)
                      +.-|-.-+.||.-|==|-+
T Consensus       321 ISvAVaTpkGLVvPViRna  339 (457)
T KOG0559|consen  321 ISVAVATPKGLVVPVIRNA  339 (457)
T ss_pred             eEEEeecCCceeeeeeccc
Confidence            3344445566666544433


No 7  
>PRK02655 psbI photosystem II reaction center I protein I; Provisional
Probab=53.50  E-value=2.6  Score=28.47  Aligned_cols=29  Identities=38%  Similarity=0.731  Sum_probs=21.6

Q ss_pred             HhhhhhhhccCchhhHHHHHHHHHHHHhhcccch
Q psy3389         125 YSIVTFFLSSTHHTKFLFGLAAARVQRRVNRGDL  158 (195)
Q Consensus       125 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (195)
                      |.+|+||.|     -|+||.....--|.-+|.||
T Consensus         9 y~vV~ffvs-----LFiFGflsnDP~RnP~rkd~   37 (38)
T PRK02655          9 YIVVFFFVG-----LFVFGFLSSDPTRNPGRKDL   37 (38)
T ss_pred             hhhHHHHHH-----HHHcccCCCCCCCCCCcccC
Confidence            788888886     58999887666666666665


No 8  
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=49.37  E-value=1.5e+02  Score=27.64  Aligned_cols=20  Identities=15%  Similarity=0.150  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHhhcccchh
Q psy3389         140 FLFGLAAARVQRRVNRGDLA  159 (195)
Q Consensus       140 ~~~~~~~~~~~~~~~~~~~~  159 (195)
                      |..++...++.+--||..+.
T Consensus       507 ~~~~~~~~~~~~~~~r~~i~  526 (585)
T PRK14950        507 FKSKFHKDKIEEPENRKITE  526 (585)
T ss_pred             cCcHHHHHHhhchHHHHHHH
Confidence            33444454444433444433


No 9  
>PF07174 FAP:  Fibronectin-attachment protein (FAP);  InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=46.73  E-value=93  Score=28.56  Aligned_cols=6  Identities=33%  Similarity=0.412  Sum_probs=2.2

Q ss_pred             CCCCCC
Q psy3389          80 TYKADP   85 (195)
Q Consensus        80 tyKAAP   85 (195)
                      +.-+++
T Consensus        88 dPna~~   93 (297)
T PF07174_consen   88 DPNAAP   93 (297)
T ss_pred             CCCCCC
Confidence            333333


No 10 
>KOG0559|consensus
Probab=42.92  E-value=93  Score=29.98  Aligned_cols=6  Identities=50%  Similarity=0.357  Sum_probs=3.5

Q ss_pred             cccccC
Q psy3389         110 ECSVKS  115 (195)
Q Consensus       110 ~~~~~~  115 (195)
                      |-.||-
T Consensus       228 E~RVkM  233 (457)
T KOG0559|consen  228 ERRVKM  233 (457)
T ss_pred             hhhhhh
Confidence            666654


No 11 
>PF05104 Rib_recp_KP_reg:  Ribosome receptor lysine/proline rich region;  InterPro: IPR007794 The ribosome receptor is an integral endoplasmic reticulum protein that has been suggested to be involved in secretion. This highly conserved region is found towards the C terminus of the transmembrane domain []. The function is unclear.; GO: 0015031 protein transport, 0030176 integral to endoplasmic reticulum membrane
Probab=42.25  E-value=66  Score=27.00  Aligned_cols=23  Identities=35%  Similarity=0.556  Sum_probs=10.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC
Q psy3389          82 KADPRPSTYKADPRPIIYKADPRP  105 (195)
Q Consensus        82 KAAP~PstykAAP~P~~ykaaP~P  105 (195)
                      |..|.|+.-...| =..-+++|++
T Consensus       127 KvePaP~~~~~~p-v~~~k~ap~~  149 (151)
T PF05104_consen  127 KVEPAPSPAVPSP-VSASKSAPVP  149 (151)
T ss_pred             ccCCCCcccCCCc-ccccccCCCC
Confidence            4455554444443 2333444443


