RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3445
         (121 letters)



>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended
           (e) SDRs.  SDRs are Rossmann-fold NAD(P)H-binding
           proteins, many of which may function as fatty acyl CoA
           reductases (FAR), acting on medium and long chain fatty
           acids, and have been reported to be involved in diverse
           processes such as biosynthesis of insect pheromones,
           plant cuticular wax production, and mammalian wax
           biosynthesis. In Arabidopsis thaliana, proteins with
           this particular architecture have also been identified
           as the MALE STERILITY 2 (MS2) gene product, which is
           implicated in male gametogenesis. Mutations in MS2
           inhibit the synthesis of exine (sporopollenin),
           rendering plants unable to reduce pollen wall fatty
           acids to corresponding alcohols. This N-terminal domain
           shares the catalytic triad (but not the upstream Asn)
           and characteristic NADP-binding motif of the extended
           SDR family. Extended SDRs are distinct from classical
           SDRs. In addition to the Rossmann fold (alpha/beta
           folding pattern with a central beta-sheet) core region
           typical of all SDRs, extended SDRs have a less conserved
           C-terminal extension of approximately 100 amino acids.
           Extended SDRs are a diverse collection of proteins, and
           include isomerases, epimerases, oxidoreductases, and
           lyases; they typically have a TGXXGXXG cofactor binding
           motif. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 320

 Score = 81.6 bits (202), Expect = 1e-19
 Identities = 26/48 (54%), Positives = 37/48 (77%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAI 114
           SV +TG TGF+GK+L+EKLLR+ P +  IYLL+R K G++ +ERL  +
Sbjct: 2   SVLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLREL 49


>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein.  This family
           represents the C-terminal region of the male sterility
           protein in a number of arabidopsis and drosophila. A
           sequence-related jojoba acyl CoA reductase is also
           included.
          Length = 245

 Score = 71.1 bits (175), Expect = 3e-16
 Identities = 25/48 (52%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 70  VTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFED 117
           +TG TGF+GK+L+EKLLR+ P +K IY LVR K G++  ERL      
Sbjct: 1   LTGATGFLGKVLLEKLLRSTPEVK-IYCLVRAKDGESALERLRQELLK 47


>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2.
          Length = 605

 Score = 63.7 bits (155), Expect = 5e-13
 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 52  KDEIGTPIQEFFRDASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERL 111
            D IG  I EF R  +  +TG TGF+ K+L+EK+LR  P +  IYLL++ K  +A  ERL
Sbjct: 108 ADGIG--IAEFLRGKNFLITGATGFLAKVLIEKILRTNPDVGKIYLLIKAKDKEAAIERL 165

Query: 112 E 112
           +
Sbjct: 166 K 166


>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase.
          Length = 491

 Score = 60.1 bits (146), Expect = 8e-12
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 61  EFFRDASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERL 111
           +F  + ++ VTG TGF+ KI VEK+LR  P++K +YLL+R    K+  +RL
Sbjct: 7   QFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRASDAKSATQRL 57


>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like,
           extended (e) SDRs.  This subgroup of extended SDR family
           domains have the characteristic active site tetrad and a
           well-conserved NAD(P)-binding motif. This subgroup is
           not well characterized, its members are annotated as
           having a variety of putative functions. One
           characterized member is Pseudomonas fluorescens MupV a
           protein  involved in the biosynthesis of Mupirocin, a
           polyketide-derived antibiotic. Extended SDRs are
           distinct from classical SDRs. In addition to the
           Rossmann fold (alpha/beta folding pattern with a central
           beta-sheet) core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids. Extended SDRs are a
           diverse collection of proteins, and include isomerases,
           epimerases, oxidoreductases, and lyases; they typically
           have a TGXXGXXG cofactor binding motif. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 293

 Score = 50.1 bits (120), Expect = 3e-08
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEA--IFEDRIH 120
           VFVTGGTGF+G+ LV++LL        + +LVR +      ER+E   +  DR+ 
Sbjct: 1   VFVTGGTGFLGRHLVKRLLENG---FKVLVLVRSESLGEAHERIEEAGLEADRVR 52


>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional
           non-ribosomal peptide synthetases and related enzymes
           [Secondary metabolites biosynthesis, transport, and
           catabolism].
          Length = 382

 Score = 47.4 bits (113), Expect = 3e-07
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDRIH 120
           V +TG TGF+G  L+ +LL      K +  LVR +  +A   RLE  F+   H
Sbjct: 3   VLLTGATGFLGAYLLLELLDR-SDAK-VICLVRAQSDEAALARLEKTFDLYRH 53


>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional.
          Length = 657

 Score = 44.9 bits (107), Expect = 2e-06
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 9/56 (16%)

Query: 69  FVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFE----DRIH 120
           FVTGGTGF+G+ LV +LL        +++LVR         RLEA+      DR+ 
Sbjct: 4   FVTGGTGFIGRRLVSRLLDRRREAT-VHVLVRR----QSLSRLEALAAYWGADRVV 54


>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain.  This model
           includes the terminal domain from the fungal alpha
           aminoadipate reductase enzyme (also known as
           aminoadipate semialdehyde dehydrogenase) which is
           involved in the biosynthesis of lysine , as well as the
           reductase-containing component of the myxochelin
           biosynthetic gene cluster, MxcG. The mechanism of
           reduction involves activation of the substrate by
           adenylation and transfer to a covalently-linked
           pantetheine cofactor as a thioester. This thioester is
           then reduced to give an aldehyde (thus releasing the
           product) and a regenerated pantetheine thiol. (In
           myxochelin biosynthesis this aldehyde is further reduced
           to an alcohol or converted to an amine by an
           aminotransferase.) This is a fundamentally different
           reaction than beta-ketoreductase domains of polyketide
           synthases which act at a carbonyl two carbons removed
           from the thioester and forms an alcohol as a product.
           This domain is invariably found at the C-terminus of the
           proteins which contain it (presumably because it results
           in the release of the product). The majority of hits to
           this model are non-ribosomal peptide synthetases in
           which this domain is similarly located proximal to a
           thiolation domain (pfam00550). In some cases this domain
           is found at the end of a polyketide synthetase enzyme,
           but is unlike ketoreductase domains which are found
           before the thiolase domains. Exceptions to this observed
           relationship with the thiolase domain include three
           proteins which consist of stand-alone reductase domains
           (GP|466833 from M. leprae, GP|435954 from Anabaena and
           OMNI|NTL02SC1199 from Strep. coelicolor) and one protein
           (OMNI|NTL01NS2636 from Nostoc) which contains N-terminal
           homology with a small group of hypothetical proteins but
           no evidence of a thiolation domain next to the putative
           reductase domain. Below the noise cutoff to this model
           are proteins containing more distantly related
           ketoreductase and dehydratase/epimerase domains. It has
           been suggested that a NADP-binding motif can be found in
           the N-terminal portion of this domain that may form a
           Rossman-type fold.
          Length = 367

 Score = 43.2 bits (102), Expect = 6e-06
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFED 117
           +V +TG TGF+G  L+E+LLR     K +  LVR    +   ERL      
Sbjct: 1   TVLLTGATGFLGAYLLEELLRRSTQAK-VICLVRAASEEHAMERLREALRS 50


>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1.  This family
           consists of an SDR module of multidomain proteins
           identified as putative polyketide sythases fatty acid
           synthases (FAS), and nonribosomal peptide synthases,
           among others. However, unlike the usual ketoreductase
           modules of FAS and polyketide synthase, these domains
           are related to the extended SDRs, and have canonical
           NAD(P)-binding motifs and an active site tetrad.
           Extended SDRs are distinct from classical SDRs. In
           addition to the Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet) core region typical
           of all SDRs, extended SDRs have a less conserved
           C-terminal extension of approximately 100 amino acids.
           Extended SDRs are a diverse collection of proteins, and
           include isomerases, epimerases, oxidoreductases, and
           lyases; they typically have a TGXXGXXG cofactor binding
           motif. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 290

 Score = 42.3 bits (100), Expect = 1e-05
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLE 112
           +V +TG TGF+G  L+ +LL+   ++  IY LVR K  +A  ERL 
Sbjct: 1   TVLLTGATGFLGAYLLRELLKR-KNVSKIYCLVRAKDEEAALERLI 45


>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase. 
            Members of this protein family are
            L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31),
            product of the LYS2 gene. It is also called
            alpha-aminoadipate reductase. In fungi, lysine is
            synthesized via aminoadipate. Currently, all members of
            this family are fungal.
          Length = 1389

 Score = 42.0 bits (99), Expect = 2e-05
 Identities = 30/95 (31%), Positives = 42/95 (44%), Gaps = 15/95 (15%)

Query: 21   EITEDIVNSKYYKDPLQLLGEKNFGRPRKIPKDE---IGTPIQEFFRDASVFVTGGTGFM 77
            E  E ++   Y KD   L+       P+  P  +     TPI       +VF+TG TGF+
Sbjct: 935  EEEETVLELDYAKDAKTLVDS----LPKSYPSRKELDASTPI-------TVFLTGATGFL 983

Query: 78   GK-ILVEKLLRAIPHLKHIYLLVRPKKGKAVQERL 111
            G  IL + L R       ++  VR K  +A  ERL
Sbjct: 984  GSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERL 1018



 Score = 32.3 bits (74), Expect = 0.042
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 53  DEIGTPIQ--EFFRDASVFVTGGTGFMGKILVEKLLRAIPHLKH 94
           D+IGTP +  E+       VT  T  MG++L  +    IP L H
Sbjct: 490 DDIGTPGRLAEWMAKYGATVTHLTPAMGQLLSAQATTPIPSLHH 533


>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde
           reductase and flavonoid reductase related proteins,
           extended (e) SDRs.  This subgroup contains proteins of
           unknown function related to aldehyde reductase and
           flavonoid reductase of the extended SDR-type. Aldehyde
           reductase I (aka carbonyl reductase) is an NADP-binding
           SDR; it has an NADP-binding motif consensus that is
           slightly different from the canonical SDR form and lacks
           the Asn of the extended SDR active site tetrad. Aldehyde
           reductase I catalyzes the NADP-dependent  reduction of
           ethyl 4-chloro-3-oxobutanoate to ethyl
           (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
           reductases act in the NADP-dependent reduction of
           flavonoids, ketone-containing plant secondary
           metabolites. Extended SDRs are distinct from classical
           SDRs. In addition to the Rossmann fold (alpha/beta
           folding pattern with a central beta-sheet) core region
           typical of all SDRs, extended SDRs have a less conserved
           C-terminal extension of approximately 100 amino acids.
           Extended SDRs are a diverse collection of proteins, and
           include isomerases, epimerases, oxidoreductases, and
           lyases; they typically have a TGXXGXXG cofactor binding
           motif. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 318

