Query         psy3483
Match_columns 99
No_of_seqs    102 out of 1785
Neff          11.2
Searched_HMMs 46136
Date          Fri Aug 16 17:53:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3483.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3483hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 6.4E-24 1.4E-28  122.2   3.9   82    8-99    162-243 (279)
  2 KOG2462|consensus               99.8 7.6E-22 1.6E-26  113.8   3.4   83    3-93    183-265 (279)
  3 KOG3623|consensus               99.7 1.2E-17 2.6E-22  107.0   0.7   82    3-92    890-971 (1007)
  4 KOG3576|consensus               99.6 5.6E-17 1.2E-21   90.6   0.7   85    4-96    114-198 (267)
  5 KOG3623|consensus               99.5   1E-14 2.3E-19   93.9   0.5   85    6-92    239-330 (1007)
  6 PHA00733 hypothetical protein   99.2 8.3E-12 1.8E-16   66.5   3.6   87    5-96     38-124 (128)
  7 KOG3576|consensus               99.2 2.9E-12 6.3E-17   72.0   1.7   88    2-97    140-238 (267)
  8 KOG1074|consensus               99.2 2.7E-12 5.9E-17   83.9  -0.3   83    6-96    604-693 (958)
  9 KOG3608|consensus               99.2 7.6E-12 1.6E-16   75.3   1.3   90    2-95    202-316 (467)
 10 PHA02768 hypothetical protein;  99.1 5.5E-11 1.2E-15   53.8   1.5   43   43-88      6-48  (55)
 11 KOG1074|consensus               99.0 2.2E-10 4.9E-15   75.2   2.0   56   43-99    880-935 (958)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.0 8.2E-10 1.8E-14   43.0   2.6   26   58-83      1-26  (26)
 13 PHA00616 hypothetical protein   98.9 8.7E-10 1.9E-14   47.6   1.5   29   71-99      1-29  (44)
 14 KOG3608|consensus               98.8 4.9E-09 1.1E-13   63.6   3.3   86    2-96    287-377 (467)
 15 PLN03086 PRLI-interacting fact  98.8 1.1E-08 2.3E-13   65.9   4.5   77    5-94    451-537 (567)
 16 PHA02768 hypothetical protein;  98.7 2.3E-09 4.9E-14   48.5  -0.1   40    7-55      5-44  (55)
 17 PHA00733 hypothetical protein   98.5 1.5E-07 3.4E-12   50.2   3.0   54    3-66     69-122 (128)
 18 PLN03086 PRLI-interacting fact  98.4   5E-07 1.1E-11   58.5   5.0   77    6-93    477-562 (567)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.4 6.1E-08 1.3E-12   37.6  -0.0   18    1-18      8-25  (26)
 20 PHA00616 hypothetical protein   98.4 1.7E-07 3.7E-12   40.6   1.1   32   43-75      2-33  (44)
 21 PHA00732 hypothetical protein   98.4 4.1E-07 8.9E-12   44.6   2.4   44    7-64      1-45  (79)
 22 PF00096 zf-C2H2:  Zinc finger,  98.3   9E-07 1.9E-11   33.2   2.1   23   72-94      1-23  (23)
 23 KOG3993|consensus               98.1 8.3E-07 1.8E-11   55.2   0.5   25   71-95    356-380 (500)
 24 PF13912 zf-C2H2_6:  C2H2-type   98.1 2.6E-06 5.6E-11   33.2   1.6   26   71-96      1-26  (27)
 25 PF13894 zf-C2H2_4:  C2H2-type   98.0 8.3E-06 1.8E-10   30.5   2.4   24   72-95      1-24  (24)
 26 PF09237 GAGA:  GAGA factor;  I  98.0 1.2E-05 2.7E-10   35.7   2.8   33   67-99     20-52  (54)
 27 PF05605 zf-Di19:  Drought indu  97.9 3.6E-05 7.8E-10   35.0   4.1   49   43-95      3-53  (54)
 28 PHA00732 hypothetical protein   97.8 1.2E-05 2.6E-10   39.5   1.4   47   42-95      1-48  (79)
 29 KOG3993|consensus               97.6 2.7E-05 5.8E-10   48.8   1.3   60    6-67    294-380 (500)
 30 smart00355 ZnF_C2H2 zinc finge  97.6 8.6E-05 1.9E-09   28.0   2.3   24   72-95      1-24  (26)
 31 PF00096 zf-C2H2:  Zinc finger,  97.6   6E-05 1.3E-09   28.0   1.6   20   44-64      2-21  (23)
 32 PF05605 zf-Di19:  Drought indu  97.6 7.3E-05 1.6E-09   34.0   2.1   50    7-66      2-52  (54)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.4 0.00017 3.7E-09   36.5   2.6   73    9-94      1-73  (100)
 34 COG5189 SFP1 Putative transcri  97.3 0.00014 3.1E-09   44.2   1.8   70    5-92    347-419 (423)
 35 PRK04860 hypothetical protein;  97.3 0.00033 7.1E-09   39.0   2.7   40   41-85    118-157 (160)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.2  0.0001 2.2E-09   28.5   0.4   20    7-27      1-20  (27)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.1 0.00065 1.4E-08   25.4   2.2   23   72-95      1-23  (24)
 38 PF12874 zf-met:  Zinc-finger o  97.1  0.0004 8.7E-09   26.2   1.6   23   72-94      1-23  (25)
 39 PF13894 zf-C2H2_4:  C2H2-type   97.0 0.00061 1.3E-08   25.1   1.8   22   43-65      1-22  (24)
 40 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00044 9.5E-09   26.8  -0.2   22   72-93      2-23  (27)
 41 PF09237 GAGA:  GAGA factor;  I  96.3  0.0083 1.8E-07   26.8   2.9   34   37-71     19-52  (54)
 42 PRK04860 hypothetical protein;  96.0  0.0034 7.3E-08   35.0   1.1   36    7-53    119-154 (160)
 43 PF13913 zf-C2HC_2:  zinc-finge  95.6   0.015 3.3E-07   22.0   1.9   18   73-91      4-21  (25)
 44 smart00451 ZnF_U1 U1-like zinc  95.1   0.024 5.3E-07   22.9   1.9   23   71-93      3-25  (35)
 45 COG4049 Uncharacterized protei  94.2   0.027 5.8E-07   25.6   1.0   27   66-92     12-38  (65)
 46 cd00350 rubredoxin_like Rubred  94.0   0.062 1.3E-06   21.7   1.8   24   43-79      2-25  (33)
 47 PF09986 DUF2225:  Uncharacteri  93.8   0.052 1.1E-06   31.8   2.0   17    5-21      3-19  (214)
 48 PF09538 FYDLN_acid:  Protein o  93.5   0.055 1.2E-06   28.3   1.5   28    9-54     11-38  (108)
 49 KOG1146|consensus               93.4   0.036 7.8E-07   40.0   0.9   26   68-93    515-540 (1406)
 50 COG2888 Predicted Zn-ribbon RN  93.0   0.054 1.2E-06   25.0   0.9   31   43-79     28-58  (61)
 51 COG5048 FOG: Zn-finger [Genera  91.9   0.035 7.5E-07   34.9  -0.6   55   42-97    289-349 (467)
 52 cd00729 rubredoxin_SM Rubredox  91.8    0.18   4E-06   20.5   1.8   10   70-79     17-26  (34)
 53 TIGR02098 MJ0042_CXXC MJ0042 f  90.5    0.25 5.3E-06   20.5   1.6   13    8-20      3-15  (38)
 54 TIGR00373 conserved hypothetic  90.5     0.2 4.3E-06   28.0   1.6   13    8-20    110-122 (158)
 55 PF13717 zinc_ribbon_4:  zinc-r  90.5    0.29 6.3E-06   20.2   1.7   12    9-20      4-15  (36)
 56 PF13719 zinc_ribbon_5:  zinc-r  90.4    0.25 5.3E-06   20.5   1.5   11    9-19      4-14  (37)
 57 PHA00626 hypothetical protein   90.1   0.092   2E-06   23.9   0.1   12   71-82     23-34  (59)
 58 PRK14890 putative Zn-ribbon RN  90.1    0.19 4.1E-06   23.2   1.0   32   42-79     25-56  (59)
 59 PRK06266 transcription initiat  90.0    0.22 4.9E-06   28.4   1.6   15    7-21    117-131 (178)
 60 PF09723 Zn-ribbon_8:  Zinc rib  89.0    0.17 3.7E-06   21.7   0.5   11    8-18      6-16  (42)
 61 COG5048 FOG: Zn-finger [Genera  89.0    0.21 4.5E-06   31.4   1.1   61    7-75    289-355 (467)
 62 COG1592 Rubrerythrin [Energy p  88.9    0.37   8E-06   27.2   1.9   23   42-78    134-156 (166)
 63 KOG2186|consensus               88.6    0.47   1E-05   28.5   2.2   56    7-73      3-58  (276)
 64 PF10571 UPF0547:  Uncharacteri  87.5    0.53 1.1E-05   18.0   1.4   11   72-82     15-25  (26)
 65 PRK00398 rpoP DNA-directed RNA  86.4     1.2 2.6E-05   19.3   2.4    8   43-50     22-29  (46)
 66 COG1997 RPL43A Ribosomal prote  86.3    0.69 1.5E-05   23.2   1.7   32   41-83     34-65  (89)
 67 PF03811 Zn_Tnp_IS1:  InsA N-te  85.3       1 2.2E-05   18.6   1.8   15   34-48     21-35  (36)
 68 KOG4167|consensus               84.8    0.17 3.7E-06   34.8  -1.0   25   71-95    792-816 (907)
 69 smart00531 TFIIE Transcription  84.5     1.3 2.8E-05   24.4   2.5   39   38-81     95-133 (147)
 70 PF09845 DUF2072:  Zn-ribbon co  84.3    0.65 1.4E-05   25.1   1.2   15    7-21      1-15  (131)
 71 PF12013 DUF3505:  Protein of u  83.9     1.3 2.7E-05   23.0   2.2   25   72-96     81-109 (109)
 72 PF14353 CpXC:  CpXC protein     83.6    0.73 1.6E-05   24.6   1.2   13    8-20      2-14  (128)
 73 TIGR02605 CxxC_CxxC_SSSS putat  83.6    0.56 1.2E-05   20.8   0.7   12    7-18      5-16  (52)
 74 smart00659 RPOLCX RNA polymera  83.5     1.8 3.8E-05   18.8   2.2   10   70-79     18-27  (44)
 75 TIGR02300 FYDLN_acid conserved  83.4    0.75 1.6E-05   24.8   1.2   28    9-54     11-38  (129)
 76 KOG3408|consensus               82.3    0.76 1.6E-05   24.5   0.9   26   68-93     54-79  (129)
 77 COG1198 PriA Primosomal protei  82.2     1.4   3E-05   30.8   2.4   12    9-20    437-448 (730)
 78 PF05443 ROS_MUCR:  ROS/MUCR tr  81.7     1.1 2.3E-05   24.4   1.4   23   71-96     72-94  (132)
 79 KOG2893|consensus               81.6    0.26 5.5E-06   29.5  -1.0   44    6-62     10-53  (341)
 80 PF07754 DUF1610:  Domain of un  81.5    0.89 1.9E-05   17.1   0.8   10    6-15     15-24  (24)
 81 smart00614 ZnF_BED BED zinc fi  80.6     2.3   5E-05   18.7   2.1   21   72-92     19-44  (50)
 82 PF15269 zf-C2H2_7:  Zinc-finge  80.4     1.5 3.2E-05   19.1   1.4   21   72-92     21-41  (54)
 83 PF02892 zf-BED:  BED zinc fing  80.4     2.3 5.1E-05   18.0   2.1   23   69-91     14-40  (45)
 84 PF06524 NOA36:  NOA36 protein;  79.7    0.54 1.2E-05   28.5  -0.1   28   67-94    205-232 (314)
 85 PF04959 ARS2:  Arsenite-resist  79.1    0.73 1.6E-05   27.1   0.3   23   71-93     77-99  (214)
 86 PRK09678 DNA-binding transcrip  78.8    0.74 1.6E-05   22.3   0.2   18   38-55     23-42  (72)
 87 KOG4173|consensus               78.6    0.53 1.1E-05   27.5  -0.4   74    8-92     80-167 (253)
 88 PF09963 DUF2197:  Uncharacteri  78.4     1.8   4E-05   19.8   1.4    7   71-77     31-37  (56)
 89 PF15135 UPF0515:  Uncharacteri  78.3     4.1 8.9E-05   24.7   3.1   17    4-20    109-125 (278)
 90 PRK00464 nrdR transcriptional   78.2    0.46 9.9E-06   26.5  -0.7   13   43-55     29-41  (154)
 91 PF03604 DNA_RNApol_7kD:  DNA d  77.7     2.8   6E-05   16.9   1.7    9   71-79     17-25  (32)
 92 PTZ00255 60S ribosomal protein  77.3     1.6 3.4E-05   22.1   1.1   31   41-82     35-65  (90)
 93 COG3364 Zn-ribbon containing p  76.6     1.4   3E-05   22.8   0.8   16    6-21      1-16  (112)
 94 COG4888 Uncharacterized Zn rib  75.9     2.2 4.8E-05   22.0   1.4   12    6-17     21-32  (104)
 95 PF01780 Ribosomal_L37ae:  Ribo  75.5     1.1 2.5E-05   22.6   0.4   31   41-82     34-64  (90)
 96 KOG2186|consensus               75.3     1.2 2.7E-05   26.9   0.5   44   43-90      4-47  (276)
 97 PF05495 zf-CHY:  CHY zinc fing  75.1     2.6 5.5E-05   20.2   1.5   60    7-81     10-71  (71)
 98 KOG2593|consensus               74.9       2 4.4E-05   27.9   1.4   10   41-50    127-136 (436)
 99 PF05129 Elf1:  Transcription e  74.0     1.4 3.1E-05   21.8   0.5   12   42-53     46-57  (81)
100 PRK14873 primosome assembly pr  73.8     2.6 5.7E-05   29.2   1.8   10    9-18    385-394 (665)
101 PF07975 C1_4:  TFIIH C1-like d  73.7    0.48   1E-05   21.3  -1.1   24   71-94     21-44  (51)
102 TIGR00280 L37a ribosomal prote  73.4     1.8 3.8E-05   22.0   0.7   30   42-82     35-64  (91)
103 smart00734 ZnF_Rad18 Rad18-lik  73.2     4.3 9.4E-05   15.3   1.7   19   73-92      3-21  (26)
104 PF10276 zf-CHCC:  Zinc-finger   72.9     2.6 5.7E-05   17.9   1.1   12    6-17     28-39  (40)
105 COG1996 RPC10 DNA-directed RNA  71.9     3.9 8.4E-05   18.2   1.6    8   43-50      7-14  (49)
106 COG0068 HypF Hydrogenase matur  71.7     1.4   3E-05   30.6   0.2   56   10-80    126-182 (750)
107 PF08790 zf-LYAR:  LYAR-type C2  71.5       3 6.6E-05   16.2   1.0   18    8-27      1-18  (28)
108 smart00154 ZnF_AN1 AN1-like Zi  71.4     2.2 4.8E-05   17.9   0.7   15    7-21     12-26  (39)
109 TIGR00622 ssl1 transcription f  71.3     4.2 9.2E-05   21.5   1.9   27   69-95     79-105 (112)
110 smart00834 CxxC_CXXC_SSSS Puta  71.2     2.2 4.8E-05   17.6   0.7   14    7-20      5-18  (41)
111 PLN02294 cytochrome c oxidase   70.6     2.6 5.5E-05   24.0   1.0   16    5-20    139-154 (174)
112 PF01363 FYVE:  FYVE zinc finge  70.5     3.5 7.6E-05   19.3   1.4   11   71-81     25-35  (69)
113 KOG1280|consensus               69.8     3.4 7.5E-05   26.2   1.5   22    5-27     77-98  (381)
114 PRK03976 rpl37ae 50S ribosomal  69.4     2.3 5.1E-05   21.5   0.7   31   41-82     35-65  (90)
115 TIGR01206 lysW lysine biosynth  69.0     6.3 0.00014   17.9   2.0   11    8-18      3-13  (54)
116 TIGR00595 priA primosomal prot  68.7     4.3 9.4E-05   27.1   1.9   10    9-18    215-224 (505)
117 COG3091 SprT Zn-dependent meta  67.0     3.9 8.5E-05   22.8   1.3   33   41-79    116-148 (156)
118 PF01096 TFIIS_C:  Transcriptio  65.3     3.9 8.5E-05   17.1   0.9    8   43-50     29-36  (39)
119 smart00440 ZnF_C2C2 C2C2 Zinc   65.1     6.7 0.00015   16.5   1.6    8   43-50     29-36  (40)
120 PF01428 zf-AN1:  AN1-like Zinc  64.3     2.9 6.4E-05   17.8   0.4   16    6-21     12-27  (43)
121 COG4896 Uncharacterized protei  63.9     5.7 0.00012   18.6   1.3    9   42-50     31-39  (68)
122 PF13451 zf-trcl:  Probable zin  63.4     4.2 9.1E-05   18.1   0.8   15    5-19      2-16  (49)
123 smart00661 RPOL9 RNA polymeras  62.9      10 0.00022   16.5   2.0   10   71-80     20-29  (52)
124 COG3357 Predicted transcriptio  62.6     6.4 0.00014   20.0   1.4   27   41-78     57-83  (97)
125 KOG3507|consensus               62.5       7 0.00015   18.1   1.4   31   41-83     19-49  (62)
126 PF08271 TF_Zn_Ribbon:  TFIIB z  61.5     7.4 0.00016   16.5   1.4   10    8-17      1-10  (43)
127 PF05191 ADK_lid:  Adenylate ki  60.9     8.4 0.00018   15.9   1.5   10    9-18      3-12  (36)
128 KOG2482|consensus               59.3     5.3 0.00012   25.5   1.0   33    7-40    195-227 (423)