No 12 
>PF03276 Gag_spuma:  Spumavirus gag protein;  InterPro: IPR004957 The Spumavirus gag protein is a core viral polyprotein that undergoes specific enzymatic cleavages in vivo to yield the mature protein.; GO: 0019028 viral capsid
Probab=40.82  E-value=2.1e+02  Score=28.51  Aligned_cols=12  Identities=33%  Similarity=0.578  Sum_probs=6.0

Q ss_pred             chhhhhccccCc
Q psy3389         157 DLARAQDRSEGL  168 (195)
Q Consensus       157 ~~~~~~~~~~~~  168 (195)
                      |.-+.-..+||+
T Consensus       352 ~vL~~ia~~EGv  363 (582)
T PF03276_consen  352 DVLRGIANQEGV  363 (582)
T ss_pred             HHHHHHhhhhhH
Confidence            334444556665


No 13 
>PF02532 PsbI:  Photosystem II reaction centre I protein (PSII 4.8 kDa protein);  InterPro: IPR003686 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbI, which is tightly associated with the D1/D2 heterodimer in PSII. The function of PsbI is unknown, but it may be involved in the assembly, dimerisation or stabilisation of PSII dimers [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_i 3ARC_I 3A0B_i 3BZ2_I 3PRQ_I 3KZI_I 3PRR_I 2AXT_i 4FBY_I 1S5L_i ....
Probab=39.97  E-value=9.8  Score=25.49  Aligned_cols=21  Identities=38%  Similarity=0.858  Sum_probs=15.4

Q ss_pred             HHhhhhhhhccCchhhHHHHHHHHHH
Q psy3389         124 FYSIVTFFLSSTHHTKFLFGLAAARV  149 (195)
Q Consensus       124 ~~~~~~~~~~~~~~~~~~~~~~~~~~  149 (195)
                      -|.+|.||.|     -|+||+...--
T Consensus         8 Vy~vV~ffv~-----LFifGflsnDp   28 (36)
T PF02532_consen    8 VYTVVIFFVS-----LFIFGFLSNDP   28 (36)
T ss_dssp             HHHHHHHHHH-----HHHHHHHTTCT
T ss_pred             ehhhHHHHHH-----HHhccccCCCC
Confidence            3788888876     58999876433


No 14 
>COG3147 DedD Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.24  E-value=1.7e+02  Score=25.93  Aligned_cols=13  Identities=15%  Similarity=0.274  Sum_probs=8.9

Q ss_pred             CCchhhHHHHhhh
Q psy3389          11 RPITYNLTRQIRD   23 (195)
Q Consensus        11 ~~~~~NL~RQi~~   23 (195)
                      ++-+.|...||+|
T Consensus        68 ~~~pegva~ei~d   80 (226)
T COG3147          68 TQPPEGVAQEIQD   80 (226)
T ss_pred             CCCCcccchhhhc
Confidence            3456677788876


No 15 
>CHL00024 psbI photosystem II protein I
Probab=32.45  E-value=9.4  Score=25.58  Aligned_cols=18  Identities=44%  Similarity=1.038  Sum_probs=14.1

Q ss_pred             HhhhhhhhccCchhhHHHHHHHH
Q psy3389         125 YSIVTFFLSSTHHTKFLFGLAAA  147 (195)
Q Consensus       125 ~~~~~~~~~~~~~~~~~~~~~~~  147 (195)
                      |.+|+||.|     -|+||....
T Consensus         9 y~vV~ffvs-----LFifGFlsn   26 (36)
T CHL00024          9 YTVVIFFVS-----LFIFGFLSN   26 (36)
T ss_pred             hhHHHHHHH-----HHHccccCC
Confidence            778888876     589998754


