Diaphorina citri psyllid: psy3475


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
VSWIRKRDLHILTVGILTYTNDLRFTSLHSDGSDEWTLKIASSQLRDSGTYECQVSTEPKISIGYKLNVVISKAKIIGNSELYIKSGSDINLTCVVLETPDPPSFIYWYRGANVVNYSQRGGISVVTEKQTRTSRLVISKAVTSDSGNYTCAPSSSDGASVVVHVLNGKKFNKLSSLRGRVGITLKFALRRSRVRFPEESIFFAWSS
cCEEEccccEEEEEccEEECccccEEEEECccccccEEEEccccccccCEEEEEECccccCEEEEEEEEEEEEEEEEccccEEEECcccEEEEEEccccccccCEEEEEEccEEEEECccccEEEEECcccCEEEEEEccccccccCEEEECcccccccEEEEEEccccccccEECccccccccEEEEEEEEEEECcccEEEEEEcc
VSWIRKRDLHILTVGILTYTNDLRFTSLHSDGSDEWTLKIASSQLRDSGTYECQVSTEPKISIGYKLNVVISKAKIIGNSELYIKSGSDINLTCVVLETPDPPSFIYWYRGANVVNYSQRGGISVVTEKQTRTSRLVISKAVTSDSGNYTCAPSSSDGASVVVHVLNGKKFNKLSSLRGRVGITLKFALRRSRVRFPEESIFFAWSS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VSWIRKRDLHILTVGILTYTNDLRFTSLHSDGSDEWTLKIASSQLRDSGTYECQVSTEPKISIGYKLNVVISKAKIIGNSELYIKSGSDINLTCVVLETPDPPSFIYWYRGANVVNYSQRGGISVVTEKQTRTSRLVISKAVTSDSGNYTCAPSSSDGASVVVHVLNGKKFNKLSSLRGRVGITLKFALRRSRVRFPEESIFFAWSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 37-118,133-158
View the alignment between query and template
View the model in PyMOL
Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 85-162
View the alignment between query and template
View the model in PyMOL
Template: 2EC8, chain A
Confidence level:very confident
Coverage over the Query: 1-169
View the alignment between query and template
View the model in PyMOL
Template: 1GSM, chain A
Confidence level:confident
Coverage over the Query: 82-206
View the alignment between query and template
View the model in PyMOL