 Score = 36.1 bits (84), Expect = 0.002
 Identities = 14/53 (26%), Positives = 19/53 (35%), Gaps = 9/53 (16%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDRIH 120
           + VTG TGF+G  LV  LL        +  LVR             +    + 
Sbjct: 1   ILVTGATGFLGSNLVRALLAQ---GYRVRALVRS------GSDAVLLDGLPVE 44


>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs.  Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 200

 Score = 35.7 bits (83), Expect = 0.002
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          + VTGG GF+G  LV +LL  
Sbjct: 1  ILVTGGAGFIGSHLVRRLLER 21


>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5.  This subgroup
           contains atypical SDRs, some of which are identified as
           putative NAD(P)-dependent epimerases, one as a putative
           NAD-dependent epimerase/dehydratase. Atypical SDRs are
           distinct from classical SDRs. Members of this subgroup
           have a glycine-rich NAD(P)-binding motif that is very
           similar to the extended SDRs, GXXGXXG, and binds NADP.
           Generally, this subgroup has poor conservation of the
           active site tetrad; however, individual sequences do
           contain matches to the YXXXK active site motif, the
           upstream Ser, and there is a highly conserved Asp in
           place of the usual active site Asn throughout the
           subgroup. Atypical SDRs generally lack the catalytic
           residues characteristic of the SDRs, and their
           glycine-rich NAD(P)-binding motif is often different
           from the forms normally seen in classical or extended
           SDRs. Atypical SDRs include biliverdin IX beta reductase
           (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 203

 Score = 34.9 bits (81), Expect = 0.004
 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 3/47 (6%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEA 113
            V V G TG +G+ +V +LL        +  LVR        E   A
Sbjct: 1   KVLVVGATGKVGRHVVRELLD---RGYQVRALVRDPSQAEKLEAAGA 44


>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7.  This subgroup
          contains atypical SDRs of unknown function. Members of
          this subgroup have a glycine-rich NAD(P)-binding motif
          consensus that matches the extended SDRs, TGXXGXXG, but
          lacks the characteristic active site residues of the
          SDRs. This subgroup has basic residues (HXXXR) in place
          of the active site motif YXXXK, these may have a
          catalytic role. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 291

 Score = 35.0 bits (81), Expect = 0.004
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          VFVTG TGF+G  +V +L+ A
Sbjct: 3  VFVTGATGFIGSAVVRELVAA 23


>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases
           [Cell envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 588

 Score = 34.6 bits (80), Expect = 0.006
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 45  GRPRKIPKDEIGTPIQEFFRDASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLL 98
           GRP      E    I       +V VTGG G +G  L  ++L+  P  K I L 
Sbjct: 233 GRPPVALDTE---LIGAMLTGKTVLVTGGGGSIGSELCRQILKFNP--KEIILF 281


>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase.  The
           sequences in this family are members of the pfam01370
           superfamily of NAD-dependent epimerases and dehydratases
           typically acting on nucleotide-sugar substrates. The
           genes of the family modeled here are generally in the
           same locus with genes involved in the biosynthesis and
           elaboration of hopene, the cyclization product of the
           polyisoprenoid squalene. This gene and its association
           with hopene biosynthesis in Zymomonas mobilis has been
           noted in the literature where the gene symbol hpnA was
           assigned. Hopanoids are known to be components of the
           plasma membrane and to have polar sugar head groups in
           Z. mobilis and other species.
          Length = 328

 Score = 33.4 bits (77), Expect = 0.016
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRP 101
           V VTG TGF+G  +V  LL     ++   +LVRP
Sbjct: 3   VLVTGATGFVGSAVVRLLLEQGEEVR---VLVRP 33


>gnl|CDD|233570 TIGR01777, yfcH, TIGR01777 family protein.  This model represents a
           clade of proteins of unknown function including the E.
           coli yfcH protein [Hypothetical proteins, Conserved].
          Length = 291

 Score = 33.0 bits (76), Expect = 0.023
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKA 106
           + +TGGTGF+G+ L ++L +   H   + +L R     A
Sbjct: 1   ILITGGTGFIGRALTQRLTKR-GH--EVTILTRSPPPGA 36


>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell
          envelope biogenesis, outer membrane / Carbohydrate
          transport and metabolism].
          Length = 314

 Score = 33.0 bits (75), Expect = 0.025
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          + VTGG GF+G  LVE+LL A
Sbjct: 3  ILVTGGAGFIGSHLVERLLAA 23


>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1.  Atypical SDRs in
           this subgroup are poorly defined and have been
           identified putatively as isoflavones reductase, sugar
           dehydratase, mRNA binding protein etc. Atypical SDRs are
           distinct from classical SDRs. Members of this subgroup
           retain the canonical active site triad (though not the
           upstream Asn found in most SDRs) but have an unusual
           putative glycine-rich NAD(P)-binding motif, GGXXXXG, in
           the usual location. Atypical SDRs generally lack the
           catalytic residues characteristic of the SDRs, and their
           glycine-rich NAD(P)-binding motif is often different
           from the forms normally seen in classical or extended
           SDRs. Atypical SDRs include biliverdin IX beta reductase
           (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 250

 Score = 32.6 bits (75), Expect = 0.029
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDR 118
            + + GGT F+GK LVE+LL A  H   + +  R +    + E +E I  DR
Sbjct: 2   KILIIGGTRFIGKALVEELLAA-GH--DVTVFNRGRTKPDLPEGVEHIVGDR 50


>gnl|CDD|215072 PLN00141, PLN00141, Tic62-NAD(P)-related group II protein;
          Provisional.
          Length = 251

 Score = 32.5 bits (74), Expect = 0.031
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 49 KIPKDEIGTPIQEFFRDASVFVTGGTGFMGKILVEKLL 86
           +   E      E  +  +VFV G TG  GK +VE+LL
Sbjct: 1  TMEGAEASEEDAENVKTKTVFVAGATGRTGKRIVEQLL 38


>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs.  Extended or
           atypical short-chain dehydrogenases/reductases (SDRs,
           aka tyrosine-dependent oxidoreductases) are distinct
           from classical SDRs. In addition to the Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet)
           core region typical of all SDRs, extended SDRs have a
           less conserved C-terminal extension of approximately 100
           amino acids. Extended SDRs are a diverse collection of
           proteins, and include isomerases, epimerases,
           oxidoreductases, and lyases; they typically have a
           TGXXGXXG cofactor binding motif. Atypical SDRs generally
           lack the catalytic residues characteristic of the SDRs,
           and their glycine-rich NAD(P)-binding motif is often
           different from the forms normally seen in classical or
           extended SDRs. Atypical SDRs include biliverdin IX beta
           reductase (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Complex
           (multidomain) SDRs such as ketoreductase domains of
           fatty acid synthase have a GGXGXXG NAD(P)-binding motif
           and an altered active site motif (YXXXN). Fungal type
           ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
           motif.
          Length = 176

 Score = 32.0 bits (73), Expect = 0.036
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKH-IYLLVR--PKKGKAVQERLEAIFED 117
           + + G TGF+G+ L  +LL       H + LLVR   +  K  QE +  +  D
Sbjct: 1   ILILGATGFIGRALARELLEQ----GHEVTLLVRNTKRLSKEDQEPVAVVEGD 49


>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases
          (3b-HSD)-like, extended (e) SDRs.  Extended SDR family
          domains belonging to this subgroup have the
          characteristic active site tetrad and a fairly
          well-conserved NAD(P)-binding motif. 3b-HSD catalyzes
          the NAD-dependent conversion of various steroids, such
          as pregnenolone to progesterone, or androstenediol to
          testosterone. This subgroup includes an unusual
          bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis
          thaliana, and Saccharomyces cerevisiae ERG26, a
          3b-HSD/C-4 decarboxylase, involved in the synthesis of
          ergosterol, the major sterol of yeast. It also includes
          human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7].  C(27) 3beta-HSD/HSD3B7 is a membrane-bound
          enzyme of the endoplasmic reticulum, that catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human NSDHL (NAD(P)H
          steroid dehydrogenase-like protein) cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 331

 Score = 32.0 bits (73), Expect = 0.043
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 67 SVFVTGGTGFMGKILVEKLLR 87
          SV VTGG+GF G+ LV++LL 
Sbjct: 1  SVLVTGGSGFFGERLVKQLLE 21


>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid
          dehydrogenase) and HSD3B1(delta 5-delta
          4-isomerase)-like, extended (e) SDRs.  This
          extended-SDR subgroup includes human 3 beta-HSD/HSD3B1
          and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7], and related proteins. These proteins have the
          characteristic active site tetrad and NAD(P)-binding
          motif of extended SDRs. 3 beta-HSD catalyzes the
          oxidative conversion of delta 5-3 beta-hydroxysteroids
          to the delta 4-3-keto configuration; this activity is
          essential for the biosynthesis of all classes of
          hormonal steroids. C(27) 3beta-HSD is a membrane-bound
          enzyme of the endoplasmic reticulum, it catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 354

 Score = 32.1 bits (73), Expect = 0.045
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 67 SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLL 98
             VTGG GF+G+ ++  LL     LK I +L
Sbjct: 1  VCLVTGGGGFLGQHIIRLLLERKEELKEIRVL 32


>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family.
           This family of proteins utilise NAD as a cofactor. The
          proteins in this family use nucleotide-sugar substrates
          for a variety of chemical reactions.
          Length = 233

 Score = 31.9 bits (73), Expect = 0.050
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          + VTGGTGF+G  LV +LL+ 
Sbjct: 1  ILVTGGTGFIGSHLVRRLLQE 21


>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs.  This
          subgroup contains aldehyde reductase of the extended
          SDR-type and related proteins. Aldehyde reductase I
          (aka carbonyl reductase) is an NADP-binding SDR; it has
          an NADP-binding motif consensus that is slightly
          different from the canonical SDR form and lacks the Asn
          of the extended SDR active site tetrad. Aldehyde
          reductase I catalyzes the NADP-dependent  reduction of
          ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 301