No 16 
>PF08120 Toxin_32:  Tamulustoxin family;  InterPro: IPR012636 This family consists of the tamulustoxins, which are found in the venom of Mesobuthus tamulus (Eastern Indian scorpion) (Buthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=32.34  E-value=16  Score=24.32  Aligned_cols=12  Identities=58%  Similarity=1.124  Sum_probs=9.3

Q ss_pred             CCCCCccccccC
Q psy3389         104 RPSTYGECSVKS  115 (195)
Q Consensus       104 ~P~syg~~~~~~  115 (195)
                      .|-+||||.-|.
T Consensus        15 spgtygecvkke   26 (35)
T PF08120_consen   15 SPGTYGECVKKE   26 (35)
T ss_pred             CCCchhhhhhhc
Confidence            578999997653


No 17 
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed
Probab=29.33  E-value=2.6e+02  Score=30.14  Aligned_cols=21  Identities=14%  Similarity=0.137  Sum_probs=10.6

Q ss_pred             HHHhhhcccCCCCCCccccCCCC
Q psy3389          18 TRQIRDLSYYKADPRPIIYKADP   40 (195)
Q Consensus        18 ~RQi~~LS~~Ka~s~Ps~~KAAP   40 (195)
                      .++|  +.++...+.+....++.
T Consensus        29 W~~~--f~~~~~~~~~~~~~~~~   49 (1228)
T PRK12270         29 WREF--FADYGPGSTAAPTAAAA   49 (1228)
T ss_pred             HHHH--HhhcCCCCCCCCCCCCc
Confidence            3455  56666555554444333


No 18 
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=29.08  E-value=3.2e+02  Score=25.50  Aligned_cols=7  Identities=14%  Similarity=0.330  Sum_probs=3.3

Q ss_pred             hhhccCC
Q psy3389           6 RELKSRP   12 (195)
Q Consensus         6 ~~~~~~~   12 (195)
                      ..+|+-.
T Consensus       339 ~~lK~~~  345 (585)
T PRK14950        339 FQLRTTS  345 (585)
T ss_pred             HHHhcCC
Confidence            4455544


No 19 
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=28.41  E-value=3.9e+02  Score=26.76  Aligned_cols=6  Identities=50%  Similarity=0.578  Sum_probs=2.4

Q ss_pred             hHHHHH
Q psy3389         120 TLAEFY  125 (195)
Q Consensus       120 ~~~~~~  125 (195)
                      +|.+-+
T Consensus       511 ~lr~~W  516 (824)
T PRK07764        511 TLRERW  516 (824)
T ss_pred             HHHHHH
Confidence            444433


No 20 
>PF05104 Rib_recp_KP_reg:  Ribosome receptor lysine/proline rich region;  InterPro: IPR007794 The ribosome receptor is an integral endoplasmic reticulum protein that has been suggested to be involved in secretion. This highly conserved region is found towards the C terminus of the transmembrane domain []. The function is unclear.; GO: 0015031 protein transport, 0030176 integral to endoplasmic reticulum membrane
Probab=27.97  E-value=2e+02  Score=24.25  Aligned_cols=8  Identities=63%  Similarity=1.090  Sum_probs=3.1

Q ss_pred             CCCCCCCC
Q psy3389          73 KVDPRPST   80 (195)
Q Consensus        73 KaAP~Pst   80 (195)
                      |+.|.|+.
T Consensus       127 KvePaP~~  134 (151)
T PF05104_consen  127 KVEPAPSP  134 (151)
T ss_pred             ccCCCCcc
Confidence            33333333


No 21 
>PF14811 TPD:  Protein of unknown function TPD sequence-motif
Probab=25.52  E-value=33  Score=27.70  Aligned_cols=16  Identities=56%  Similarity=1.288  Sum_probs=12.2