129 PRK12380 hydrogenase nickel in  58.0     8.9 0.00019   20.2   1.6   24   43-79     71-94  (113)
130 PF04423 Rad50_zn_hook:  Rad50   55.7     4.5 9.8E-05   18.1   0.2   12    9-20     22-33  (54)
131 TIGR00100 hypA hydrogenase nic  55.4      11 0.00023   20.0   1.6   24   43-79     71-94  (115)
132 PRK03824 hypA hydrogenase nick  55.3      11 0.00023   20.6   1.7   13    7-19     70-82  (135)
133 COG4391 Uncharacterized protei  55.1     7.9 0.00017   18.1   1.0   12    7-18     48-59  (62)
134 KOG2482|consensus               54.9     8.5 0.00018   24.6   1.3   23   72-94    196-218 (423)
135 PF11672 DUF3268:  Protein of u  54.6      17 0.00036   19.0   2.2   13    6-18      1-13  (102)
136 COG1998 RPS31 Ribosomal protei  54.5     7.4 0.00016   17.4   0.8   25   44-79     21-45  (51)
137 COG4530 Uncharacterized protei  53.9     7.6 0.00016   20.5   0.9   14   69-82     24-37  (129)
138 smart00064 FYVE Protein presen  53.9      12 0.00025   17.4   1.5    6   45-50     29-34  (68)
139 PRK00564 hypA hydrogenase nick  53.8      11 0.00023   20.0   1.5   11   43-53     72-82  (117)
140 KOG1146|consensus               53.1     7.9 0.00017   29.2   1.1   53   41-95   1283-1352(1406)
141 KOG4167|consensus               52.7     2.9 6.3E-05   29.3  -0.9   25   42-67    792-816 (907)
142 cd00065 FYVE FYVE domain; Zinc  52.5      14  0.0003   16.4   1.6    8   44-51     20-27  (57)
143 PF14446 Prok-RING_1:  Prokaryo  52.1      15 0.00032   16.8   1.6    7   72-78     22-28  (54)
144 TIGR00416 sms DNA repair prote  51.2      15 0.00032   24.4   2.1    8   43-50      8-15  (454)
145 PRK12496 hypothetical protein;  50.8      13 0.00027   21.1   1.5   11    8-18    128-138 (164)
146 PF13878 zf-C2H2_3:  zinc-finge  50.3      22 0.00047   15.0   2.1    7   44-50     15-21  (41)
147 PRK11823 DNA repair protein Ra  50.0      16 0.00035   24.1   2.1    8   43-50      8-15  (446)
148 PRK14714 DNA polymerase II lar  49.7      27  0.0006   26.5   3.3   34    8-51    668-701 (1337)
149 PF07295 DUF1451:  Protein of u  49.3     9.7 0.00021   21.2   0.9    8   43-50    113-120 (146)
150 COG5112 UFD2 U1-like Zn-finger  49.1     5.8 0.00012   20.8   0.0   23   71-93     55-77  (126)
151 PF10013 DUF2256:  Uncharacteri  48.7     8.2 0.00018   16.6   0.5   12    9-20     10-21  (42)
152 PRK05580 primosome assembly pr  48.7      14 0.00031   25.8   1.8    8   10-17    384-391 (679)
153 cd00924 Cyt_c_Oxidase_Vb Cytoc  48.6      12 0.00027   19.2   1.2   17   66-83     75-91  (97)
154 PRK03681 hypA hydrogenase nick  48.1      15 0.00033   19.4   1.5   25   43-79     71-95  (114)
155 PTZ00043 cytochrome c oxidase   47.1      10 0.00022   22.8   0.8   17    5-21    179-195 (268)
156 COG5152 Uncharacterized conser  46.8     9.3  0.0002   22.5   0.6   12    7-18    196-207 (259)
157 PRK04023 DNA polymerase II lar  46.5      27 0.00057   26.0   2.8    9    8-16    627-635 (1121)
158 COG2879 Uncharacterized small   45.3      27 0.00059   16.5   1.9   16   84-99     25-40  (65)
159 PF14369 zf-RING_3:  zinc-finge  45.2      10 0.00022   15.5   0.5   11    9-19     23-33  (35)
160 PF01155 HypA:  Hydrogenase exp  44.2     6.4 0.00014   20.7  -0.3   25   43-80     71-95  (113)
161 COG1773 Rubredoxin [Energy pro  44.1      13 0.00027   17.1   0.7   12   71-82      3-14  (55)
162 PF04780 DUF629:  Protein of un  42.2      23 0.00049   23.8   1.9   23   71-93     57-79  (466)
163 PRK00432 30S ribosomal protein  41.3      33  0.0007   15.3   1.8   11   70-80     36-46  (50)
164 cd01121 Sms Sms (bacterial rad  40.9      25 0.00053   22.8   1.9    7   44-50     16-22  (372)
165 COG4957 Predicted transcriptio  40.4      25 0.00055   19.4   1.6   22   72-96     77-98  (148)
166 PF07282 OrfB_Zn_ribbon:  Putat  40.2      34 0.00075   15.9   2.0   16   67-82     42-57  (69)
167 COG5216 Uncharacterized conser  40.0      17 0.00038   16.8   0.8   13   67-79     40-52  (67)
168 PRK14892 putative transcriptio  39.7      35 0.00075   17.7   2.0    7    8-14     22-28  (99)
169 PF01286 XPA_N:  XPA protein N-  39.7      15 0.00033   15.0   0.6   12   73-84      5-16  (34)
170 COG1675 TFA1 Transcription ini  39.1      22 0.00048   20.5   1.3    8   72-79    133-140 (176)
171 KOG2231|consensus               38.4      32  0.0007   24.2   2.2   18    9-27    184-201 (669)
172 COG5432 RAD18 RING-finger-cont  37.5     7.7 0.00017   24.2  -0.6   16   34-50     52-67  (391)
173 PHA02998 RNA polymerase subuni  37.4      30 0.00065   20.1   1.7   12   72-83    172-183 (195)
174 COG3677 Transposase and inacti  37.1      19 0.00042   19.5   0.9   18   67-84     49-66  (129)
175 PF14255 Cys_rich_CPXG:  Cystei  37.1      15 0.00033   16.6   0.4   10    9-18      2-11  (52)
176 KOG2785|consensus               37.0      60  0.0013   21.3   3.1   23   71-93    217-242 (390)
177 PF14803 Nudix_N_2:  Nudix N-te  37.0      32 0.00069   14.0   1.3    7   43-49     23-29  (34)
178 COG1571 Predicted DNA-binding   36.5      30 0.00066   22.9   1.8   14   71-84    367-380 (421)
179 PF04216 FdhE:  Protein involve  36.3      14  0.0003   22.9   0.3   13   68-80    235-247 (290)
180 PF12773 DZR:  Double zinc ribb  36.3      42 0.00092   14.4   1.9    8   72-79     30-37  (50)
181 PF12647 RNHCP:  RNHCP domain;   36.1      38 0.00083   17.3   1.8   26    6-31      3-30  (92)
182 COG1326 Uncharacterized archae  35.2      67  0.0015   19.0   2.8   10   72-81     31-40  (201)
183 PRK06260 threonine synthase; V  33.8      40 0.00087   21.9   2.1    9   42-50     19-27  (397)
184 PLN03238 probable histone acet  33.6      62  0.0013   20.4   2.7   25   69-93     46-70  (290)
185 KOG3362|consensus               33.5      14  0.0003   20.6  -0.0   20   72-91    130-149 (156)
186 PF00301 Rubredoxin:  Rubredoxi  33.3      23  0.0005   15.6   0.7   11   72-82      2-12  (47)
187 KOG0717|consensus               33.0      31 0.00067   23.2   1.4   21   72-92    293-313 (508)
188 PF02748 PyrI_C:  Aspartate car  32.9      28  0.0006   15.7   0.9   16    4-19     32-47  (52)
189 PF09416 UPF1_Zn_bind:  RNA hel  32.7      47   0.001   18.7   1.9   50    2-51      9-69  (152)
190 PRK05978 hypothetical protein;  32.7      28 0.00062   19.5   1.1    8    9-16     35-42  (148)
191 PF01927 Mut7-C:  Mut7-C RNAse   32.5      25 0.00055   19.3   0.9   21   69-89    122-142 (147)
192 cd00730 rubredoxin Rubredoxin;  32.4      22 0.00048   15.8   0.5   11   72-82      2-12  (50)
193 PF02148 zf-UBP:  Zn-finger in   31.5      20 0.00044   16.5   0.4   16   69-84      9-24  (63)
194 PF02591 DUF164:  Putative zinc  31.4      59  0.0013   14.5   2.6   16   65-80     40-55  (56)
195 PRK03564 formate dehydrogenase  31.4      84  0.0018   20.0   3.0   10    7-16    187-196 (309)
196 PRK05654 acetyl-CoA carboxylas  30.9      74  0.0016   20.0   2.8   12   43-54     47-58  (292)
197 KOG4727|consensus               30.9      31 0.00068   19.9   1.1   22   71-92     75-96  (193)
198 COG4338 Uncharacterized protei  30.8      16 0.00035   16.2  -0.0   13    9-21     14-26  (54)
199 TIGR00515 accD acetyl-CoA carb  30.2      30 0.00066   21.6   1.0   12    9-20     28-39  (285)
200 PF11494 Ta0938:  Ta0938;  Inte  29.8      42 0.00091   17.4   1.3   39    4-55     11-50  (105)
201 PF06397 Desulfoferrod_N:  Desu  29.5      28 0.00061   14.4   0.6   10   71-80      6-15  (36)
202 PF08209 Sgf11:  Sgf11 (transcr  29.5      51  0.0011   13.3   1.5   20   43-64      5-24  (33)
203 COG1594 RPB9 DNA-directed RNA   28.9      53  0.0011   17.4   1.7   12   71-82    100-111 (113)
204 PF02176 zf-TRAF:  TRAF-type zi  28.8      66  0.0014   14.3   2.3   20   57-76     24-43  (60)
205 PF02891 zf-MIZ:  MIZ/SP-RING z  28.6      31 0.00067   15.2   0.7    8   72-79     42-49  (50)
206 PF12230 PRP21_like_P:  Pre-mRN  28.4      19 0.00041   21.4   0.0   30   42-73    168-197 (229)
207 PTZ00303 phosphatidylinositol   28.4      47   0.001   24.3   1.8    6   45-50    484-489 (1374)
208 PF14787 zf-CCHC_5:  GAG-polypr  28.4      33 0.00072   14.2   0.7   14   73-86      4-17  (36)
209 CHL00174 accD acetyl-CoA carbo  28.2      89  0.0019   19.8   2.8   11   43-53     58-68  (296)
210 COG1655 Uncharacterized protei  28.1      27 0.00059   21.2   0.6   17    5-21     17-33  (267)
211 KOG1842|consensus               27.6      34 0.00073   22.9   1.0   21   72-92     16-36  (505)
212 KOG2071|consensus               26.9      75  0.0016   22.1   2.4   29   67-95    414-442 (579)
213 KOG0227|consensus               26.6      39 0.00084   19.9   1.0   20   72-91     54-73  (222)
214 PTZ00448 hypothetical protein;  26.3      55  0.0012   21.4   1.7   24   71-94    314-337 (373)
215 PF08792 A2L_zn_ribbon:  A2L zi  26.2      39 0.00085   13.6   0.7   10   72-81     22-31  (33)
216 PF08274 PhnA_Zn_Ribbon:  PhnA   26.1      32  0.0007   13.5   0.5    7   43-49     20-26  (30)
217 PF04810 zf-Sec23_Sec24:  Sec23  25.9      41 0.00088   14.0   0.8   12    5-16     22-33  (40)
218 PRK04351 hypothetical protein;  25.9      65  0.0014   18.0   1.8   33   42-83    112-144 (149)
219 TIGR01384 TFS_arch transcripti  25.7      61  0.0013   16.5   1.6   36   43-81     63-100 (104)
220 KOG2907|consensus               25.6      41 0.00088   18.0   0.9   37   43-83     75-114 (116)
221 TIGR00627 tfb4 transcription f  25.2      69  0.0015   20.0   1.9   10   72-81    256-265 (279)
222 PF14690 zf-ISL3:  zinc-finger   24.8      33 0.00072   14.4   0.4   10    7-16      2-11  (47)
223 smart00731 SprT SprT homologue  24.3      68  0.0015   17.6   1.7   32   42-81    112-143 (146)
224 KOG1088|consensus               24.1      50  0.0011   17.8   1.0   12   43-54     99-110 (124)
225 COG0675 Transposase and inacti  24.1   1E+02  0.0023   19.0   2.7   16   69-84    320-335 (364)
226 COG5236 Uncharacterized conser  24.1      70  0.0015   20.8   1.8   75    9-95    222-305 (493)
227 PRK12722 transcriptional activ  24.1      71  0.0015   18.7   1.7   28   43-79    135-162 (187)
228 PF13824 zf-Mss51:  Zinc-finger  24.0      50  0.0011   15.2   0.9   15   67-81     10-24  (55)
229 COG1656 Uncharacterized conser  23.8      47   0.001   19.0   1.0    9   43-51    131-139 (165)
230 KOG1813|consensus               23.7      78  0.0017   20.1   1.9   14    6-19    240-253 (313)
231 PLN00104 MYST -like histone ac  23.6      69  0.0015   21.6   1.8   25   69-93    196-220 (450)
232 PF01215 COX5B:  Cytochrome c o  23.5      31 0.00068   19.0   0.2   16   69-84    110-125 (136)
233 TIGR00143 hypF [NiFe] hydrogen  23.4      24 0.00052   25.0  -0.2   12   10-21     93-104 (711)
234 KOG1994|consensus               22.8      45 0.00098   20.2   0.8   24   67-90    235-258 (268)
235 PF05741 zf-nanos:  Nanos RNA b  22.7      34 0.00074   15.7   0.3   10    7-16     33-42  (55)
236 KOG0320|consensus               22.5      13 0.00029   21.5  -1.3   10   72-81    168-177 (187)
237 PRK00420 hypothetical protein;  22.4      76  0.0017   16.9   1.5    7   44-50     42-48  (112)
238 PTZ00064 histone acetyltransfe  22.3      89  0.0019   21.5   2.1   25   69-93    278-302 (552)
239 COG1579 Zn-ribbon protein, pos  22.3   1E+02  0.0022   18.9   2.2   13   68-80    218-230 (239)
240 PF09082 DUF1922:  Domain of un  22.0      54  0.0012   15.8   0.8   10    8-18      4-13  (68)
241 KOG2272|consensus               22.0 1.4E+02  0.0031   18.6   2.8   19   65-83    215-233 (332)
242 PF14354 Lar_restr_allev:  Rest  21.9      47   0.001   15.0   0.6   10    7-16      3-12  (61)
243 PRK01343 zinc-binding protein;  21.9      43 0.00094   15.5   0.5   12    7-18      9-20  (57)
244 PF10071 DUF2310:  Zn-ribbon-co  21.8      52  0.0011   20.3   1.0    7   72-78    242-248 (258)
245 PF14311 DUF4379:  Domain of un  21.8      53  0.0012   14.6   0.8   12    8-19     29-40  (55)
246 PF11023 DUF2614:  Protein of u  21.8      52  0.0011   17.5   0.9   13    6-18     68-80  (114)
247 PF13248 zf-ribbon_3:  zinc-rib  21.7      32  0.0007   12.7   0.1    6   10-15     19-24  (26)
248 PRK07591 threonine synthase; V  21.5      86  0.0019   20.7   2.0    8   43-50     34-41  (421)
249 PRK12860 transcriptional activ  21.3      80  0.0017   18.5   1.6   27   43-78    135-161 (189)
250 PF01844 HNH:  HNH endonuclease  21.2      44 0.00096   13.9   0.5   11   10-20      1-11  (47)
251 COG5151 SSL1 RNA polymerase II  21.1      73  0.0016   20.4   1.5   27   69-95    386-412 (421)
252 PF14447 Prok-RING_4:  Prokaryo  21.1      48   0.001   15.2   0.6    6   45-50     42-47  (55)
253 PF03884 DUF329:  Domain of unk  20.8      53  0.0011   15.2   0.7   12    8-19      3-14  (57)
254 PF11789 zf-Nse:  Zinc-finger o  20.8 1.1E+02  0.0023   14.0   1.8   31   41-76     23-53  (57)
255 PF04606 Ogr_Delta:  Ogr/Delta-  20.7      59  0.0013   14.0   0.8    7   10-16      2-8   (47)
256 PF10263 SprT-like:  SprT-like   20.7      79  0.0017   17.3   1.5   31   42-81    123-153 (157)
257 PF06220 zf-U1:  U1 zinc finger  20.6      88  0.0019   12.9   1.3   12   71-82      3-14  (38)
258 TIGR03831 YgiT_finger YgiT-typ  20.6      44 0.00095   13.8   0.4   11    8-18     33-43  (46)
259 PRK05452 anaerobic nitric oxid  20.2 1.3E+02  0.0028   20.4   2.6    9   71-79    458-466 (479)
260 PF09297 zf-NADH-PPase:  NADH p  20.1      80  0.0017   12.2   1.3   10   69-78     19-28  (32)