 Score = 31.9 bits (73), Expect = 0.051
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          V VTG TGF+   +VE+LL+A
Sbjct: 2  VLVTGATGFIASHIVEQLLKA 22


>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs.
          This subgroup contains FRs of the extended SDR-type and
          related proteins. These FRs act in the NADP-dependent
          reduction of  flavonoids, ketone-containing plant
          secondary metabolites; they have the characteristic
          active site triad of the SDRs (though not the upstream
          active site Asn) and a NADP-binding motif that is very
          similar to the typical extended SDR motif. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 293

 Score = 31.8 bits (73), Expect = 0.058
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 68 VFVTGGTGFMGKILVEKLLR 87
          V VTG +GF+G  LV++LL+
Sbjct: 1  VCVTGASGFIGSWLVKRLLQ 20


>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          archaeal and bacterial proteins, and has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 31.9 bits (73), Expect = 0.061
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 68 VFVTGGTGFMGKILVEKLLR 87
          + VTGG GF+G  LV++LL 
Sbjct: 2  ILVTGGAGFIGSHLVDRLLE 21


>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid
          dehydrogenase-like protein)-like, extended (e) SDRs.
          This subgroup includes human NSDHL and related
          proteins. These proteins have the characteristic active
          site tetrad of extended SDRs, and also have a close
          match to their  NAD(P)-binding motif.  Human NSDHL is a
          3beta-hydroxysteroid dehydrogenase (3 beta-HSD) which
          functions in the cholesterol biosynthetic pathway.  3
          beta-HSD catalyzes the oxidative conversion of delta
          5-3 beta-hydroxysteroids to the delta 4-3-keto
          configuration; this activity is essential for the
          biosynthesis of all classes of hormonal steroids.
          Mutations in the gene encoding NSDHL cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait.  This subgroup also includes an
          unusual bifunctional [3beta-hydroxysteroid
          dehydrogenase (3b-HSD)/C-4 decarboxylase from
          Arabidopsis thaliana, and Saccharomyces cerevisiae
          ERG26, a 3b-HSD/C-4 decarboxylase, involved in the
          synthesis of ergosterol, the major sterol of yeast.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 335

 Score = 31.6 bits (72), Expect = 0.070
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 67 SVFVTGGTGFMGKILVEKLLR 87
          S  V GG+GF+G+ LVE+LLR
Sbjct: 1  SCLVVGGSGFLGRHLVEQLLR 21


>gnl|CDD|224015 COG1090, COG1090, Predicted nucleoside-diphosphate sugar epimerase
           [General function prediction only].
          Length = 297

 Score = 31.5 bits (72), Expect = 0.071
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR 100
           + +TGGTG +G+ L  +L +   H   + +L R
Sbjct: 1   ILITGGTGLIGRALTARLRKG-GH--QVTILTR 30


>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase,
          extended (e) SDRs.  This subgroup contains
          UDP-N-acetylglucosamine 4-epimerase of Pseudomonas
          aeruginosa, WbpP,  an extended SDR, that catalyzes the
          NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to
          UDP-Glc and UDP-Gal.  This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 304

 Score = 31.4 bits (72), Expect = 0.086
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query: 68 VFVTGGTGFMGKILVEKLLR 87
          V VTGG GF+G  LVE+LL 
Sbjct: 2  VLVTGGAGFIGSHLVERLLE 21


>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase,
          LLPSF_EDH_00030 family.  This clade within the NAD
          dependent epimerase/dehydratase superfamily (pfam01370)
          is characterized by inclusion of its members within a
          cassette of seven distinctive enzymes. These include
          four genes homologous to the elements of the neuraminic
          (sialic) acid biosynthesis cluster (NeuABCD), an
          aminotransferase and a nucleotidyltransferase in
          addition to the epimerase/dehydratase. Together it is
          very likely that these enzymes direct the biosynthesis
          of a nine-carbon sugar analagous to CMP-neuraminic
          acid. These seven genes form the core of the cassette,
          although they are often accompanied by additional genes
          that may further modify the product sugar. Although
          this cassette is widely distributed in bacteria, the
          family nomenclature arises from the instance in
          Leptospira interrogans serovar Lai, str. 56601, where
          it appears as the 30th gene in the 91-gene
          lipopolysaccharide biosynthesis cluster.
          Length = 297

 Score = 31.1 bits (71), Expect = 0.11
 Identities = 12/21 (57%), Positives = 14/21 (66%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          V VTG  GF+G  LVE L+R 
Sbjct: 1  VLVTGADGFIGSHLVEALVRQ 21


>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7.  These proteins are
           members of the classical SDR family, with a canonical
           active site triad (and also an active site Asn) and a
           typical Gly-rich NAD-binding motif. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRS are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes have a
           3-glycine N-terminal NAD(P)(H)-binding pattern
           (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
           extended SDRs), while substrate binding is in the
           C-terminal region. A critical catalytic Tyr residue
           (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
           (15-PGDH) numbering), is often found in a conserved
           YXXXK pattern. In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) or additional
           Ser, contributing to the active site. Substrates for
           these enzymes include sugars, steroids, alcohols, and
           aromatic compounds. The standard reaction mechanism is a
           proton relay involving the conserved Tyr and Lys, as
           well as Asn (or Ser). Some SDR family members, including
           17 beta-hydroxysteroid dehydrogenase contain an
           additional helix-turn-helix motif that is not generally
           found among SDRs.
          Length = 235

 Score = 30.8 bits (70), Expect = 0.11
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 5/59 (8%)

Query: 63  FRDASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDRIHT 121
            +D +V VTG    +GK  VE LL      K +Y  VR     A    L A + D++  
Sbjct: 1   IKDKTVLVTGANRGIGKAFVESLLAH--GAKKVYAAVRDPGSAA---HLVAKYGDKVVP 54


>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase.  This family
           contains a wide variety of dehydrogenases.
          Length = 167

 Score = 30.6 bits (70), Expect = 0.13
 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAI 114
           +V +TGGTG +G  L   L       +H+ L+ R        E +  +
Sbjct: 2   TVLITGGTGGLGLALARWLAAEGA--RHLVLVSRRGPAPGAAELVAEL 47


>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl
           reductase (PTCR)-like, classical (c) SDRs.  PTCR is a
           classical SDR which catalyzes the NADPH-dependent
           reduction of ketones on steroids and prostaglandins.
           Unlike most SDRs, PTCR functions as a monomer. This
           subgroup also includes human carbonyl reductase 1 (CBR1)
           and CBR3. CBR1 is an NADPH-dependent SDR with broad
           substrate specificity and may be responsible for the in
           vivo reduction of quinones, prostaglandins, and other
           carbonyl-containing compounds. In addition it includes
           poppy NADPH-dependent salutaridine reductase which
           catalyzes the stereospecific reduction of salutaridine
           to 7(S)-salutaridinol in the biosynthesis of morphine,
           and Arabidopsis SDR1,a menthone reductase, which
           catalyzes the reduction of menthone to neomenthol, a
           compound with antimicrobial activity; SDR1  can also
           carry out neomenthol oxidation. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, 15-hydroxyprostaglandin dehydrogenase
           (15-PGDH) numbering). In addition to the Tyr and Lys,
           there is often an upstream Ser (Ser-138, 15-PGDH
           numbering) and/or an Asn (Asn-107, 15-PGDH numbering)
           contributing to the active site; while substrate binding
           is in the C-terminal region, which determines
           specificity. The standard reaction mechanism is a
           4-pro-S hydride transfer and proton relay involving the
           conserved Tyr and Lys, a water molecule stabilized by
           Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
           Some atypical SDRs have lost catalytic activity and/or
           have an unusual NAD(P)-binding motif and missing or
           unusual active site residues. Reactions catalyzed within
           the SDR family include isomerization, decarboxylation,
           epimerization, C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 225

 Score = 30.7 bits (70), Expect = 0.14
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR-PKKGKAVQERLEA 113
             VTG    +G  +V +L ++ P    + L  R  ++G+A  E+L A
Sbjct: 3   ALVTGANRGIGFEIVRQLAKSGPG--TVILTARDVERGQAAVEKLRA 47


>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase.  This
          enzyme catalyzes the first step in the biosynthesis of
          pseudaminic acid, the conversion of
          UDP-N-acetylglucosamine to
          UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences
          are members of the broader pfam01073 (3-beta
          hydroxysteroid dehydrogenase/isomerase family) family.
          Length = 324

 Score = 30.8 bits (70), Expect = 0.14
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 62 FFRDASVFVTGGTGFMGKILVEKLL 86
           F + S+ +TGGTG  GK  + +LL
Sbjct: 1  MFNNKSILITGGTGSFGKAFISRLL 25


>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked
          N-acetylglucosamine) inverting 4,6-dehydratase,
          extended (e) SDRs.  UDP-Glcnac inverting
          4,6-dehydratase was identified in Helicobacter pylori
          as the hexameric flaA1 gene product (FlaA1). FlaA1 is
          hexameric, possesses UDP-GlcNAc-inverting
          4,6-dehydratase activity,  and catalyzes the first step
          in the creation of a pseudaminic acid derivative in
          protein glycosylation. Although this subgroup has the
          NADP-binding motif characteristic of extended SDRs, its
          members tend to have a Met substituted for the active
          site Tyr found in most SDR families. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 287

 Score = 30.7 bits (70), Expect = 0.15
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 65 DASVFVTGGTGFMGKILVEKLLRAIPHLKHIY 96
            ++ VTGG G +G  LV ++L+  P    ++
Sbjct: 2  GKTILVTGGAGSIGSELVRQILKFGPKKLIVF 33


>gnl|CDD|187553 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8.  This subgroup
           contains atypical SDRs of unknown function. Proteins in
           this subgroup have a glycine-rich NAD(P)-binding motif
           consensus that resembles that of the extended SDRs,
           (GXXGXXG or GGXGXXG), but lacks the characteristic
           active site residues of the SDRs. A Cys often replaces
           the usual Lys of the YXXXK active site motif, while the
           upstream Ser is generally present and Arg replaces the
           usual Asn. Atypical SDRs generally lack the catalytic
           residues characteristic of the SDRs, and their
           glycine-rich NAD(P)-binding motif is often different
           from the forms normally seen in classical or extended
           SDRs. Atypical SDRs include biliverdin IX beta reductase
           (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 296

