Diaphorina citri psyllid: psy3466


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MIQDAINDLKRLNKRQFLYQVLSFGMIVSSALMIWKGLMVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNYQEEPVRVGEIVVFKVEGRDIPIVHRVLKLHEK
cHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccEEEEECccccccEEccEEEEEEccccccEEEEEEEEEcc
*******DLKRLNKRQFLYQVLSFGMIVSSALMIWKGLMVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNYQEEPVRVGEIVVFKVEGRDIPIVHRVLKL***
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQDAINDLKRLNKRQFLYQVLSFGMIVSSALMIWKGLMVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNYQEEPVRVGEIVVFKVEGRDIPIVHRVLKLHEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptidase complex catalytic subunit SEC11C Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentQ9BY50
Signal peptidase complex catalytic subunit SEC11C Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentQ9WTR7
Signal peptidase complex catalytic subunit SEC11C Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentQ9D8V7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0008236 [MF]serine-type peptidase activityprobableGO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006465 [BP]signal peptide processingprobableGO:0044267, GO:0051604, GO:1901564, GO:0043603, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0034641, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0008152, GO:0016485, GO:0006518
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0006614 [BP]SRP-dependent cotranslational protein targeting to membraneprobableGO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0006112 [BP]energy reserve metabolic processprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0050796 [BP]regulation of insulin secretionprobableGO:0090087, GO:0032879, GO:0060341, GO:0051046, GO:0002791, GO:0050794, GO:0008150, GO:0090276, GO:0046883, GO:0051049, GO:0023051, GO:0065007, GO:0010646, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B12, chain A
Confidence level:confident
Coverage over the Query: 48-103
View the alignment between query and template
View the model in PyMOL