No 1  
>KOG2462|consensus
Probab=99.89  E-value=6.4e-24  Score=122.23  Aligned_cols=82  Identities=32%  Similarity=0.604  Sum_probs=63.8

Q ss_pred             eeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCchHH
Q psy3483           8 VTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNERSNV   87 (99)
Q Consensus         8 ~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~~~l   87 (99)
                      +.|.+|++.+..-- .|.+|      +++|+  -+.+|++||+.|... ..|+.|+++||||+||.|..|+++|..++||
T Consensus       162 ~~C~~C~K~YvSmp-ALkMH------irTH~--l~c~C~iCGKaFSRP-WLLQGHiRTHTGEKPF~C~hC~kAFADRSNL  231 (279)
T KOG2462|consen  162 FSCKYCGKVYVSMP-ALKMH------IRTHT--LPCECGICGKAFSRP-WLLQGHIRTHTGEKPFSCPHCGKAFADRSNL  231 (279)
T ss_pred             ccCCCCCceeeehH-HHhhH------hhccC--CCcccccccccccch-HHhhcccccccCCCCccCCcccchhcchHHH
Confidence            44444444444333 44444      55554  567899999987776 9999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCC
Q psy3483          88 KAHMIRRHSVKP   99 (99)
Q Consensus        88 ~~H~~~~~~~kp   99 (99)
                      ..|++||.+.|+
T Consensus       232 RAHmQTHS~~K~  243 (279)
T KOG2462|consen  232 RAHMQTHSDVKK  243 (279)
T ss_pred             HHHHHhhcCCcc
Confidence            999999998774