 Score = 30.7 bits (70), Expect = 0.15
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR-PKKGKAVQERLE 112
           + +TGGTGF+G+ L  + L A  H   + +L R P K + + E + 
Sbjct: 2   IVITGGTGFIGRALT-RRLTAAGH--EVVVLSRRPGKAEGLAEVIT 44


>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1
          alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like,
          atypical (a) SDRs.  This subgroup of extended SDR-like
          proteins are atypical SDRs. They have a glycine-rich
          NAD(P)-binding motif similar to the typical SDRs,
          GXXGXXG, and have the YXXXK active site motif (though
          not the other residues of the SDR tetrad). Members
          identified include NDUFA9 (mitochondrial) and putative
          nucleoside-diphosphate-sugar epimerase. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 273

 Score = 30.7 bits (70), Expect = 0.15
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          V V G TGF+G+ +V +L + 
Sbjct: 3  VTVFGATGFIGRYVVNRLAKR 23


>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and
          related proteins, extended (e) SDRs.  UGD catalyzes the
          formation of UDP-xylose from UDP-glucuronate; it is an
          extended-SDR, and has the characteristic glycine-rich
          NAD-binding pattern, TGXXGXXG, and active site tetrad. 
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 305

 Score = 30.7 bits (70), Expect = 0.15
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          + +TGG GF+G  L ++LL  
Sbjct: 3  ILITGGAGFLGSHLCDRLLED 23


>gnl|CDD|219957 pfam08659, KR, KR domain.  This enzymatic domain is part of
           bacterial polyketide synthases and catalyzes the first
           step in the reductive modification of the beta-carbonyl
           centres in the growing polyketide chain. It uses NADPH
           to reduce the keto group to a hydroxy group.
          Length = 181

 Score = 30.2 bits (69), Expect = 0.19
 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 3/50 (6%)

Query: 66  ASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR-PKKGKAVQERLEAI 114
            +  VTGG G +G  L   L       +H+ LL R        +  L  +
Sbjct: 1   GTYLVTGGLGGLGLELARWLAER--GARHLVLLSRSGAPDPEAEALLAEL 48


>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains CDP-D-glucose
          4,6-dehydratase, an extended SDR, which catalyzes the
          conversion of CDP-D-glucose to
          CDP-4-keto-6-deoxy-D-glucose. This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 336

 Score = 30.4 bits (69), Expect = 0.19
 Identities = 11/25 (44%), Positives = 13/25 (52%)

Query: 62 FFRDASVFVTGGTGFMGKILVEKLL 86
          F++   V VTG TGF G  L   L 
Sbjct: 1  FWQGKRVLVTGHTGFKGSWLSLWLQ 25


>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases
           [Cell envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 275

 Score = 30.3 bits (68), Expect = 0.20
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 3/33 (9%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR 100
           + VTG TGF+G  +V +LL        +   VR
Sbjct: 3   ILVTGATGFVGGAVVRELLARG---HEVRAAVR 32


>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl
           reductase.
          Length = 390

 Score = 30.1 bits (68), Expect = 0.23
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 65  DASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKG 104
           D +V V G TG++GK +V +L+R      ++  + R K G
Sbjct: 60  DVTVLVVGATGYIGKFVVRELVR---RGYNVVAVAREKSG 96


>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c)
           SDR.  This subgroup includes Anabaena sp. strain PCC
           7120 HetN, a putative oxidoreductase involved in
           heterocyst differentiation, and related proteins.  SDRs
           are a functionally diverse family of oxidoreductases
           that have a single domain with a structurally conserved
           Rossmann fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRs are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes catalyze a
           wide range of activities including the metabolism of
           steroids, cofactors, carbohydrates, lipids, aromatic
           compounds, and amino acids, and act in redox sensing.
           Classical SDRs have an TGXXX[AG]XG cofactor binding
           motif and a YXXXK active site motif, with the Tyr
           residue of the active site motif serving as a critical
           catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 223

 Score = 30.0 bits (68), Expect = 0.23
 Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 7/55 (12%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRP----KKGKAVQERLEAIFEDR 118
             VTG +  +G  +   L R       + L +R         A    +EA+  D 
Sbjct: 3   ALVTGASRGIGIEIARALAR---DGYRVSLGLRNPEDLAALSASGGDVEAVPYDA 54


>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase,
           and related proteins, extended (e) SDRs.  This subgroup
           contains aldehyde reductase and flavonoid reductase of
           the extended SDR-type and related proteins. Proteins in
           this subgroup have a complete SDR-type active site
           tetrad and a close match to the canonical extended SDR
           NADP-binding motif. Aldehyde reductase I (aka carbonyl
           reductase) is an NADP-binding SDR; it catalyzes  the
           NADP-dependent  reduction of ethyl
           4-chloro-3-oxobutanoate to ethyl
           (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
           reductases act in the NADP-dependent reduction of
           flavonoids, ketone-containing plant secondary
           metabolites. Extended SDRs are distinct from classical
           SDRs. In addition to the Rossmann fold (alpha/beta
           folding pattern with a central beta-sheet) core region
           typical of all SDRs, extended SDRs have a less conserved
           C-terminal extension of approximately 100 amino acids.
           Extended SDRs are a diverse collection of proteins, and
           include isomerases, epimerases, oxidoreductases, and
           lyases; they typically have a TGXXGXXG cofactor binding
           motif. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 295

 Score = 29.9 bits (67), Expect = 0.24
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRP 101
           V VTG +GF+   +VE+LL        +   VR 
Sbjct: 1   VLVTGASGFVASHVVEQLLE---RGYKVRATVRD 31


>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated.
          Length = 238

 Score = 29.9 bits (68), Expect = 0.28
 Identities = 9/22 (40%), Positives = 12/22 (54%)

Query: 65 DASVFVTGGTGFMGKILVEKLL 86
             V VTG    +G+  VE+LL
Sbjct: 6  GKVVLVTGANRGIGRAFVEQLL 27


>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase.
          Length = 367

 Score = 29.7 bits (67), Expect = 0.30
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 65 DASVFVTGGTGFMGKILVEKLLR 87
             V VTGG  F+G  +V++LLR
Sbjct: 53 ARLVCVTGGVSFLGLAIVDRLLR 75


>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e)
          SDRs.  Decarboxylase domain of ArnA. ArnA, is an enzyme
          involved in the modification of outer membrane protein
          lipid A of gram-negative bacteria. It is a bifunctional
          enzyme that catalyzes the NAD-dependent decarboxylation
          of UDP-glucuronic acid and
          N-10-formyltetrahydrofolate-dependent formylation of
          UDP-4-amino-4-deoxy-l-arabinose; its NAD-dependent
          decaboxylating activity is in the C-terminal 360
          residues. This subgroup belongs to the extended SDR
          family, however the NAD binding motif is not a perfect
          match and the upstream Asn of the canonical active site
          tetrad is not conserved. Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 316

 Score = 29.6 bits (67), Expect = 0.31
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 67 SVFVTGGTGFMGKILVEKLLR 87
          +V VTG  GF+G  L E+LLR
Sbjct: 1  NVLVTGADGFIGSHLTERLLR 21


>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase.  Members
          of this protein family are CDP-glucose 4,6-dehydratase
          from a variety of Gram-negative and Gram-positive
          bacteria. Members typically are encoded next to a gene
          that encodes a glucose-1-phosphate
          cytidylyltransferase, which produces the substrate,
          CDP-D-glucose, used by this enzyme to produce
          CDP-4-keto-6-deoxyglucose [Cell envelope, Biosynthesis
          and degradation of surface polysaccharides and
          lipopolysaccharides].
          Length = 349

 Score = 29.6 bits (67), Expect = 0.33
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 62 FFRDASVFVTGGTGFMGKILV 82
          F++   V VTG TGF G  L 
Sbjct: 1  FWQGKKVLVTGHTGFKGSWLS 21


>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase
           (PCBER) like, atypical (a) SDRs.  PCBER and
           pinoresinol-lariciresinol reductases are NADPH-dependent
           aromatic alcohol reductases, and are atypical members of
           the SDR family. Other proteins in this subgroup are
           identified as eugenol synthase. These proteins contain
           an N-terminus characteristic of NAD(P)-binding proteins
           and a small C-terminal domain presumed to be involved in
           substrate binding, but they do not have the conserved
           active site Tyr residue typically found in SDRs.
           Numerous other members have unknown functions. The
           glycine rich NADP-binding motif in this subgroup is of 2
           forms: GXGXXG and G[GA]XGXXG; it tends to be atypical
           compared with the forms generally seen in classical or
           extended SDRs. The usual SDR active site tetrad is not
           present, but a critical active site Lys at the usual SDR
           position has been identified in various members, though
           other charged and polar residues are found at this
           position in this subgroup. Atypical SDR-related proteins
           retain the Rossmann fold of the SDRs, but have limited
           sequence identity and generally lack the catalytic
           properties of the archetypical members. Atypical SDRs
           include biliverdin IX beta reductase (BVR-B,aka flavin
           reductase), NMRa (a negative transcriptional regulator
           of various fungi), progesterone 5-beta-reductase like
           proteins, phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 282

 Score = 29.6 bits (67), Expect = 0.36
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 2/37 (5%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKK 103
            + + G TG +G  +V  LL +      + +L RP  
Sbjct: 1   KIAIAGATGTLGGPIVSALLASPGF--TVTVLTRPSS 35


>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family.  NmrA is a negative
           transcriptional regulator involved in the
           post-translational modification of the transcription
           factor AreA. NmrA is part of a system controlling
           nitrogen metabolite repression in fungi. This family
           only contains a few sequences as iteration results in
           significant matches to other Rossmann fold families.
          Length = 232

 Score = 29.2 bits (66), Expect = 0.45
 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 3/42 (7%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQE 109
           + V G TG+ G  +V   L+A  H   +  LVR  K +  + 
Sbjct: 1   ILVFGATGYQGGSVVRASLKA-GH--PVRALVRDPKSELAKS 39


