BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy348
         (293 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1EPX|A Chain A, Crystal Structure Analysis Of Aldolase From L. Mexicana
 pdb|1EPX|B Chain B, Crystal Structure Analysis Of Aldolase From L. Mexicana
 pdb|1EPX|C Chain C, Crystal Structure Analysis Of Aldolase From L. Mexicana
 pdb|1EPX|D Chain D, Crystal Structure Analysis Of Aldolase From L. Mexicana
          Length = 370

 Score = 30.8 bits (68), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 11/55 (20%)

Query: 147 PYEALYYT-----HLLP--LPAFAFLYKNLYE----HWLIAVNSTPLPLPSYLSF 190
           P +  +YT       +P  LP   FL   L E     +L A+N++PLP P +LSF
Sbjct: 255 PEQVAHYTVMTLARTMPAMLPGVMFLSGGLSEVQASEYLNAINNSPLPRPYFLSF 309


>pdb|2QAP|A Chain A, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana
 pdb|2QAP|B Chain B, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana
 pdb|2QAP|C Chain C, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana
 pdb|2QAP|D Chain D, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana
 pdb|2QDG|A Chain A, Fructose-1,6-bisphosphate Schiff Base Intermediate In Fbp
           Aldolase From Leishmania Mexicana
 pdb|2QDG|B Chain B, Fructose-1,6-bisphosphate Schiff Base Intermediate In Fbp
           Aldolase From Leishmania Mexicana
 pdb|2QDG|C Chain C, Fructose-1,6-bisphosphate Schiff Base Intermediate In Fbp
           Aldolase From Leishmania Mexicana
 pdb|2QDG|D Chain D, Fructose-1,6-bisphosphate Schiff Base Intermediate In Fbp
           Aldolase From Leishmania Mexicana
 pdb|2QDH|A Chain A, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana In Complex With Mannitol-1,6-Bisphosphate, A
           Competitive Inhibitor
 pdb|2QDH|B Chain B, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana In Complex With Mannitol-1,6-Bisphosphate, A
           Competitive Inhibitor
 pdb|2QDH|C Chain C, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana In Complex With Mannitol-1,6-Bisphosphate, A
           Competitive Inhibitor
 pdb|2QDH|D Chain D, Fructose-1,6-Bisphosphate Aldolase From Leishmania
           Mexicana In Complex With Mannitol-1,6-Bisphosphate, A
           Competitive Inhibitor
          Length = 391

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 4/36 (11%)

Query: 159 LPAFAFLYKNLYE----HWLIAVNSTPLPLPSYLSF 190
           LP   FL   L E     +L A+N++PLP P +LSF
Sbjct: 294 LPGVMFLSGGLSEVQASEYLNAINNSPLPRPYFLSF 329


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.142    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,313,877
Number of Sequences: 62578
Number of extensions: 273745
Number of successful extensions: 663
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 663
Number of HSP's gapped (non-prelim): 2
length of query: 293
length of database: 14,973,337
effective HSP length: 98
effective length of query: 195
effective length of database: 8,840,693
effective search space: 1723935135
effective search space used: 1723935135
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)