No 2  
>KOG2462|consensus
Probab=99.85  E-value=7.6e-22  Score=113.76  Aligned_cols=83  Identities=22%  Similarity=0.389  Sum_probs=77.0

Q ss_pred             CCCceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcccc
Q psy3483           3 STELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSN   82 (99)
Q Consensus         3 ~~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~   82 (99)
                      +...++.|.+|||.|...= .|+-|      +++|+||+||.|..|++.|... ++|+.|+.+|.+.++|+|..|++.|.
T Consensus       183 TH~l~c~C~iCGKaFSRPW-LLQGH------iRTHTGEKPF~C~hC~kAFADR-SNLRAHmQTHS~~K~~qC~~C~KsFs  254 (279)
T KOG2462|consen  183 THTLPCECGICGKAFSRPW-LLQGH------IRTHTGEKPFSCPHCGKAFADR-SNLRAHMQTHSDVKKHQCPRCGKSFA  254 (279)
T ss_pred             ccCCCcccccccccccchH-Hhhcc------cccccCCCCccCCcccchhcch-HHHHHHHHhhcCCccccCcchhhHHH
Confidence            4457899999999999887 89999      9999999999999999988888 99999999999999999999999999


Q ss_pred             CchHHHHHHHH
Q psy3483          83 ERSNVKAHMIR   93 (99)
Q Consensus        83 ~~~~l~~H~~~   93 (99)
                      ..+.|..|...
T Consensus       255 l~SyLnKH~ES  265 (279)
T KOG2462|consen  255 LKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHhhhh
Confidence            99999999753


No 3  
>KOG3623|consensus
Probab=99.66  E-value=1.2e-17  Score=107.04  Aligned_cols=82  Identities=21%  Similarity=0.481  Sum_probs=75.2

Q ss_pred             CCCceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcccc
Q psy3483           3 STELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSN   82 (99)
Q Consensus         3 ~~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~   82 (99)
                      +++..|-|+.|+|.|...+ .|-+|      --.|+|.+||+|.+|.+.|..+ ..|..|.+.|.|++||+|..|++.|.
T Consensus       890 te~gmyaCDqCDK~FqKqS-SLaRH------KYEHsGqRPyqC~iCkKAFKHK-HHLtEHkRLHSGEKPfQCdKClKRFS  961 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQS-SLARH------KYEHSGQRPYQCIICKKAFKHK-HHLTEHKRLHSGEKPFQCDKCLKRFS  961 (1007)
T ss_pred             CccccchHHHHHHHHHhhH-HHHHh------hhhhcCCCCcccchhhHhhhhh-hhhhhhhhhccCCCcchhhhhhhhcc
Confidence            4466799999999998777 77788      6789999999999999999988 99999999999999999999999999


Q ss_pred             CchHHHHHHH
Q psy3483          83 ERSNVKAHMI   92 (99)
Q Consensus        83 ~~~~l~~H~~   92 (99)
                      .+..+..||-
T Consensus       962 HSGSYSQHMN  971 (1007)
T KOG3623|consen  962 HSGSYSQHMN  971 (1007)
T ss_pred             cccchHhhhc
Confidence            9999999975


No 4  
>KOG3576|consensus
Probab=99.63  E-value=5.6e-17  Score=90.56  Aligned_cols=85  Identities=27%  Similarity=0.563  Sum_probs=76.5

Q ss_pred             CCceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccC
Q psy3483           4 TELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus         4 ~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~   83 (99)
                      +...|.|..|+|.|.... +|..|      ++.|..-+.+.|..||+.|-.. -.|..|+++|+|.+||+|..|+++|.+
T Consensus       114 d~d~ftCrvCgK~F~lQR-mlnrh------~kch~~vkr~lct~cgkgfndt-fdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQR-MLNRH------LKCHSDVKRHLCTFCGKGFNDT-FDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             CCCeeeeehhhhhhhHHH-HHHHH------hhhccHHHHHHHhhccCcccch-hhhhhhhccccCccccchhhhhHHHHh
Confidence            455699999999999888 99999      9999998999999999987766 789999999999999999999999999