>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins,
           NMRa-like, atypical (a) SDRs.  TMR is an atypical
           NADP-binding protein of the SDR family. It lacks the
           active site residues of the SDRs but has a glycine rich
           NAD(P)-binding motif that matches the extended SDRs.
           Proteins in this subgroup however, are more similar in
           length to the classical SDRs. TMR was identified as a
           reducer of triphenylmethane dyes, important
           environmental pollutants. This subgroup also includes
           Escherichia coli NADPH-dependent quinine oxidoreductase
           (QOR2), which catalyzes two-electron reduction of
           quinone; but is unlikely to play a major role in
           protecting against quinone cytotoxicity. Atypical SDRs
           are distinct from classical SDRs. Atypical SDRs include
           biliverdin IX beta reductase (BVR-B,aka flavin
           reductase), NMRa (a negative transcriptional regulator
           of various fungi), progesterone 5-beta-reductase like
           proteins, phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 272

 Score = 29.2 bits (66), Expect = 0.50
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 70  VTGGTGFMGKILVEKLLRAIPHLKHIYLLVR-PKKGKAVQER 110
           VTG TG +G  +VE LL     +  +  LVR P+K KA    
Sbjct: 3   VTGATGKLGTAVVELLLA---KVASVVALVRNPEKAKAFAAD 41


>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs. 
          GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase)
          acts in the NADP-dependent synthesis of GDP-fucose from
          GDP-mannose. Two activities have been proposed for the
          same active site: epimerization and reduction. Proteins
          in this subgroup are extended SDRs, which have a
          characteristic active site tetrad and an NADP-binding
          motif, [AT]GXXGXXG, that is a close match to the
          archetypical form. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 28.7 bits (65), Expect = 0.65
 Identities = 8/20 (40%), Positives = 11/20 (55%)

Query: 68 VFVTGGTGFMGKILVEKLLR 87
          + VTG  G +G  +V  L R
Sbjct: 2  ILVTGHRGLVGSAIVRVLAR 21


>gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase.  This
          model describes D-Ala--D-Ala ligase, an enzyme that
          makes a required precursor of the bacterial cell wall.
          It also describes some closely related proteins
          responsible for resistance to glycopeptide antibiotics
          such as vancomycin. The mechanism of glyopeptide
          antibiotic resistance involves the production of
          D-alanine-D-lactate (VanA and VanB families) or
          D-alanine-D-serine (VanC). The seed alignment contains
          only chromosomally encoded D-ala--D-ala ligases, but a
          number of antibiotic resistance proteins score above
          the trusted cutoff of this model [Cell envelope,
          Biosynthesis and degradation of murein sacculus and
          peptidoglycan].
          Length = 315

 Score = 28.8 bits (65), Expect = 0.68
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 7  KKALSSTKYKVKPLEITEDIVNSKYYKDPLQLL 39
           KAL    Y V P++I +  + S  YKD  QL+
Sbjct: 24 LKALRDLGYDVYPVDIDK--MGSWTYKDLPQLI 54


>gnl|CDD|187659 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of
           fatty acid synthase (FAS), subgroup 3, complex (x).
           Ketoreductase, a module of the multidomain polyketide
           synthase (PKS), has 2 subdomains, each corresponding  to
           a SDR family monomer. The C-terminal subdomain catalyzes
           the NADPH-dependent reduction of the beta-carbonyl of a
           polyketide to a hydroxyl group, a step in the
           biosynthesis of polyketides, such as erythromycin. The
           N-terminal subdomain, an interdomain linker, is a
           truncated Rossmann fold which acts to stabilizes the
           catalytic subdomain. Unlike typical SDRs, the isolated
           domain does not oligomerize but is composed of 2
           subdomains, each resembling an SDR monomer. The active
           site resembles that of typical SDRs, except that the
           usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. In some instances, such as
           porcine FAS, an enoyl reductase (ER) module is inserted
           between the sub-domains. Fatty acid synthesis occurs via
           the stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consists of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthesis
           uses a dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles, ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-KR, forming beta-hydroxyacyl-ACP, which is in turn
           dehydrated by dehydratase to a beta-enoyl intermediate,
           which is reduced by NADP-dependent beta- ER. Polyketide
           synthesis also proceeds via the addition of 2-carbon
           units as in fatty acid synthesis. The complex SDR
           NADP-binding motif, GGXGXXG, is often present, but is
           not strictly conserved in each instance of the module.
           This subfamily includes KR domains found in many
           multidomain PKSs, including six of seven Sorangium
           cellulosum PKSs (encoded by spiDEFGHIJ) which
           participate in the synthesis of the polyketide scaffold
           of the cytotoxic spiroketal polyketide spirangien. These
           seven PKSs have either a single PKS module (SpiF), two
           PKR modules (SpiD,-E,-I,-J), or three PKS modules
           (SpiG,-H). This subfamily includes the second KR domains
           of SpiE,-G, I, and -J, both KR domains of SpiD, and the
           third KR domain of SpiH. The single KR domain of SpiF,
           the first and second KR domains of SpiH, the first KR
           domains of SpiE,-G,- I, and -J, and the third KR domain
           of SpiG, belong to a different KR_FAS_SDR subfamily.
           SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 448

 Score = 28.8 bits (65), Expect = 0.72
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 7/57 (12%)

Query: 46  RPRKIPKDEIGTPIQEFFR-DASVFVTGGTGFMGKILVEKLLRA--IPHLKHIYLLV 99
           R  ++       P+      D +V +TGGTG +G +L   L+    + HL    LLV
Sbjct: 173 RLARVAPAATLPPVPRPLDPDGTVLITGGTGTLGALLARHLVTEHGVRHL----LLV 225


>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           both KR domains of the Bacillus subtilis Pks J,-L, and
           PksM, and all three KR domains of PksN, components of
           the megacomplex bacillaene synthase, which synthesizes
           the antibiotic bacillaene. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G
           NAD(P)-binding motif. Some atypical SDRs have lost
           catalytic activity and/or have an unusual NAD(P)-binding
           motif and missing or unusual active site residues.
           Reactions catalyzed within the SDR family include
           isomerization, decarboxylation, epimerization, C=N bond
           reduction, dehydratase activity, dehalogenation,
           Enoyl-CoA reduction, and carbonyl-alcohol
           oxidoreduction.
          Length = 436

 Score = 28.5 bits (64), Expect = 0.75
 Identities = 12/44 (27%), Positives = 17/44 (38%), Gaps = 4/44 (9%)

Query: 46  RPRKIPKDEIGTPIQEFFRDASVF-VTGGTGFMGKILVEKLLRA 88
            P  +P            +   V+ VTGG G +G+ L   L R 
Sbjct: 188 EPLPLPAGAAA---SAPLKPGGVYLVTGGAGGIGRALARALARR 228


>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase
           (retinol-DH), Light dependent Protochlorophyllide
           (Pchlide) OxidoReductase (LPOR) and related proteins,
           classical (c) SDRs.  Classical SDR subgroup containing
           retinol-DHs, LPORs, and related proteins. Retinol is
           processed by a medium chain alcohol dehydrogenase
           followed by retinol-DHs. Pchlide reductases act in
           chlorophyll biosynthesis. There are distinct enzymes
           that catalyze Pchlide reduction in light or dark
           conditions. Light-dependent reduction is via an
           NADP-dependent SDR, LPOR. Proteins in this subfamily
           share the glycine-rich NAD-binding motif of the
           classical SDRs, have a partial match to the canonical
           active site tetrad, but lack the typical active site
           Ser. This subgroup includes the human proteins: retinol
           dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase
           SDR family member (DHRS)-12 , -13 and -X (a DHRS on
           chromosome X), and WWOX (WW domain-containing
           oxidoreductase), as well as a Neurospora crassa SDR
           encoded by the blue light inducible bli-4 gene. SDRs are
           a functionally diverse family of oxidoreductases that
           have a single domain with a structurally conserved
           Rossmann fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRs are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes catalyze a
           wide range of activities including the metabolism of
           steroids, cofactors, carbohydrates, lipids, aromatic
           compounds, and amino acids, and act in redox sensing.
           Classical SDRs have an TGXXX[AG]XG cofactor binding
           motif and a YXXXK active site motif, with the Tyr
           residue of the active site motif serving as a critical
           catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 269

 Score = 28.3 bits (64), Expect = 0.79
 Identities = 10/45 (22%), Positives = 19/45 (42%), Gaps = 4/45 (8%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR-PKKGKAVQERL 111
           V +TG    +GK    +L +      H+ +  R  +KG+     +
Sbjct: 4   VVITGANSGIGKETARELAK---RGAHVIIACRNEEKGEEAAAEI 45


>gnl|CDD|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus.
           Dihydrodipicolinate reductase (DapB) reduces the
           alpha,beta-unsaturated cyclic imine,
           dihydro-dipicolinate. This reaction is the second
           committed step in the biosynthesis of L-lysine and its
           precursor meso-diaminopimelate, which are critical for
           both protein and cell wall biosynthesis. The N-terminal
           domain of DapB binds the dinucleotide NADPH.
          Length = 122

 Score = 27.6 bits (62), Expect = 0.89
 Identities = 11/50 (22%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 70  VTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDRI 119
           V G +G MG+ L+ K +   P  + +  + RP       +  E      +
Sbjct: 5   VVGASGRMGRELI-KAILEAPDFELVAAVDRPGSSLLGSDAGELAGPLGV 53


>gnl|CDD|218047 pfam04367, DUF502, Protein of unknown function (DUF502).  Predicted
           to be an integral membrane protein.
          Length = 108

 Score = 27.5 bits (62), Expect = 0.95
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 13/58 (22%)

Query: 66  ASVFVTG--GTGFMGKILV---EKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDR 118
             +F+ G     F+G+ L+   E+LL  IP ++ IY         +V++ +E +  D+
Sbjct: 6   LLIFLVGLLARNFIGRWLLSLGERLLNRIPLVRSIY--------SSVKQLVETLLGDK 55


