Diaphorina citri psyllid: psy3403

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-

MIGGIKYVSYKSELQMPDIIKLIQKDLSEPYSIYTYRYFIHNWPKFCFLMDQLKTINIIENDTATQSIRSALNNTTLVPSNLNSESKDVEDSNCNITVICHSYDNTQSQDILYNGVTNSNHNDLGSNKLSERYESTECLEPDECVNNSQLTNNSSSYSCKNCDNGHILHDSSHFNTSQPKSLAPINNGPKKSLTKLKSLSSSQGNNDVHHKHEKKHSSESINGSTVNKKKINPETKASKEANNYSSKTCVKNKLSNVNNNNTDFCSSQETQPNQNTVQSTLVLNQTNEEVSGNIHSTPELCSTDDVSKVESSALDDTSLKVENLEIQSGEESCTDLCSPSQQVEPLTSNDIEKSKTKHFECNPCNVHFLCCTDEMIGGIKYVSYKSELQMPDIIKLIQKDLSEPYSIYTYRYFIHNWPKFCFLAMDEQKCVGAIVCKLDIHRKVIRRGYIAMLAVDENYRKRKIGSNLVLKAIRAMVADDADEVVLETEITNRPALKLYENLGFVRDKRLF

ccccEEEEEccccccHHHHHHHHHHccccccEEEEEHHHHHccccEEEEEEccccEEEEEEEEccHHcccccccccECcccccccccccccccccHEEEHHHccccccccEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHcccccccHHHHHHHHHHccccEEEEEEcccEEEEEEEEEccccccccEEEEEEEEEcHHHHcccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccCEECccc

**GGIKYVSYKSELQMPDIIKLIQKDLSEPYSIYTYRYFIHNWPKFCFLMDQLKTINIIENDTATQSIRSALNNTTLVPSNLNSESKDVEDSNCNITVICHSYDNTQSQDILYNGVTNSNHNDLGSNKLSERYE*TECLEPDECVNNSQLTNNSSSYSCKNCDNGHILHD*******************************************************************************************************************************************************************************************HFECNPCNVHFLCCTDEMIGGIKYVSYKSELQMPDIIKLIQKDLSEPYSIYTYRYFIHNWPKFCFLAMDEQKCVGAIVCKLDIHRKVIRRGYIAMLAVDENYRKRKIGSNLVLKAIRAMVADDADEVVLETEITNRPALKLYENLGFVRDKRLF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
N-alpha-acetyltransferase 30	Probable N-acetyltransferase.	confident	Q54MP9
N-alpha-acetyltransferase 30	Catalytic component of the NatC N-terminal acetyltransferase.	confident	O74311

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008080 [MF]	N-acetyltransferase activity	probable	GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X7B, chain A
Confidence level:very confident
Coverage over the Query: 378-510
View the alignment between query and template
View the model in PyMOL

Template: 2X7B, chain A
Confidence level:very confident
Coverage over the Query: 4-113
View the alignment between query and template
View the model in PyMOL