Q ss_pred             chHHHHHHHHhcC
Q psy3483          84 RSNVKAHMIRRHS   96 (99)
Q Consensus        84 ~~~l~~H~~~~~~   96 (99)
                      +-.|..|++.-+|
T Consensus       186 rcsleshl~kvhg  198 (267)
T KOG3576|consen  186 RCSLESHLKKVHG  198 (267)
T ss_pred             hccHHHHHHHHcC
Confidence            9999999875444


No 5  
>KOG3623|consensus
Probab=99.46  E-value=1e-14  Score=93.88  Aligned_cols=85  Identities=22%  Similarity=0.536  Sum_probs=70.8

Q ss_pred             ceeeCccccccccccchhhhccchhh---ccC-CC---CCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCC
Q psy3483           6 LIVTCMYCSKILTYETETIMNHCKFC---KAV-SR---PTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCD   78 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~~~~~~h~~~~---~~~-~~---~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~   78 (99)
                      ..|.|..|..+|.++. .|..|+.+.   +.. ..   -...+.|+|.+||+.|..+ ..|..|+++|.|++||.|+.|+
T Consensus       239 ~nfsC~lCsytFAyRt-QLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfK-HHLKEHlRIHSGEKPfeCpnCk  316 (1007)
T KOG3623|consen  239 PNFSCMLCSYTFAYRT-QLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFK-HHLKEHLRIHSGEKPFECPNCK  316 (1007)
T ss_pred             CCCcchhhhhhhhhHH-HHHHHHHhhcCCCcccccccchhhhccccccccchhhhhH-HHHHhhheeecCCCCcCCcccc
Confidence            3488999999999998 899995443   111 11   1234669999999999988 9999999999999999999999


Q ss_pred             ccccCchHHHHHHH
Q psy3483          79 YRSNERSNVKAHMI   92 (99)
Q Consensus        79 ~~f~~~~~l~~H~~   92 (99)
                      +.|..+..+..|+.
T Consensus       317 KRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  317 KRFSHSGSYSSHMS  330 (1007)
T ss_pred             cccccCCccccccc
Confidence            99999999999875


No 6  
>PHA00733 hypothetical protein
Probab=99.25  E-value=8.3e-12  Score=66.47  Aligned_cols=87  Identities=16%  Similarity=0.291  Sum_probs=66.7

Q ss_pred             CceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCc
Q psy3483           5 ELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNER   84 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~   84 (99)
                      .+++.|..|.+.|.... .|..+..+...+.. .+.++|.|+.|++.|... ..+..|++.+  +.+|.|..|++.|...
T Consensus        38 ~~~~~~~~~~~~~~~~~-~l~~~~~l~~~~~~-~~~kPy~C~~Cgk~Fss~-s~L~~H~r~h--~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQ-LLDESSYLYKLLTS-KAVSPYVCPLCLMPFSSS-VSLKQHIRYT--EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             hhhHHHHHHhhhccChh-hhcchHHHHhhccc-CCCCCccCCCCCCcCCCH-HHHHHHHhcC--CcCccCCCCCCccCCH
Confidence            56678999998887665 55554222222333 347889999999988877 8899998876  4579999999999999


Q ss_pred             hHHHHHHHHhcC
Q psy3483          85 SNVKAHMIRRHS   96 (99)
Q Consensus        85 ~~l~~H~~~~~~   96 (99)
                      ..|..|+...++
T Consensus       113 ~sL~~H~~~~h~  124 (128)
T PHA00733        113 DSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHhcC
Confidence            999999887664


No 7  
>KOG3576|consensus
Probab=99.24  E-value=2.9e-12  Score=71.96  Aligned_cols=88  Identities=24%  Similarity=0.451  Sum_probs=73.5

Q ss_pred             CCCCceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHh-h----------CCCC
Q psy3483           2 KSTELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRT-H----------TKDR   70 (99)
Q Consensus         2 h~~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~-~----------~~~~   70 (99)
                      |++.+.+.|..||++|-.-. .|..|      ++.|+|-+||.|..|++.|... -+|..|.+. |          ..++
T Consensus       140 h~~vkr~lct~cgkgfndtf-dlkrh------~rthtgvrpykc~~c~kaftqr-csleshl~kvhgv~~~yaykerr~k  211 (267)
T KOG3576|consen  140 HSDVKRHLCTFCGKGFNDTF-DLKRH------TRTHTGVRPYKCSLCEKAFTQR-CSLESHLKKVHGVQHQYAYKERRAK  211 (267)
T ss_pred             ccHHHHHHHhhccCcccchh-hhhhh------hccccCccccchhhhhHHHHhh-ccHHHHHHHHcCchHHHHHHHhhhh
Confidence            56677889999999999888 99999      9999999999999999977655 788888653 2          2356


Q ss_pred             ceecCCCCccccCchHHHHHHHHhcCC
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRRHSV   97 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~~~~   97 (99)
                      .|.|..||..-.....+..|+..++..
T Consensus       212 l~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  212 LYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             eeeecccCCCCCChhHHHHHHHhcCCC
Confidence            799999999888888888898877654


No 8  
>KOG1074|consensus
Probab=99.18  E-value=2.7e-12  Score=83.87  Aligned_cols=83  Identities=14%  Similarity=0.407  Sum_probs=74.2

Q ss_pred             ceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCC----CceecC---CCC
Q psy3483           6 LIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKD----RPYKCF---YCD   78 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~----~~~~C~---~c~   78 (99)
                      .|.+|-.|.+.....+ .|++|      ++.|+|++||+|.+||+.|.++ .+|..|+.+|...    ..+.|+   .|-
T Consensus       604 dPNqCiiC~rVlSC~s-aLqmH------yrtHtGERPFkCKiCgRAFtTk-GNLkaH~~vHka~p~~R~q~ScP~~~ic~  675 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPS-ALQMH------YRTHTGERPFKCKICGRAFTTK-GNLKAHMSVHKAKPPARVQFSCPSTFICQ  675 (958)
T ss_pred             Cccceeeeeecccchh-hhhhh------hhcccCcCccccccccchhccc-cchhhcccccccCccccccccCCchhhhc
Confidence            3678999999999999 99999      9999999999999999999888 9999999988554    357898   899


Q ss_pred             ccccCchHHHHHHHHhcC
Q psy3483          79 YRSNERSNVKAHMIRRHS   96 (99)
Q Consensus        79 ~~f~~~~~l~~H~~~~~~   96 (99)
                      +.|.+.-.+..|.+.|.+
T Consensus       676 ~kftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  676 KKFTNAVTLPQHIRIHLG  693 (958)
T ss_pred             ccccccccccceEEeecC
Confidence            999999999999999884


No 9  
>KOG3608|consensus
Probab=99.17  E-value=7.6e-12  Score=75.34  Aligned_cols=90  Identities=33%  Similarity=0.651  Sum_probs=63.5

Q ss_pred             CCCCceeeCccccccccccchhhhccchh-------------h-----------ccCCCCCCCcceeccCCCcccccChh
Q psy3483           2 KSTELIVTCMYCSKILTYETETIMNHCKF-------------C-----------KAVSRPTKYQRYVCCLCSKYRHSDAS   57 (99)
Q Consensus         2 h~~~~~~~c~~c~~~f~~~~~~~~~h~~~-------------~-----------~~~~~~~~~~~~~c~~c~~~~~~~~~   57 (99)
                      |+++|..-|+.||.-|..+. .|-.|++-             |           +++..|.  ..|.|+.|.-+.... +
T Consensus       202 Hs~eKvvACp~Cg~~F~~~t-kl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~-s  277 (467)
T KOG3608|consen  202 HSNEKVVACPHCGELFRTKT-KLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSA-S  277 (467)
T ss_pred             cCCCeEEecchHHHHhcccc-HHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCCh-H
Confidence            56666666666666666555 45455111             0           0033332  347899998865555 8


Q ss_pred             HHHHHHHh-hCCCCceecCCCCccccCchHHHHHHHHhc
Q psy3483          58 KMRSHIRT-HTKDRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        58 ~~~~h~~~-~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      +|..|++. |..++||+|..|+..|...++|..|..+|.
T Consensus       278 sL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  278 SLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             HHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            89999876 788999999999999999999999998886


No 10 
>PHA02768 hypothetical protein; Provisional
Probab=99.07  E-value=5.5e-11  Score=53.75  Aligned_cols=43  Identities=23%  Similarity=0.394  Sum_probs=35.7

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCchHHH
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNERSNVK   88 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~~~l~   88 (99)
                      |.|++||+.|... +.|..|++.|+  ++++|..|++.|...+.|+
T Consensus         6 y~C~~CGK~Fs~~-~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKR-KSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccH-HHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            6799999977766 88999999988  6889999999888777654


No 11 
>KOG1074|consensus
Probab=98.98  E-value=2.2e-10  Score=75.23  Aligned_cols=56  Identities=36%  Similarity=0.685  Sum_probs=51.5

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCchHHHHHHHHhcCCCC
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNERSNVKAHMIRRHSVKP   99 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~kp   99 (99)
                      ..|.+||+.|.++ +.|..|+++|++++||.|..|++.|..+.+|..||.+|....|
T Consensus       880 h~C~vCgk~FsSS-sALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  880 HVCNVCGKQFSSS-AALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhccchhcccch-HHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCC
Confidence            4699999988888 9999999999999999999999999999999999999976543


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.96  E-value=8.2e-10  Score=43.03  Aligned_cols=26  Identities=46%  Similarity=1.012  Sum_probs=22.9

Q ss_pred             HHHHHHHhhCCCCceecCCCCccccC
Q psy3483          58 KMRSHIRTHTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus        58 ~~~~h~~~~~~~~~~~C~~c~~~f~~   83 (99)
                      +|..|++.|++++||.|..|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47789999999999999999998863


No 13 
>PHA00616 hypothetical protein
Probab=98.88  E-value=8.7e-10  Score=47.65  Aligned_cols=29  Identities=21%  Similarity=0.480  Sum_probs=17.4

Q ss_pred             ceecCCCCccccCchHHHHHHHHhcCCCC
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRRHSVKP   99 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~~~~kp   99 (99)
                      ||+|..||+.|...++|..|++.++|++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            45566666666666666666666665543


No 14 
>KOG3608|consensus
Probab=98.80  E-value=4.9e-09  Score=63.56  Aligned_cols=86  Identities=23%  Similarity=0.441  Sum_probs=64.4