>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase
           (FAS), complex (x) SDRs.  Ketoreductase, a module of the
           multidomain polyketide synthase (PKS), has 2 subdomains,
           each corresponding  to a SDR family monomer. The
           C-terminal subdomain catalyzes the NADPH-dependent
           reduction of the beta-carbonyl of a polyketide to a
           hydroxyl group, a step in the biosynthesis of
           polyketides, such as erythromycin. The N-terminal
           subdomain, an interdomain linker, is a truncated
           Rossmann fold which acts to stabilizes the catalytic
           subdomain. Unlike typical SDRs, the isolated domain does
           not oligomerize but is composed of 2 subdomains, each
           resembling an SDR monomer. The active site resembles
           that of typical SDRs, except that the usual positions of
           the catalytic Asn and Tyr are swapped, so that the
           canonical YXXXK motif changes to YXXXN. Modular PKSs are
           multifunctional structures in which the makeup
           recapitulates that found in (and may have evolved from)
           FAS.  In some instances, such as porcine FAS, an enoyl
           reductase (ER) module is inserted between the
           sub-domains. Fatty acid synthesis occurs via the
           stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consist of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthase
           uses a dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles, ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-KR, forming beta-hydroxyacyl-ACP, which is in turn
           dehydrated by dehydratase to a beta-enoyl intermediate,
           which is reduced by NADP-dependent beta-ER. Polyketide
           synthesis also proceeds via the addition of 2-carbon
           units as in fatty acid synthesis. The complex SDR
           NADP-binding motif, GGXGXXG, is often present, but is
           not strictly conserved in each instance of the module.
           SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 375

 Score = 28.1 bits (63), Expect = 1.1
 Identities = 12/49 (24%), Positives = 19/49 (38%), Gaps = 2/49 (4%)

Query: 65  DASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEA 113
           D +  +TGG G +G ++   L       +H+ LL R         R   
Sbjct: 150 DGTYLITGGLGGLGLLVARWLAAR--GARHLVLLSRRGPAPRAAARAAL 196


>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase.
          Length = 351

 Score = 28.3 bits (63), Expect = 1.1
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 67 SVFVTGGTGFMGKILVEKLLRA 88
          +V VTG +GF+G  LV +LL  
Sbjct: 7  TVCVTGASGFIGSWLVMRLLER 28


>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional.
          Length = 256

 Score = 27.6 bits (62), Expect = 1.3
 Identities = 12/56 (21%), Positives = 22/56 (39%), Gaps = 6/56 (10%)

Query: 68  VFVTGGTGFMGKILVEKLLR--AIPHLKHIYLLVRPKKGKAVQERLEAIFEDRIHT 121
           + +TG  G +G  LV+ +L    I     I      +    + E L   F+ +  +
Sbjct: 7   ILITGAGGLIGSALVKAILEAGGIVIAADIDK----EALNELLESLGKEFKSKKLS 58


>gnl|CDD|187658 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of
           fatty acid synthase (FAS), subgroup 2, complex (x).
           Ketoreductase, a module of the multidomain polyketide
           synthase, has 2 subdomains, each corresponding  to a
           short-chain dehydrogenases/reductase (SDR) family
           monomer. The C-terminal subdomain catalyzes the
           NADPH-dependent reduction of the beta-carbonyl of a
           polyketide to a hydroxyl group, a step in the
           biosynthesis of polyketides, such as erythromycin.  The
           N-terminal subdomain, an interdomain linker, is a
           truncated Rossmann fold which acts to stabilizes the
           catalytic subdomain. Unlike typical SDRs, the isolated
           domain does not oligomerizes but is composed of 2
           subdomains, each resembling an SDR monomer.  In some
           instances,  as in porcine FAS, an enoyl reductase (a
           Rossman fold NAD binding domain of the MDR family)
           module is inserted between the sub-domains.  The active
           site resembles that of typical SDRs, except that the
           usual positions of the catalytic asparagine and tyrosine
           are swapped, so that the canonical YXXXK motif changes
           to YXXXN. Modular polyketide synthases are
           multifunctional structures in which the makeup
           recapitulates that found in (and may have evolved from)
           fatty acid synthase.   In some instances, such as
           porcine FAS , an enoyl reductase module is inserted
           between the sub-domains. Fatty acid synthesis occurs via
           the stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consists of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthesis
           uses dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles,  ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-ketoacyl reductase (KR), forming
           beta-hydroxyacyl-ACP, which is in turn dehydrated by
           dehydratase to a beta-enoyl intermediate, which is
           reduced by NADP-dependent beta-enoyl reductase (ER).
           Polyketide syntheses also proceeds via the addition of
           2-carbon units as in fatty acid synthesis.  The complex
           SDR NADP binding motif, GGXGXXG, is often present, but
           is not strictly conserved in each instance of the
           module. This subfamily includes the KR domain of the
           Lyngbya majuscule Jam J, -K, and #L  which are encoded
           on the jam gene cluster and are involved in the
           synthesis of the Jamaicamides (neurotoxins); Lyngbya
           majuscule Jam P belongs to a different KR_FAS_SDR_x
           subfamily. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 376

 Score = 27.6 bits (62), Expect = 1.5
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 57  TPIQEFFRDASVFVTGGTGFMGKILVEKLLR--AIPHLKHIYLLVRPKKGKAVQERLEAI 114
            P +    DA+  +TGG G +G ++ E L+   A    +H+ L  R     A ++ + A+
Sbjct: 141 APARPLRPDATYLITGGLGGLGLLVAEWLVERGA----RHLVLTGRRAPSAAARQAIAAL 196


>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding. 
          Length = 182

 Score = 27.3 bits (61), Expect = 1.5
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 70  VTGGTGFMGKILVEKLLRAIPHLKHIYLLVR 100
           V G TG  G+ LV++LL    H   +  L R
Sbjct: 3   VIGATGKTGRRLVKELLAR-GH--QVTALSR 30


>gnl|CDD|213897 TIGR04240, flavi_E_stem, flavivirus envelope glycoprotein E,
          stem/anchor domain.  This model describes the
          C-terminal domain, containing a stem region followed by
          two transmembrane anchor domains, of the envelope
          protein E. This protein is cleaved from the large
          flavivirus polyprotein, which yields three structural
          and seven nonstructural proteins.
          Length = 97

 Score = 26.8 bits (60), Expect = 1.6
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 55 IGTPIQEFFRDASVFVTGGTGFMGKILVEKLL 86
          IG  + + F  A   + GG  ++ KIL+  LL
Sbjct: 34 IGKALHQVFGGAFRALFGGVSWITKILIGVLL 65


>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH
          and WbmG-like, extended (e) SDRs.  Bordetella
          bronchiseptica enzymes WbmH and WbmG, and related
          proteins. This subgroup exhibits the active site tetrad
          and NAD-binding motif of the extended SDR family. It
          has been proposed that the active site in Bordetella
          WbmG and WbmH cannot function as an epimerase, and that
          it plays a role in O-antigen synthesis pathway from
          UDP-2,3-diacetamido-2,3-dideoxy-l-galacturonic acid.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 307

 Score = 27.5 bits (61), Expect = 1.8
 Identities = 10/19 (52%), Positives = 13/19 (68%)

Query: 68 VFVTGGTGFMGKILVEKLL 86
          V +TGG G +G  L+E LL
Sbjct: 3  VLITGGAGQIGSHLIEHLL 21


>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana
          GDP-mannose-3',5'-epimerase (GME)-like, extended (e)
          SDRs.  This subgroup of NDP-sugar
          epimerase/dehydratases are extended SDRs; they have the
          characteristic active site tetrad, and an NAD-binding
          motif: TGXXGXX[AG], which is a close match to the
          canonical NAD-binding motif. Members include
          Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)
          which catalyzes the epimerization of two positions of
          GDP-alpha-D-mannose to form GDP-beta-L-galactose.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 328

 Score = 27.4 bits (61), Expect = 1.9
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query: 68 VFVTGGTGFMGKILVEKLLR 87
            VTG  GF+G  L E+L  
Sbjct: 3  ALVTGAGGFIGSHLAERLKA 22


>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid
          dehydrogenase/isomerase family.  The enzyme 3
          beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase
          (3 beta-HSD) catalyzes the oxidation and isomerisation
          of 5-ene-3 beta-hydroxypregnene and
          5-ene-hydroxyandrostene steroid precursors into the
          corresponding 4-ene-ketosteroids necessary for the
          formation of all classes of steroid hormones.
          Length = 280

 Score = 27.3 bits (61), Expect = 2.3
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 70 VTGGTGFMGKILVEKLLR 87
          VTGG GF+G+ +V  LLR
Sbjct: 2  VTGGGGFLGRHIVRLLLR 19


>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase.
          Length = 442

 Score = 27.3 bits (60), Expect = 2.3
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 68  VFVTGGTGFMGKILVEKLLR 87
           V VTGG GF+G  LV++L+ 
Sbjct: 122 VVVTGGAGFVGSHLVDRLMA 141


>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial
           polyketide synthases.  It catalyses the first step in
           the reductive modification of the beta-carbonyl centres
           in the growing polyketide chain. It uses NADPH to reduce
           the keto group to a hydroxy group.
          Length = 180

 Score = 27.1 bits (61), Expect = 2.3
 Identities = 10/35 (28%), Positives = 16/35 (45%), Gaps = 2/35 (5%)

Query: 66  ASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR 100
            +  +TGG G +G+ L   L       + + LL R
Sbjct: 1   GTYLITGGLGGLGRALARWLAER--GARRLVLLSR 33


>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e)
          SDRs.  CDP-tyvelose 2-epimerase is a tetrameric SDR
          that catalyzes the conversion of CDP-D-paratose to
          CDP-D-tyvelose, the last step in tyvelose biosynthesis.
          This subgroup is a member of the extended SDR
          subfamily, with a characteristic active site tetrad and
          NAD-binding motif. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 337

 Score = 27.3 bits (61), Expect = 2.4
 Identities = 9/22 (40%), Positives = 12/22 (54%)

Query: 66 ASVFVTGGTGFMGKILVEKLLR 87
            V +TGG GF+G  L    L+
Sbjct: 1  MRVLITGGAGFIGSNLARFFLK 22


>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2.  This subgroup
          contains atypical SDRs, one member is identified as
          Escherichia coli protein ybjT, function unknown.
          Atypical SDRs are distinct from classical SDRs. Members
          of this subgroup have a glycine-rich NAD(P)-binding
          motif consensus that generally matches the extended
          SDRs, TGXXGXXG, but lacks the characteristic active
          site residues of the SDRs. This subgroup has basic
          residues (HXXXR) in place of the active site motif
          YXXXK, these may have a catalytic role. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 293

 Score = 26.9 bits (60), Expect = 2.5
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          V VTG TG++G  LV +LL+ 
Sbjct: 1  VLVTGATGYVGGRLVPRLLQE 21


>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          bacterial proteins, and includes the Staphylococcus
          aureus capsular polysaccharide Cap5N, which may have a
          role in the synthesis of UDP-N-acetyl-d-fucosamine.
          This subgroup has the characteristic active site tetrad
          and NAD-binding motif of the extended SDRs. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 303

