Diaphorina citri psyllid: psy3450

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
METKPVVATQKQYDYLLKFLLVGDSDVGKQEILSGYKLELTAWLMETKPVVATQKQYDYLLKFLLVGDSDVGKQEILSGLYLESRFPRFWLDGSSESPFCSGSGKYDDMLAYKTTTILLDGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGILLVYDITNKWSFDGIDRWLKEVEEHAPGVPKVLVGNRLHLAFNRTVTTREAEMYAIKNQMAFFEVSPLCDFNIRESFTELSRRALQRNGMERLWRSNKVGRKPLINFESFTELSRRALQRNGMERLWRSNKGKHLLTYFQYCFAGLVRPSVDVNKNKYNLLSFSVISLQELCCRAIVARTTVYAINQLPLPNLIKSHLKSYAMTSYTTMTMTTSARQHTKKLRFPSAQSTHSLLDTPSPSAATASLVSCGTGGASSASVKVSHSQKSKHSSCVGRNSCVVS
ccccccccccccHHHHHHEEEccccccccHHHcccccccEEEEEEcccccccccccccEEEEEEEECcccccHHHHccccccccccccccccccccccECcccccccccEEEEEEEEEEccEEEEEEEEEcccccccHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHcccCEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccEEEc
********TQKQYDYLLKFLLVGDSDVGKQEIL****LELT************QKQYDYLLKFLLVGDSDVGKQEILSGLYLESRFPRFWLDGSSESPFCSGSGKYDDMLAYKTTTILLDGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGILLVYDITNKWSFDGIDRWLKEVEEHAPGVPKVLVGNRLHLAFNRTVTTREAEMYAIKNQMAFFEVSPLCDFNIRESFTELSRRALQRNG**********************************E******KGKHLLTYFQYCFAGLVRPSVDVNKNKYNLLSFSVISLQELCCRAIVARTTVYAINQLPLPNLIKSHLKSYAMTSYTTM************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METKPVVATQKQYDYLLKFLLVGDSDVGKQEILSGYKLELTAWLMETKPVVATQKQYDYLLKFLLVGDSDVGKQEILSGLYLESRFPRFWLDGSSESPFCSGSGKYDDMLAYKTTTILLDGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGILLVYDITNKWSFDGIDRWLKEVEEHAPGVPKVLVGNRLHLAFNRTVTTREAEMYAIKNQMAFFEVSPLCDFNIRESFTELSRRALQRNGMERLWRSNKVGRKPLINFESFTELSRRALQRNGMERLWRSNKGKHLLTYFQYCFAGLVRPSVDVNKNKYNLLSFSVISLQELCCRAIVARTTVYAINQLPLPNLIKSHLKSYAMTSYTTMTMTTSARQHTKKLRFPSAQSTHSLLDTPSPSAATASLVSCGTGGASSASVKVSHSQKSKHSSCVGRNSCVVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein Rab-40C Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.confidentQ8VHQ4
Ras-related protein Rab-40C Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.confidentQ96S21

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0000131 [CC]incipient cellular bud siteprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0032588 [CC]trans-Golgi network membraneprobableGO:0005802, GO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0046907 [BP]intracellular transportprobableGO:0009987, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0009504 [CC]cell plateprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0072372 [CC]primary ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BCG, chain Y
Confidence level:very confident
Coverage over the Query: 57-244
View the alignment between query and template
View the model in PyMOL
Template: 3BBP, chain A
Confidence level:very confident
Coverage over the Query: 61-235
View the alignment between query and template
View the model in PyMOL
Template: 3L0I, chain B
Confidence level:very confident
Coverage over the Query: 10-38
View the alignment between query and template
View the model in PyMOL
Template: 4DCU, chain A
Confidence level:confident
Coverage over the Query: 56-88,100-243,262-317
View the alignment between query and template
View the model in PyMOL
Template: 2C9W, chain A
Confidence level:confident
Coverage over the Query: 304-353
View the alignment between query and template
View the model in PyMOL