Diaphorina citri psyllid: psy345

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--
MLTGSSTHLSLPMDVSNTSTISTAMSAIKEKFSRPPNVLVNCAGITRDNWFLKLTEKDFQQVFDVNLKGTFLVSQAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMITSVPDKVKETFTRLIPLKRFGKPEGSSTHLSLPMDVSNTSTISTAMSTIKEKFSRPPNVLVNCAGITRDNWFLKLTEKDFQQVFDVNLKGTFLVSQAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMTTSVPDKVKETFTRLIPLKRFGKPEAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMTTCVPDKVKETFTRLIPFKRFGKPEEIGEVICFLASDRSSYITGTLIKVTGGLAT
ccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEcccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHcccccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccccCEEEccccccccHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccEEEEcccccc
****SSTHLSLPMDVSNTSTISTAMSAIKEKFSRPPNVLVNCAGITRDNWFLKLTEKDFQQVFDVNLKGTFLVSQAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMITSVPDKVKETFTRLIPLKRFGKPEGSSTHLSLPMDVSNTSTISTAMSTIKEKFSRPPNVLVNCAGITRDNWFLKLTEKDFQQVFDVNLKGTFLVSQAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMTTSVPDKVKETFTRLIPLKRFGKPEAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMTTCVPDKVKETFTRLIPFKRFGKPEEIGEVICFLASDRSSYITGTLIKVTGGLA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTGSSTHLSLPMDVSNTSTISTAMSAIKEKFSRPPNVLVNCAGITRDNWFLKLTEKDFQQVFDVNLKGTFLVSQAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMITSVPDKVKETFTRLIPLKRFGKPEGSSTHLSLPMDVSNTSTISTAMSTIKEKFSRPPNVLVNCAGITRDNWFLKLTEKDFQQVFDVNLKGTFLVSQAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMTTSVPDKVKETFTRLIPLKRFGKPEAVCKELVETKSSGSIINIGSIVGQMGNMGQSNYAATKAGVEAFTKSVAMEMATFGIRCNVILPGFIETPMTTCVPDKVKETFTRLIPFKRFGKPEEIGEVICFLASDRSSYITGTLIKVTGGLAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0018454 [MF]acetoacetyl-CoA reductase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0044429 [CC]mitochondrial partprobableGO:0005737, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0044444, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0004303 [MF]estradiol 17-beta-dehydrogenase activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0050662 [MF]coenzyme bindingprobableGO:0003674, GO:0048037, GO:0005488
GO:0044085 [BP]cellular component biogenesisprobableGO:0008150, GO:0071840
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 13-312
View the alignment between query and template
View the model in PyMOL
Template: 3U0B, chain A
Confidence level:very confident
Coverage over the Query: 114-160,174-309,320,416-462
View the alignment between query and template
View the model in PyMOL
Template: 3T7C, chain A
Confidence level:very confident
Coverage over the Query: 117-338,413-461
View the alignment between query and template
View the model in PyMOL
Template: 3TJR, chain A
Confidence level:very confident
Coverage over the Query: 117-137,148-320,333-388
View the alignment between query and template
View the model in PyMOL
Template: 3EMK, chain A
Confidence level:confident
Coverage over the Query: 179-334
View the alignment between query and template
View the model in PyMOL