Q ss_pred             CCCCceeeCccccccccccchhhhccchhhccCCCCCCCcceeccC--CCcccccChhHHHHHHHh-hCC--CCceecCC
Q psy3483           2 KSTELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCL--CSKYRHSDASKMRSHIRT-HTK--DRPYKCFY   76 (99)
Q Consensus         2 h~~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~--c~~~~~~~~~~~~~h~~~-~~~--~~~~~C~~   76 (99)
                      |+.++||+|..|++.+..++ .|..|      ...|. +.-|.|.-  |...+... ..+..|.+- |.|  ..+|.|-.
T Consensus       287 Hs~dkpfKCd~Cd~~c~~es-dL~kH------~~~HS-~~~y~C~h~~C~~s~r~~-~q~~~H~~evhEg~np~~Y~CH~  357 (467)
T KOG3608|consen  287 HSKDKPFKCDECDTRCVRES-DLAKH------VQVHS-KTVYQCEHPDCHYSVRTY-TQMRRHFLEVHEGNNPILYACHC  357 (467)
T ss_pred             hccCCCccccchhhhhccHH-HHHHH------HHhcc-ccceecCCCCCcHHHHHH-HHHHHHHHHhccCCCCCceeeec
Confidence            67788888888888888887 88888      66665 45577766  76655554 677777654 434  45699999


Q ss_pred             CCccccCchHHHHHHHHhcC
Q psy3483          77 CDYRSNERSNVKAHMIRRHS   96 (99)
Q Consensus        77 c~~~f~~~~~l~~H~~~~~~   96 (99)
                      |++.|..-.+|.+|+...++
T Consensus       358 Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  358 CDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             chhhhccchhHHHHHHHhhc
Confidence            99999999999999776554


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.78  E-value=1.1e-08  Score=65.89  Aligned_cols=77  Identities=16%  Similarity=0.271  Sum_probs=56.3

Q ss_pred             CceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccC-
Q psy3483           5 ELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNE-   83 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~-   83 (99)
                      ++.+.|+.|++.|. .. .+..|      ...+.  .++.|+ ||. +... ..+..|+..+...+++.|..|+..|.. 
T Consensus       451 ~~H~~C~~Cgk~f~-~s-~LekH------~~~~H--kpv~Cp-Cg~-~~~R-~~L~~H~~thCp~Kpi~C~fC~~~v~~g  517 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QG-EMEKH------MKVFH--EPLQCP-CGV-VLEK-EQMVQHQASTCPLRLITCRFCGDMVQAG  517 (567)
T ss_pred             ccCccCCCCCCccc-hH-HHHHH------HHhcC--CCccCC-CCC-Ccch-hHHHhhhhccCCCCceeCCCCCCccccC
Confidence            45678889988885 34 67788      44442  667888 886 4444 788888888888889999999888742 


Q ss_pred             ---------chHHHHHHHHh
Q psy3483          84 ---------RSNVKAHMIRR   94 (99)
Q Consensus        84 ---------~~~l~~H~~~~   94 (99)
                               ...|..|+...
T Consensus       518 ~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        518 GSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             ccccchhhhhhhHHHHHHhc
Confidence                     24677887764


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.71  E-value=2.3e-09  Score=48.55  Aligned_cols=40  Identities=13%  Similarity=0.333  Sum_probs=34.6

Q ss_pred             eeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccC
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSD   55 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~   55 (99)
                      .|.|+.||+.|...+ .|..|      ++.|+  +++.|..|++.|...
T Consensus         5 ~y~C~~CGK~Fs~~~-~L~~H------~r~H~--k~~kc~~C~k~f~~~   44 (55)
T PHA02768          5 GYECPICGEIYIKRK-SMITH------LRKHN--TNLKLSNCKRISLRT   44 (55)
T ss_pred             ccCcchhCCeeccHH-HHHHH------HHhcC--CcccCCcccceeccc
Confidence            489999999999999 99999      88888  678899999966543


No 17 
>PHA00733 hypothetical protein
Probab=98.48  E-value=1.5e-07  Score=50.23  Aligned_cols=54  Identities=15%  Similarity=0.288  Sum_probs=43.5

Q ss_pred             CCCceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhh
Q psy3483           3 STELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTH   66 (99)
Q Consensus         3 ~~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~   66 (99)
                      .+++||.|+.|++.|.... .|..|      +..+  ..++.|.+|++.|... ..|..|+.-.
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s-~L~~H------~r~h--~~~~~C~~CgK~F~~~-~sL~~H~~~~  122 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSV-SLKQH------IRYT--EHSKVCPVCGKEFRNT-DSTLDHVCKK  122 (128)
T ss_pred             CCCCCccCCCCCCcCCCHH-HHHHH------HhcC--CcCccCCCCCCccCCH-HHHHHHHHHh
Confidence            3578999999999999998 88888      5544  3468999999987776 8888887654


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.44  E-value=5e-07  Score=58.47  Aligned_cols=77  Identities=17%  Similarity=0.343  Sum_probs=60.8

Q ss_pred             ceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCccccc---------ChhHHHHHHHhhCCCCceecCC
Q psy3483           6 LIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHS---------DASKMRSHIRTHTKDRPYKCFY   76 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~---------~~~~~~~h~~~~~~~~~~~C~~   76 (99)
                      +++.|+ |++.+ .+. .|..|      ...+...+++.|..|+..+..         ....+..|.... +.+++.|..
T Consensus       477 kpv~Cp-Cg~~~-~R~-~L~~H------~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~  546 (567)
T PLN03086        477 EPLQCP-CGVVL-EKE-QMVQH------QASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDS  546 (567)
T ss_pred             CCccCC-CCCCc-chh-HHHhh------hhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccc
Confidence            678999 99765 445 88889      888999999999999986531         124788888885 999999999


Q ss_pred             CCccccCchHHHHHHHH
Q psy3483          77 CDYRSNERSNVKAHMIR   93 (99)
Q Consensus        77 c~~~f~~~~~l~~H~~~   93 (99)
                      |++.+..+ .+..|+..
T Consensus       547 Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        547 CGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             cCCeeeeh-hHHHHHHH
Confidence            99987665 67777654


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.38  E-value=6.1e-08  Score=37.65  Aligned_cols=18  Identities=28%  Similarity=0.593  Sum_probs=15.2

Q ss_pred             CCCCCceeeCcccccccc
Q psy3483           1 MKSTELIVTCMYCSKILT   18 (99)
Q Consensus         1 ~h~~~~~~~c~~c~~~f~   18 (99)
                      +|+|++||+|+.|++.|.
T Consensus         8 ~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    8 THTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHSSSSSEEESSSSEEES
T ss_pred             hcCCCCCCCCCCCcCeeC
Confidence            478899999999998885


No 20 
>PHA00616 hypothetical protein
Probab=98.36  E-value=1.7e-07  Score=40.55  Aligned_cols=32  Identities=16%  Similarity=0.285  Sum_probs=18.1

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecC
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCF   75 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~   75 (99)
                      |+|+.||+.|... +.+..|++.+++++++.|.
T Consensus         2 YqC~~CG~~F~~~-s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKK-KEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhH-HHHHHHHHHhcCCCcccee
Confidence            4556666555544 5566666666666555544


No 21 
>PHA00732 hypothetical protein
Probab=98.35  E-value=4.1e-07  Score=44.61  Aligned_cols=44  Identities=20%  Similarity=0.409  Sum_probs=30.6

Q ss_pred             eeeCccccccccccchhhhccchhhccCCC-CCCCcceeccCCCcccccChhHHHHHHH
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVSR-PTKYQRYVCCLCSKYRHSDASKMRSHIR   64 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~-~~~~~~~~c~~c~~~~~~~~~~~~~h~~   64 (99)
                      ||.|..|++.|.... .|..|      ++. |.+   +.|+.|++.|.    .+..|..
T Consensus         1 py~C~~Cgk~F~s~s-~Lk~H------~r~~H~~---~~C~~CgKsF~----~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLF-ALKQH------ARRNHTL---TKCPVCNKSYR----RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHH-HHHHH------hhcccCC---CccCCCCCEeC----Chhhhhc
Confidence            578888888888887 88888      653 443   46888888654    2455553


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.27  E-value=9e-07  Score=33.20  Aligned_cols=23  Identities=43%  Similarity=0.752  Sum_probs=19.4

Q ss_pred             eecCCCCccccCchHHHHHHHHh
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRR   94 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~   94 (99)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67888999999999998888764


No 23 
>KOG3993|consensus
Probab=98.09  E-value=8.3e-07  Score=55.19  Aligned_cols=25  Identities=12%  Similarity=0.493  Sum_probs=23.0

Q ss_pred             ceecCCCCccccCchHHHHHHHHhc
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      .|.|..|++.|.....|..|+.+|.
T Consensus       356 i~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  356 IFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             eeecHHhhhhhHHHHHHHHhHHhhh
Confidence            6999999999999999999988875


No 24 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.08  E-value=2.6e-06  Score=33.18  Aligned_cols=26  Identities=23%  Similarity=0.430  Sum_probs=21.8

Q ss_pred             ceecCCCCccccCchHHHHHHHHhcC
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRRHS   96 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~~~   96 (99)
                      ||.|..|++.|.....|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58899999999999999999887753


No 25 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.00  E-value=8.3e-06  Score=30.53  Aligned_cols=24  Identities=25%  Similarity=0.625  Sum_probs=18.2

Q ss_pred             eecCCCCccccCchHHHHHHHHhc
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      |.|..|+..|.....|..|+.+++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            678888888888888888888763


No 26 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.97  E-value=1.2e-05  Score=35.65  Aligned_cols=33  Identities=27%  Similarity=0.530  Sum_probs=22.3

Q ss_pred             CCCCceecCCCCccccCchHHHHHHHHhcCCCC
Q psy3483          67 TKDRPYKCFYCDYRSNERSNVKAHMIRRHSVKP   99 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~kp   99 (99)
                      .++.|-.|++|+..+.+..+|.+|+...++.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            456788888888888888888888888877776


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.93  E-value=3.6e-05  Score=35.03  Aligned_cols=49  Identities=27%  Similarity=0.575  Sum_probs=27.4