 Score = 26.9 bits (60), Expect = 2.9
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 67 SVFVTGGTGFMGKILVEKLL 86
           V VTG  GF+G+ LV+KLL
Sbjct: 1  KVLVTGANGFIGRALVDKLL 20


>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase.
          Length = 436

 Score = 26.9 bits (59), Expect = 2.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 7/42 (16%)

Query: 45  GRPRKIPKDEIGTPIQEFFRDASVFVTGGTGFMGKILVEKLL 86
           GR  ++P   IG       +   + VTGG GF+G  LV+KL+
Sbjct: 107 GRTGRVPVG-IGR------KRLRIVVTGGAGFVGSHLVDKLI 141


>gnl|CDD|187560 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs.
           Atypical SDRs in this subgroup include CC3 (also known
           as TIP30) which is implicated in tumor suppression.
           Atypical SDRs are distinct from classical SDRs. Members
           of this subgroup have a glycine rich NAD(P)-binding
           motif that resembles the extended SDRs, and have an
           active site triad of the SDRs (YXXXK and upstream Ser),
           although the upstream Asn of the usual SDR active site
           is substituted with Asp. For CC3, the Tyr of the triad
           is displaced compared to the usual SDRs and the protein
           is monomeric, both these observations suggest that the
           usual SDR catalytic activity is not present. NADP
           appears to serve an important role as a ligand, and may
           be important in the interaction with other
           macromolecules. Atypical SDRs generally lack the
           catalytic residues characteristic of the SDRs, and their
           glycine-rich NAD(P)-binding motif is often different
           from the forms normally seen in classical or extended
           SDRs. Atypical SDRs include biliverdin IX beta reductase
           (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 214

 Score = 26.5 bits (59), Expect = 3.1
 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR 100
           +  V G TG +GK L+ +LL++ P+   +  +VR
Sbjct: 2   TALVLGATGLVGKHLLRELLKS-PYYSKVTAIVR 34


>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE.  Alternate name:
           UDPgalactose 4-epimerase This enzyme interconverts
           UDP-glucose and UDP-galactose. A set of related
           proteins, some of which are tentatively identified as
           UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus
           halodurans, and several archaea, but deeply branched
           from this set and lacking experimental evidence, are
           excluded from This model and described by a separate
           model [Energy metabolism, Sugars].
          Length = 328

 Score = 26.5 bits (59), Expect = 3.3
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 17/67 (25%)

Query: 68  VFVTGGTGFMGKILVEKLLR-----------------AIPHLKHIYLLVRPKKGKAVQER 110
           + VTGG G++G   V +LL                  A+P  + I  +   +     +E 
Sbjct: 2   ILVTGGAGYIGSHTVRQLLESGHEVVILDNLSNGSREALPRGERITPVTFVEGDLRDREL 61

Query: 111 LEAIFED 117
           L+ +FE+
Sbjct: 62  LDRLFEE 68


>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a
           nucleoside-diphosphate-sugar 4-epimerase)-like, extended
           (e) SDRs.  Nucleoside-diphosphate-sugar 4-epimerase has
           the characteristic active site tetrad and NAD-binding
           motif of the extended SDR, and is related to more
           specifically defined epimerases such as UDP-glucose 4
           epimerase (aka UDP-galactose-4-epimerase), which
           catalyzes the NAD-dependent conversion of UDP-galactose
           to UDP-glucose, the final step in Leloir galactose
           synthesis. This subgroup includes Escherichia coli
           055:H7 Gne, a UDP-GlcNAc 4-epimerase, essential for O55
           antigen synthesis. Extended SDRs are distinct from
           classical SDRs. In addition to the Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet)
           core region typical of all SDRs, extended SDRs have a
           less conserved C-terminal extension of approximately 100
           amino acids. Extended SDRs are a diverse collection of
           proteins, and include isomerases, epimerases,
           oxidoreductases, and lyases; they typically have a
           TGXXGXXG cofactor binding motif. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 26.6 bits (59), Expect = 3.3
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 15/66 (22%)

Query: 67  SVFVTGGTGFMGKILVEKLLRAIPHLKHIYLL--VRPKKGK------------AVQERLE 112
            V +TG +GF+G+ L E+LL +    + + L+  V PK               AV   +E
Sbjct: 2   KVLITGASGFVGQRLAERLL-SDVPNERLILIDVVSPKAPSGAPRVTQIAGDLAVPALIE 60

Query: 113 AIFEDR 118
           A+   R
Sbjct: 61  ALANGR 66


>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR).  SDRs
          are a functionally diverse family of oxidoreductases
          that have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRs are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human prostaglandin
          dehydrogenase (PGDH) numbering). In addition to the Tyr
          and Lys, there is often an upstream Ser (Ser-138, PGDH
          numbering) and/or an Asn (Asn-107, PGDH numbering)
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Extended SDRs have additional
          elements in the C-terminal region, and typically have a
          TGXXGXXG cofactor binding motif. Complex (multidomain)
          SDRs such as ketoreductase (KR) domains of fatty acid
          synthase have a GGXGXXG NAD(P)-binding motif and an
          altered active site motif (YXXXN). Fungal type KRs have
          a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical
          SDRs have lost catalytic activity and/or have an
          unusual NAD(P)-binding motif and missing or unusual
          active site residues. Reactions catalyzed within the
          SDR family include isomerization, decarboxylation,
          epimerization, C=N bond reduction, dehydratase
          activity, dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 186

 Score = 26.3 bits (58), Expect = 4.0
 Identities = 8/21 (38%), Positives = 11/21 (52%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          V VTGG+G +G  +   L   
Sbjct: 1  VLVTGGSGGIGGAIARWLASR 21


>gnl|CDD|131703 TIGR02655, circ_KaiC, circadian clock protein KaiC.  Members of
           this family are the circadian clock protein KaiC, part
           of the kaiABC operon that controls circadian rhythm. It
           may be universal in Cyanobacteria. Each member has two
           copies of the KaiC domain (pfam06745), which is also
           found in other proteins. KaiC performs
           autophosphorylation and acts as its own transcriptional
           repressor [Cellular processes, Other].
          Length = 484

 Score = 26.5 bits (58), Expect = 4.1
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 62  FFRDASVFVTGGTGFMGKILVEKLL 86
           FF+D+ +  TG TG    +LV K L
Sbjct: 260 FFKDSIILATGATGTGKTLLVSKFL 284


>gnl|CDD|181080 PRK07680, PRK07680, late competence protein ComER; Validated.
          Length = 273

 Score = 26.5 bits (59), Expect = 4.2
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 73  GTGFMGKILVEKLL--RAIPHLKHIYLLVR-PKKGKAVQERLEAI 114
           GTG MG IL+E  L   A+     + +  R P K   ++ER   I
Sbjct: 7   GTGNMGTILIEAFLESGAVKP-SQLTITNRTPAKAYHIKERYPGI 50


>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
          Provisional.
          Length = 249

 Score = 26.4 bits (59), Expect = 4.3
 Identities = 7/22 (31%), Positives = 11/22 (50%)

Query: 67 SVFVTGGTGFMGKILVEKLLRA 88
             VTG    +G+ +  +L RA
Sbjct: 8  VALVTGAARGLGRAIALRLARA 29


>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
           Validated.
          Length = 246

 Score = 26.3 bits (59), Expect = 4.5
 Identities = 8/46 (17%), Positives = 17/46 (36%), Gaps = 2/46 (4%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQERLEA 113
             VTG +  +G+ +  +L      +         +  +A+   L A
Sbjct: 8   ALVTGASRGIGRAIALRLAADGAKVVIYD--SNEEAAEALAAELRA 51


>gnl|CDD|198114 smart01046, c-SKI_SMAD_bind, c-SKI Smad4 binding domain.  c-SKI is
           an oncoprotein that inhibits TGF-beta signaling through
           interaction with Smad proteins. This domain binds to
           Smad4.
          Length = 95

 Score = 25.4 bits (56), Expect = 4.7
 Identities = 8/24 (33%), Positives = 12/24 (50%)

Query: 94  HIYLLVRPKKGKAVQERLEAIFED 117
             YL V    G   +E+LE + E+
Sbjct: 66  RSYLHVAKDYGTEEREKLEQLLEE 89


>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase.  This
          protein is related to UDP-glucose 4-epimerase (GalE)
          and likewise has an NAD cofactor [Cell envelope,
          Biosynthesis and degradation of surface polysaccharides
          and lipopolysaccharides].
          Length = 317

 Score = 26.2 bits (58), Expect = 4.8
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 67 SVFVTGGTGFMGKILVEKLLRAIPH 91
           + VTGG GF+G   V  +L   P 
Sbjct: 1  RILVTGGAGFIGSNFVRYILNEHPD 25


>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8.  This subgroup
          has a fairly well conserved active site tetrad and
          domain size of the classical SDRs, but has an atypical
          NAD-binding motif ([ST]G[GA]XGXXG). SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRs are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase (15-PGDH)
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) contributing
          to the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. Extended SDRs have additional elements in
          the C-terminal region, and typically have a TGXXGXXG
          cofactor binding motif. Complex (multidomain) SDRs such
          as ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
          have lost catalytic activity and/or have an unusual
          NAD(P)-binding motif and missing or unusual active site
          residues. Reactions catalyzed within the SDR family
          include isomerization, decarboxylation, epimerization,
          C=N bond reduction, dehydratase activity,
          dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 250

 Score = 26.1 bits (58), Expect = 4.9
 Identities = 8/21 (38%), Positives = 12/21 (57%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
          + +TG  G +GK   + LL A
Sbjct: 5  ILITGAAGLIGKAFCKALLSA 25


>gnl|CDD|227389 COG5056, ARE1, Acyl-CoA cholesterol acyltransferase [Lipid
          metabolism].
          Length = 512

 Score = 26.3 bits (58), Expect = 5.0
 Identities = 9/28 (32%), Positives = 12/28 (42%)

Query: 6  HKKALSSTKYKVKPLEITEDIVNSKYYK 33
           +K+     Y VK L  T  IV   Y +
Sbjct: 56 LRKSKVRAAYTVKTLSPTPSIVARPYQR 83


>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase.
          Length = 352

 Score = 26.1 bits (58), Expect = 5.0
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 65 DASVFVTGGTGFMGKILVEKLL 86
            ++ VTGG G++G   V +LL
Sbjct: 5  GRTILVTGGAGYIGSHTVLQLL 26