Q ss_pred             ccCCCcceeeeeeehhccccCC
Q psy3389         168 LLGPGPRLVRLVSYWAFGFEGN  189 (195)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~  189 (195)
                      .+|||     +|-|| |||.-.
T Consensus       109 rfGpG-----~VIyw-~G~~~~  124 (139)
T PF14811_consen  109 RFGPG-----AVIYW-FGFIDE  124 (139)
T ss_pred             HhCCc-----eEEEe-ccchhh
Confidence            47888     78899 788644


No 22 
>KOG2154|consensus
Probab=24.60  E-value=86  Score=30.59  Aligned_cols=26  Identities=38%  Similarity=0.616  Sum_probs=21.7

Q ss_pred             hhHHHHHhhhhhhhccCchhhHHHHH
Q psy3389         119 KTLAEFYSIVTFFLSSTHHTKFLFGL  144 (195)
Q Consensus       119 ~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (195)
                      |.-|.|+-..-.||||||--..|..-
T Consensus       330 KyRarff~L~D~FLSSTHLpa~LvAs  355 (505)
T KOG2154|consen  330 KYRARFFRLADLFLSSTHLPAYLVAS  355 (505)
T ss_pred             HHHHHHHHHHHHHhhcccchHHHHHH
Confidence            67789999999999999988776533


No 23 
>KOG0898|consensus
Probab=24.07  E-value=59  Score=27.41  Aligned_cols=19  Identities=47%  Similarity=0.580  Sum_probs=14.8

Q ss_pred             hHHHHHHHHHHHHhhcccc
Q psy3389         139 KFLFGLAAARVQRRVNRGD  157 (195)
Q Consensus       139 ~~~~~~~~~~~~~~~~~~~  157 (195)
                      .-|.-|.-+|++||+|||-
T Consensus        38 ~~~~~l~~ar~rrR~~RGL   56 (152)
T KOG0898|consen   38 EQLVKLFPARQRRRLNRGL   56 (152)
T ss_pred             HHHHHHHHHHHHHHHHccc
Confidence            3455667799999999984


No 24 
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional
Probab=23.23  E-value=3.9e+02  Score=25.62  Aligned_cols=7  Identities=57%  Similarity=1.184  Sum_probs=3.3

Q ss_pred             hhHHHHH
Q psy3389         119 KTLAEFY  125 (195)
Q Consensus       119 ~~~~~~~  125 (195)
                      |.||+||
T Consensus       602 ~~~a~~f  608 (620)
T PRK14948        602 KNLADFF  608 (620)
T ss_pred             HHHHHHc
Confidence            3445554


No 25 
>KOG4491|consensus
Probab=21.44  E-value=60  Score=29.87  Aligned_cols=20  Identities=50%  Similarity=0.640  Sum_probs=17.4

Q ss_pred             HHhhhhhhhccCchhhHHHH
Q psy3389         124 FYSIVTFFLSSTHHTKFLFG  143 (195)
Q Consensus       124 ~~~~~~~~~~~~~~~~~~~~  143 (195)
                      |-|++.||+||..-|||-.+
T Consensus        85 f~sl~~fF~sss~~tkfr~~  104 (323)
T KOG4491|consen   85 FTSLLMFFLSSSKLTKFRGE  104 (323)
T ss_pred             HHHHHHHHHccchhhhHHHH
Confidence            57889999999999999755


No 26 
>PRK00404 tatB sec-independent translocase; Provisional
Probab=20.87  E-value=2e+02  Score=23.59  Aligned_cols=6  Identities=33%  Similarity=0.761  Sum_probs=2.2

Q ss_pred             hHHHHh
Q psy3389          16 NLTRQI   21 (195)
Q Consensus        16 NL~RQi   21 (195)
                      .|-+|+
T Consensus        58 elr~~l   63 (141)
T PRK00404         58 EIRRQL   63 (141)
T ss_pred             HHHHHH
Confidence            333333


Done!