Q ss_pred             eeccCCCcccccChhHHHHHHHh-hCC-CCceecCCCCccccCchHHHHHHHHhc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRT-HTK-DRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~-~~~-~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      |.|+.|++ .+.. ..|..|... |.. .+.+.|+.|...+.  .+|..|+..++
T Consensus         3 f~CP~C~~-~~~~-~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSE-SSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCH-HHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            55666666 4444 556666443 333 23566777765433  36666766544


No 28 
>PHA00732 hypothetical protein
Probab=97.80  E-value=1.2e-05  Score=39.49  Aligned_cols=47  Identities=21%  Similarity=0.424  Sum_probs=37.5

Q ss_pred             ceeccCCCcccccChhHHHHHHHh-hCCCCceecCCCCccccCchHHHHHHHHhc
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRT-HTKDRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~-~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      ||.|..|++.|... ..+..|++. |.   ++.|..|++.|.   .+..|.++..
T Consensus         1 py~C~~Cgk~F~s~-s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTL-FALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCH-HHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            47899999988777 999999984 65   368999999997   4777776543


No 29 
>KOG3993|consensus
Probab=97.60  E-value=2.7e-05  Score=48.76  Aligned_cols=60  Identities=22%  Similarity=0.471  Sum_probs=44.7

Q ss_pred             ceeeCccccccccccchhhhccchhhccC------CCC---------------------CCCcceeccCCCcccccChhH
Q psy3483           6 LIVTCMYCSKILTYETETIMNHCKFCKAV------SRP---------------------TKYQRYVCCLCSKYRHSDASK   58 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~~~~~~h~~~~~~~------~~~---------------------~~~~~~~c~~c~~~~~~~~~~   58 (99)
                      ..|.|++|+|.|.... +|-.|.+|....      ...                     ..+..|.|.+|++.|..+ .-
T Consensus       294 vEYrCPEC~KVFsCPA-NLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRq-AY  371 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPA-NLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQ-AY  371 (500)
T ss_pred             eeecCCcccccccCch-hhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHH-HH
Confidence            3589999999999998 999998875110      000                     112358999999999888 78


Q ss_pred             HHHHHHhhC
Q psy3483          59 MRSHIRTHT   67 (99)
Q Consensus        59 ~~~h~~~~~   67 (99)
                      |..|+.+|.
T Consensus       372 LrKHqlthq  380 (500)
T KOG3993|consen  372 LRKHQLTHQ  380 (500)
T ss_pred             HHHhHHhhh
Confidence            889987763


No 30 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.59  E-value=8.6e-05  Score=28.02  Aligned_cols=24  Identities=29%  Similarity=0.533  Sum_probs=19.0

Q ss_pred             eecCCCCccccCchHHHHHHHHhc
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            468888888888888888887654


No 31 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.57  E-value=6e-05  Score=28.02  Aligned_cols=20  Identities=35%  Similarity=0.725  Sum_probs=9.9

Q ss_pred             eccCCCcccccChhHHHHHHH
Q psy3483          44 VCCLCSKYRHSDASKMRSHIR   64 (99)
Q Consensus        44 ~c~~c~~~~~~~~~~~~~h~~   64 (99)
                      .|+.|++.|... ..|..|++
T Consensus         2 ~C~~C~~~f~~~-~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSK-SNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSH-HHHHHHHH
T ss_pred             CCCCCCCccCCH-HHHHHHHh
Confidence            455555544444 55555544


No 32 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.55  E-value=7.3e-05  Score=34.03  Aligned_cols=50  Identities=26%  Similarity=0.640  Sum_probs=33.9

Q ss_pred             eeeCccccccccccchhhhccchhhccCCCCCCC-cceeccCCCcccccChhHHHHHHHhh
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVSRPTKY-QRYVCCLCSKYRHSDASKMRSHIRTH   66 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~-~~~~c~~c~~~~~~~~~~~~~h~~~~   66 (99)
                      .|.|++|++.|. .. .|..|+     ...|..+ +.+.|++|...  .. ..+..|+..+
T Consensus         2 ~f~CP~C~~~~~-~~-~L~~H~-----~~~H~~~~~~v~CPiC~~~--~~-~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ES-SLVEHC-----EDEHRSESKNVVCPICSSR--VT-DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCCccC-HH-HHHHHH-----HhHCcCCCCCccCCCchhh--hh-hHHHHHHHHh
Confidence            589999999655 34 677774     3344433 45889999873  23 5778887654


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.41  E-value=0.00017  Score=36.50  Aligned_cols=73  Identities=14%  Similarity=0.429  Sum_probs=21.2

Q ss_pred             eCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCchHHH
Q psy3483           9 TCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNERSNVK   88 (99)
Q Consensus         9 ~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~~~l~   88 (99)
                      +|..|+..|.... .+..|      +....+-..   ..... .... ..+..+... .....+.|..|+..|.....|.
T Consensus         1 ~C~~C~~~f~~~~-~l~~H------~~~~H~~~~---~~~~~-l~~~-~~~~~~~~~-~~~~~~~C~~C~~~f~s~~~l~   67 (100)
T PF12756_consen    1 QCLFCDESFSSVD-DLLQH------MKKKHGFDI---PDQKY-LVDP-NRLLNYLRK-KVKESFRCPYCNKTFRSREALQ   67 (100)
T ss_dssp             -------------------------------------------------------------SSEEBSSSS-EESSHHHHH
T ss_pred             Ccccccccccccc-ccccc------ccccccccc---ccccc-cccc-ccccccccc-ccCCCCCCCccCCCCcCHHHHH
Confidence            5889999998877 78888      533222110   00000 1111 222222221 1223699999999999999999


Q ss_pred             HHHHHh
Q psy3483          89 AHMIRR   94 (99)
Q Consensus        89 ~H~~~~   94 (99)
                      .|++.+
T Consensus        68 ~Hm~~~   73 (100)
T PF12756_consen   68 EHMRSK   73 (100)
T ss_dssp             HHHHHT
T ss_pred             HHHcCc
Confidence            999865


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.32  E-value=0.00014  Score=44.20  Aligned_cols=70  Identities=20%  Similarity=0.243  Sum_probs=40.4

Q ss_pred             CceeeCc--cccccccccchhhhccchhhc-cCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccc
Q psy3483           5 ELIVTCM--YCSKILTYETETIMNHCKFCK-AVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRS   81 (99)
Q Consensus         5 ~~~~~c~--~c~~~f~~~~~~~~~h~~~~~-~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f   81 (99)
                      ++||+|+  .|.|.++..- .|..|+..+. ....|  +.|  -++--..|             -...+||.|.+|++.+
T Consensus       347 ~KpykCpV~gC~K~Yknqn-GLKYH~lhGH~~~~~~--~~p--~p~~~~~F-------------~~~~KPYrCevC~KRY  408 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQN-GLKYHMLHGHQNQKLH--ENP--SPEKMNIF-------------SAKDKPYRCEVCDKRY  408 (423)
T ss_pred             CceecCCCCCchhhhcccc-chhhhhhccccCcccC--CCC--Cccccccc-------------cccCCceeccccchhh
Confidence            4788884  4777777666 6777732211 01111  111  11111112             2347899999999999


Q ss_pred             cCchHHHHHHH
Q psy3483          82 NERSNVKAHMI   92 (99)
Q Consensus        82 ~~~~~l~~H~~   92 (99)
                      .+..-|.-|+.
T Consensus       409 KNlNGLKYHr~  419 (423)
T COG5189         409 KNLNGLKYHRK  419 (423)
T ss_pred             ccCccceeccc
Confidence            88888877654


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=97.25  E-value=0.00033  Score=38.96  Aligned_cols=40  Identities=23%  Similarity=0.453  Sum_probs=33.1

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCch
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNERS   85 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~~   85 (99)
                      -+|.|. |+.   .. ..+..|.++++++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~-~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQ-LTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---ee-CHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            368997 986   33 67899999999999999999999876543


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.22  E-value=0.0001  Score=28.50  Aligned_cols=20  Identities=20%  Similarity=0.444  Sum_probs=10.7

Q ss_pred             eeeCccccccccccchhhhcc
Q psy3483           7 IVTCMYCSKILTYETETIMNH   27 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h   27 (99)
                      ||+|..|++.|.... .|..|
T Consensus         1 ~~~C~~C~~~F~~~~-~l~~H   20 (27)
T PF13912_consen    1 PFECDECGKTFSSLS-ALREH   20 (27)
T ss_dssp             SEEETTTTEEESSHH-HHHHH
T ss_pred             CCCCCccCCccCChh-HHHHH
Confidence            345555555555555 55555


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.12  E-value=0.00065  Score=25.44  Aligned_cols=23  Identities=48%  Similarity=1.008  Sum_probs=16.0

Q ss_pred             eecCCCCccccCchHHHHHHHHhc
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      |.|..|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67888887776 778888887764


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.12  E-value=0.0004  Score=26.24  Aligned_cols=23  Identities=13%  Similarity=0.499  Sum_probs=18.8

Q ss_pred             eecCCCCccccCchHHHHHHHHh
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRR   94 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~   94 (99)
                      |.|..|+..|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57888888888888888887654


No 39 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.03  E-value=0.00061  Score=25.14  Aligned_cols=22  Identities=41%  Similarity=0.831  Sum_probs=11.0

Q ss_pred             eeccCCCcccccChhHHHHHHHh
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRT   65 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~   65 (99)
                      |.|+.|+..|... ..+..|+..
T Consensus         1 ~~C~~C~~~~~~~-~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSK-SELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSH-HHHHHHHHH
T ss_pred             CCCcCCCCcCCcH-HHHHHHHHh
Confidence            3466666655544 556666554


No 40 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.61  E-value=0.00044  Score=26.77  Aligned_cols=22  Identities=27%  Similarity=0.504  Sum_probs=17.6

Q ss_pred             eecCCCCccccCchHHHHHHHH
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      |.|..|++.|.....+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888877654


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.32  E-value=0.0083  Score=26.81  Aligned_cols=34  Identities=18%  Similarity=0.415  Sum_probs=21.5

Q ss_pred             CCCCcceeccCCCcccccChhHHHHHHHhhCCCCc
Q psy3483          37 PTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRP   71 (99)
Q Consensus        37 ~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~   71 (99)
                      ...++|..|++|+...... .+|..|+....+.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~s-rnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQS-RNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSH-HHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccch-hhHHHHHHHHhcccC
Confidence            3456788999999976665 899999987766655


