Diaphorina citri psyllid: psy3471


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MKELVDYDLGNAPYGYVVRADMKELVDYDLGNAPYGYVPFCDSRTEMDGFRFWNQGYWRNHLQGRKYHISALYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDRSKSSAKTIDLCNNPLTKEAKLSAAMRILYSVYAFIFRAYKFEYELVQYKWPRWLTQQTEKQRIIWGYKILFLDVLFPLDVKKIIFVDADQ
ccccccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccccEEEEEHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccccccEEECccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEcccc
MKELVDYDLGNAPYGYVVRADMKELVDYDLGNAPYGYVPFCDSRTEMDGFRFWNQGYWRNHLQGRKYHISALYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDRSKSSAKTIDLCNNPLTKEAKLSAAMRILYSVYAFIFRAYKFEYELVQYKWPRWLTQQTEKQRIIWGYKILFLDVLFPLDVKKIIFVDADQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKELVDYDLGNAPYGYVVRADMKELVDYDLGNAPYGYVPFCDSRTEMDGFRFWNQGYWRNHLQGRKYHISALYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDRSKSSAKTIDLCNNPLTKEAKLSAAMRILYSVYAFIFRAYKFEYELVQYKWPRWLTQQTEKQRIIWGYKILFLDVLFPLDVKKIIFVDADQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-glucose:glycoprotein glucosyltransferase 1 Recognizes glycoproteins with minor folding defects. Reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.confidentQ6P5E4
UDP-glucose:glycoprotein glucosyltransferase 1 Recognizes glycoproteins with minor folding defects. Reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.confidentQ9JLA3
UDP-glucose:glycoprotein glucosyltransferase Selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER. Unfolded, denatured glycoproteins are substantially better substrates for glucosylation by this enzyme than are the corresponding native proteins. This protein and transient glucosylation may be involved in monitoring and/or assisting the folding and assembly of newly made glycoproteins, in order to identify glycoproteins that need assistance in folding from chaperones.confidentQ09140

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003980 [MF]UDP-glucose:glycoprotein glucosyltransferase activityprobableGO:0035251, GO:0046527, GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0005791 [CC]rough endoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005793 [CC]endoplasmic reticulum-Golgi intermediate compartmentprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035250 [MF]UDP-galactosyltransferase activityprobableGO:0003674, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0005537 [MF]mannose bindingprobableGO:0005488, GO:0003674, GO:0048029, GO:0030246
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0051787 [MF]misfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006078 [BP](1->6)-beta-D-glucan biosynthetic processprobableGO:0044249, GO:0009250, GO:0034645, GO:0016051, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0071704, GO:0006077, GO:0006073, GO:0044042, GO:0043170, GO:0009987, GO:0000271, GO:0034637, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0044723, GO:0051273, GO:0044238, GO:0005975, GO:0051274, GO:0005976, GO:0044237, GO:0033692
GO:0045995 [BP]regulation of embryonic developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0030968 [BP]endoplasmic reticulum unfolded protein responseprobableGO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0006984, GO:0051716, GO:0006986, GO:0071310, GO:0065007, GO:0009987, GO:0050794, GO:0006950, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0050896, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0034976, GO:0034620
GO:0071218 [BP]cellular response to misfolded proteinprobableGO:0051716, GO:0070887, GO:0006950, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0035967, GO:0035966, GO:0044763, GO:0033554, GO:0042221, GO:0051788, GO:0010033, GO:0044699
GO:0061062 [BP]regulation of nematode larval developmentprobableGO:0050793, GO:0048580, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0051084 [BP]'de novo' posttranslational protein foldingprobableGO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0043687 [BP]post-translational protein modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0042594 [BP]response to starvationprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0006950, GO:0008150
GO:0018279 [BP]protein N-linked glycosylation via asparagineprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0006487, GO:0018196, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0097359 [BP]UDP-glucosylationprobableGO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0006011, GO:0009225, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901135, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G9R, chain A
Confidence level:confident
Coverage over the Query: 9-150
View the alignment between query and template
View the model in PyMOL
Template: 1G9R, chain A
Confidence level:confident
Coverage over the Query: 175-227
View the alignment between query and template
View the model in PyMOL