>gnl|CDD|219099 pfam06595, BDV_P24, Borna disease virus P24 protein.  This family
          consists of several Borna disease virus (BDV) P24
          proteins. The function of this family is unknown.
          Length = 201

 Score = 26.1 bits (57), Expect = 5.1
 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 33 KDPLQLLGEKNFG-RPRKIPKDEIGTPIQEFFRDAS 67
          +DP  L  E++   RPRK+P++ +  P+ +   D  
Sbjct: 16 EDPQTLRRERSGSPRPRKVPRNALTQPVDQLLGDLR 51


>gnl|CDD|224342 COG1424, BioW, Pimeloyl-CoA synthetase [Coenzyme metabolism].
          Length = 239

 Score = 26.0 bits (57), Expect = 5.3
 Identities = 14/51 (27%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 45 GRPRKIPKDEIGTPIQEFFRDASVFVTGGTGFMGKILVEKLLRAIPHLKHI 95
          G  R +  DEI   ++E          G   FM  I +EK+   I  +K +
Sbjct: 14 GAERIVEFDEIEQTVKELLNKGLFHENGQPDFM-NIKIEKIKEPIQQIKAL 63


>gnl|CDD|181661 PRK09124, PRK09124, pyruvate dehydrogenase; Provisional.
          Length = 574

 Score = 26.1 bits (58), Expect = 5.4
 Identities = 11/27 (40%), Positives = 13/27 (48%), Gaps = 6/27 (22%)

Query: 50  IPKDEIG------TPIQEFFRDASVFV 70
           IP  EIG      T  QE FR+ S + 
Sbjct: 102 IPSSEIGSGYFQETHPQELFRECSHYC 128


>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding
           subunit; Provisional.
          Length = 356

 Score = 26.0 bits (58), Expect = 5.6
 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 3/24 (12%)

Query: 55  IGTPIQEFFRDASVFVTGGTGFMG 78
           IGTP++ + + AS FV     F+G
Sbjct: 216 IGTPVEVYEKPASTFV---ASFIG 236


>gnl|CDD|224426 COG1509, KamA, Lysine 2,3-aminomutase [Amino acid transport and
           metabolism].
          Length = 369

 Score = 26.1 bits (58), Expect = 5.8
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 9/56 (16%)

Query: 48  RKIPKDEIGTPIQEFFRD----ASVFVTGGTGFMG--KILVEKL--LRAIPHLKHI 95
           +   K+E      ++         V ++GG       K L   L  LRAIPH+K I
Sbjct: 139 QGFNKEEW-DKALDYIAAHPEIREVLLSGGDPLSLSDKKLEWLLKRLRAIPHVKII 193


>gnl|CDD|178047 PLN02427, PLN02427, UDP-apiose/xylose synthase.
          Length = 386

 Score = 26.0 bits (57), Expect = 5.9
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 56 GTPIQEFFRDASVFVTGGTGFMGKILVEKLLRAIPH 91
          G PI+      ++ + G  GF+G  L EKL+   PH
Sbjct: 9  GKPIKPL----TICMIGAGGFIGSHLCEKLMTETPH 40


>gnl|CDD|187651 cd08947, NmrA_TMR_like_SDR_a, NmrA (a transcriptional regulator),
           HSCARG (an NADPH sensor), and triphenylmethane reductase
           (TMR) like proteins, atypical (a) SDRs.  Atypical SDRs
           belonging to this subgroup include NmrA, HSCARG, and
           TMR, these proteins bind NAD(P) but  they lack the usual
           catalytic residues of the SDRs. Atypical SDRs are
           distinct from classical SDRs. NmrA is a negative
           transcriptional regulator of various fungi, involved in
           the post-translational modulation of the GATA-type
           transcription factor AreA.  NmrA lacks the canonical
           GXXGXXG NAD-binding motif and has altered residues at
           the catalytic triad, including a Met instead of the
           critical Tyr residue. NmrA may bind nucleotides but
           appears to lack any dehydrogenase activity. HSCARG has
           been identified as a putative NADP-sensing molecule, and
           redistributes and restructures in response to NADPH/NADP
           ratios. Like NmrA, it lacks most of the active site
           residues of the SDR family, but has an NAD(P)-binding
           motif similar to the extended SDR family, GXXGXXG. TMR,
           an NADP-binding protein, lacks the active site residues
           of the SDRs but has a glycine rich NAD(P)-binding motif
           that matches the extended SDRs. Atypical SDRs include
           biliverdin IX beta reductase (BVR-B,aka flavin
           reductase), NMRa (a negative transcriptional regulator
           of various fungi), progesterone 5-beta-reductase like
           proteins, phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 224

 Score = 26.0 bits (57), Expect = 5.9
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 2/41 (4%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVRPKKGKAVQ 108
           + VTG TG  G  ++  LL        +  +VR  +  A  
Sbjct: 1   IAVTGATGQQGGSVIRHLLAKGAS--QVRAVVRNVEKAATL 39


>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin
           oxidoreductases use flavin as a substrate in mediating
           electron transfer from iron complexes or iron proteins.
           Structurally similar to ferredoxin reductases, but with
           only 15% sequence identity, flavin reductases reduce
           FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a
           substrate, rather than a tightly bound prosthetic group
           as in flavoenzymes; weaker binding is due to the absence
           of a binding site for the AMP moeity of FAD.
          Length = 224

 Score = 25.6 bits (57), Expect = 6.3
 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 6/45 (13%)

Query: 62  FFRDAS----VFVTGGTGFMG-KILVEKLLRAIPHLK-HIYLLVR 100
           F R+ S    + + GGTGF   K ++E LL        H+Y   R
Sbjct: 92  FLREDSDRPLILIAGGTGFAPIKSILEHLLAQGSKRPIHLYWGAR 136


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 2 (CDKL2) and CDKL3 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL2 and CDKL3
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL2, also called
           p56 KKIAMRE, is expressed in testis, kidney, lung, and
           brain. It functions mainly in mature neurons and plays
           an important role in learning and memory. Inactivation
           of CDKL3, also called NKIAMRE (NKIATRE in rat), by
           translocation is associated with mild mental
           retardation. It has been reported that CDKL3 is lost in
           leukemic cells having a chromosome arm 5q deletion, and
           may contribute to the transformed phenotype.
          Length = 286

 Score = 25.8 bits (57), Expect = 6.6
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 19  PLEITEDIVNSKYYKDPLQLLGEKNFGRP 47
           P E+  D V +++Y+ P  L+G+  +GR 
Sbjct: 153 PGEVYTDYVATRWYRAPELLVGDTKYGRA 181


>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related
           to short-chain alcohol dehydrogenases) [Secondary
           metabolites biosynthesis, transport, and catabolism /
           General function prediction only].
          Length = 251

 Score = 25.5 bits (56), Expect = 7.4
 Identities = 9/61 (14%), Positives = 20/61 (32%), Gaps = 4/61 (6%)

Query: 63  FRDASVFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR--PKKGKAVQERLEAIFEDRIH 120
                  VTG +  +G+ +   L R     + +    R   +  +A+   ++     R  
Sbjct: 3   LSGKVALVTGASSGIGRAIARALARE--GARVVVAARRSEEEAAEALAAAIKEAGGGRAA 60

Query: 121 T 121
            
Sbjct: 61  A 61


>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase.
          Length = 353

 Score = 25.6 bits (56), Expect = 7.6
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 70 VTGGTGFMGKILVEKLLR 87
          VTG TG++G  LV+ LL+
Sbjct: 15 VTGATGYIGSWLVKLLLQ 32


>gnl|CDD|234993 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed.
          Length = 333

 Score = 25.5 bits (57), Expect = 8.4
 Identities = 10/19 (52%), Positives = 13/19 (68%)

Query: 7  KKALSSTKYKVKPLEITED 25
           KAL   KY+V P+ IT+D
Sbjct: 28 LKALDKEKYEVVPIGITKD 46


>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e)
          SDRs.  GDP-mannose 4,6 dehydratase, a homodimeric SDR,
          catalyzes the NADP(H)-dependent conversion of
          GDP-(D)-mannose to GDP-4-keto, 6-deoxy-(D)-mannose in
          the fucose biosynthesis pathway. These proteins have
          the canonical active site triad and NAD-binding
          pattern, however the active site Asn is often missing
          and may be substituted with Asp. A Glu residue has been
          identified as an important active site base. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 316

 Score = 25.6 bits (57), Expect = 8.4
 Identities = 9/21 (42%), Positives = 10/21 (47%)

Query: 68 VFVTGGTGFMGKILVEKLLRA 88
            +TG TG  G  L E LL  
Sbjct: 2  ALITGITGQDGSYLAEFLLEK 22


>gnl|CDD|225480 COG2928, COG2928, Uncharacterized conserved protein [Function
           unknown].
          Length = 222

 Score = 25.3 bits (56), Expect = 9.5
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 16/53 (30%)

Query: 74  TGFM-----GKILV---EKLLRAIPHLKHIYLLVRPKKGKAVQERLEAIFEDR 118
            GF+     G+ L+   + LLR IP +K IY        K+ ++ +E +  D+
Sbjct: 71  LGFLARNMIGRSLLSLGDSLLRRIPLVKSIY--------KSAKQVVETLLSDQ 115


>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein.
           This is a family of diverse bacterial polysaccharide
           biosynthesis proteins including the CapD protein, WalL
           protein mannosyl-transferase and several putative
           epimerases (e.g. WbiI).
          Length = 280

 Score = 25.1 bits (56), Expect = 10.0
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 68  VFVTGGTGFMGKILVEKLLRAIPHLKHIYLLVR 100
           V VTGG G +G  L  ++L+  P  K I L  R
Sbjct: 1   VLVTGGGGSIGSELCRQILKFNP--KKIILFSR 31


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.321    0.141    0.402 

Gapped
Lambda     K      H
   0.267   0.0701    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,499,050
Number of extensions: 600551
Number of successful extensions: 843
Number of sequences better than 10.0: 1
Number of HSP's gapped: 838
Number of HSP's successfully gapped: 139
Length of query: 121
Length of database: 10,937,602
Length adjustment: 84
Effective length of query: 37
Effective length of database: 7,211,866
Effective search space: 266839042
Effective search space used: 266839042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.3 bits)