No 42 
>PRK04860 hypothetical protein; Provisional
Probab=95.99  E-value=0.0034  Score=35.00  Aligned_cols=36  Identities=19%  Similarity=0.325  Sum_probs=29.0

Q ss_pred             eeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccc
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRH   53 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~   53 (99)
                      +|.|. |+.   ... .+..|      .+.++++++|.|..|+..+.
T Consensus       119 ~Y~C~-C~~---~~~-~~rrH------~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        119 PYRCK-CQE---HQL-TVRRH------NRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEcC-CCC---eeC-HHHHH------HHHhcCCccEECCCCCceeE
Confidence            68897 988   333 66788      88899999999999998654


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.61  E-value=0.015  Score=22.04  Aligned_cols=18  Identities=17%  Similarity=0.436  Sum_probs=9.1

Q ss_pred             ecCCCCccccCchHHHHHH
Q psy3483          73 KCFYCDYRSNERSNVKAHM   91 (99)
Q Consensus        73 ~C~~c~~~f~~~~~l~~H~   91 (99)
                      .|+.||+.| ....|..|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            455555555 333444554


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.09  E-value=0.024  Score=22.95  Aligned_cols=23  Identities=22%  Similarity=0.502  Sum_probs=17.4

Q ss_pred             ceecCCCCccccCchHHHHHHHH
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      +|.|..|+..|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888877777777653


No 45 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.22  E-value=0.027  Score=25.63  Aligned_cols=27  Identities=15%  Similarity=0.282  Sum_probs=18.6

Q ss_pred             hCCCCceecCCCCccccCchHHHHHHH
Q psy3483          66 HTKDRPYKCFYCDYRSNERSNVKAHMI   92 (99)
Q Consensus        66 ~~~~~~~~C~~c~~~f~~~~~l~~H~~   92 (99)
                      ..|+.-+.|+.|+..|....++.+|.-
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhh
Confidence            345666777777777777777777754


No 46 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.00  E-value=0.062  Score=21.75  Aligned_cols=24  Identities=29%  Similarity=0.837  Sum_probs=14.8

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      |.|.+||..+...             ..++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCC
Confidence            5677777643322             25778888764


No 47 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.84  E-value=0.052  Score=31.76  Aligned_cols=17  Identities=24%  Similarity=0.510  Sum_probs=14.2

Q ss_pred             CceeeCccccccccccc
Q psy3483           5 ELIVTCMYCSKILTYET   21 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~~   21 (99)
                      ++...||+|++.|..+.
T Consensus         3 ~k~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKK   19 (214)
T ss_pred             CCceECCCCCCeeeeeE
Confidence            46679999999998775


No 48 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.46  E-value=0.055  Score=28.26  Aligned_cols=28  Identities=21%  Similarity=0.418  Sum_probs=18.5

Q ss_pred             eCccccccccccchhhhccchhhccCCCCCCCcceeccCCCccccc
Q psy3483           9 TCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHS   54 (99)
Q Consensus         9 ~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~   54 (99)
                      .|+.||+.|.    .|..              .|..|+.||..|..
T Consensus        11 ~Cp~CG~kFY----DLnk--------------~PivCP~CG~~~~~   38 (108)
T PF09538_consen   11 TCPSCGAKFY----DLNK--------------DPIVCPKCGTEFPP   38 (108)
T ss_pred             cCCCCcchhc----cCCC--------------CCccCCCCCCccCc
Confidence            6888888877    2222              35678888875543


No 49 
>KOG1146|consensus
Probab=93.36  E-value=0.036  Score=40.03  Aligned_cols=26  Identities=27%  Similarity=0.751  Sum_probs=22.1

Q ss_pred             CCCceecCCCCccccCchHHHHHHHH
Q psy3483          68 KDRPYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        68 ~~~~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      +.++|.|..|...+....+|.+|+..
T Consensus       515 ~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  515 PGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCCcccceeeeeeeecchHHHHHHHH
Confidence            45689999999999999999999764


No 50 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=92.95  E-value=0.054  Score=25.00  Aligned_cols=31  Identities=19%  Similarity=0.620  Sum_probs=16.2

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      |.|+.||...... .     .+...-..+|.|+.||.
T Consensus        28 F~CPnCGe~~I~R-c-----~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          28 FPCPNCGEVEIYR-C-----AKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eeCCCCCceeeeh-h-----hhHHHcCCceECCCcCc
Confidence            6778887532222 1     11122245788888873


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.90  E-value=0.035  Score=34.89  Aligned_cols=55  Identities=20%  Similarity=0.446  Sum_probs=40.5

Q ss_pred             ceeccCCCcccccChhHHHHHHH--hhCCC--CceecC--CCCccccCchHHHHHHHHhcCC
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIR--THTKD--RPYKCF--YCDYRSNERSNVKAHMIRRHSV   97 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~--~~~~~--~~~~C~--~c~~~f~~~~~l~~H~~~~~~~   97 (99)
                      ++.|..|...+... ..+..|..  .|+++  +++.|+  .|++.|.....+..|...|++.
T Consensus       289 ~~~~~~~~~~~s~~-~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         289 PIKSKQCNISFSRS-SPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCCccccCCcccc-ccccccccccccccccCCceeeeccCCCccccccccccCCcccccCC
Confidence            45667777766665 77777777  68888  788888  6888888888877777777654


No 52 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.83  E-value=0.18  Score=20.54  Aligned_cols=10  Identities=40%  Similarity=0.796  Sum_probs=5.8

Q ss_pred             CceecCCCCc
Q psy3483          70 RPYKCFYCDY   79 (99)
Q Consensus        70 ~~~~C~~c~~   79 (99)
                      .|..|+.|+.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            3556666653


No 53 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.54  E-value=0.25  Score=20.46  Aligned_cols=13  Identities=15%  Similarity=0.501  Sum_probs=7.4

Q ss_pred             eeCcccccccccc
Q psy3483           8 VTCMYCSKILTYE   20 (99)
Q Consensus         8 ~~c~~c~~~f~~~   20 (99)
                      ..|+.|+..|.-.
T Consensus         3 ~~CP~C~~~~~v~   15 (38)
T TIGR02098         3 IQCPNCKTSFRVV   15 (38)
T ss_pred             EECCCCCCEEEeC
Confidence            4566666665533


No 54 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=90.52  E-value=0.2  Score=27.99  Aligned_cols=13  Identities=15%  Similarity=0.329  Sum_probs=6.5

Q ss_pred             eeCcccccccccc
Q psy3483           8 VTCMYCSKILTYE   20 (99)
Q Consensus         8 ~~c~~c~~~f~~~   20 (99)
                      |.|+.|+..|...
T Consensus       110 Y~Cp~c~~r~tf~  122 (158)
T TIGR00373       110 FICPNMCVRFTFN  122 (158)
T ss_pred             EECCCCCcEeeHH
Confidence            4555555554443


No 55 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.50  E-value=0.29  Score=20.21  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=6.7

Q ss_pred             eCcccccccccc
Q psy3483           9 TCMYCSKILTYE   20 (99)
Q Consensus         9 ~c~~c~~~f~~~   20 (99)
                      .|+.|+..|.-.
T Consensus         4 ~Cp~C~~~y~i~   15 (36)
T PF13717_consen    4 TCPNCQAKYEID   15 (36)
T ss_pred             ECCCCCCEEeCC
Confidence            466666665433


No 56 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.41  E-value=0.25  Score=20.53  Aligned_cols=11  Identities=27%  Similarity=0.615  Sum_probs=5.6

Q ss_pred             eCccccccccc
Q psy3483           9 TCMYCSKILTY   19 (99)
Q Consensus         9 ~c~~c~~~f~~   19 (99)
                      .|+.|+..|.-
T Consensus         4 ~CP~C~~~f~v   14 (37)
T PF13719_consen    4 TCPNCQTRFRV   14 (37)
T ss_pred             ECCCCCceEEc
Confidence            45555555543


No 57 
>PHA00626 hypothetical protein
Probab=90.15  E-value=0.092  Score=23.94  Aligned_cols=12  Identities=33%  Similarity=0.955  Sum_probs=6.1

Q ss_pred             ceecCCCCcccc
Q psy3483          71 PYKCFYCDYRSN   82 (99)
Q Consensus        71 ~~~C~~c~~~f~   82 (99)
                      .|.|..|+..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            455555555443


No 58 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=90.08  E-value=0.19  Score=23.25  Aligned_cols=32  Identities=19%  Similarity=0.672  Sum_probs=16.6

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      .|.|+.||...... -.     +-..-..+|.|+.||.
T Consensus        25 ~F~CPnCG~~~I~R-C~-----~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYR-CE-----KCRKQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEee-ch-----hHHhcCCceECCCCCC
Confidence            36777777641111 10     1112245788888874


No 59 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.04  E-value=0.22  Score=28.35  Aligned_cols=15  Identities=20%  Similarity=0.569  Sum_probs=8.6

Q ss_pred             eeeCccccccccccc
Q psy3483           7 IVTCMYCSKILTYET   21 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~   21 (99)
                      -|.|+.|+..|....
T Consensus       117 ~Y~Cp~C~~rytf~e  131 (178)
T PRK06266        117 FFFCPNCHIRFTFDE  131 (178)
T ss_pred             EEECCCCCcEEeHHH
Confidence            456666666655443


No 60 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=89.04  E-value=0.17  Score=21.66  Aligned_cols=11  Identities=18%  Similarity=0.522  Sum_probs=6.8

Q ss_pred             eeCcccccccc
Q psy3483           8 VTCMYCSKILT   18 (99)
Q Consensus         8 ~~c~~c~~~f~   18 (99)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            56666666654


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.98  E-value=0.21  Score=31.43  Aligned_cols=61  Identities=20%  Similarity=0.363  Sum_probs=47.8

Q ss_pred             eeeCccccccccccchhhhccchhhccCC--CCCCC--cceecc--CCCcccccChhHHHHHHHhhCCCCceecC
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVS--RPTKY--QRYVCC--LCSKYRHSDASKMRSHIRTHTKDRPYKCF   75 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~--~~~~~--~~~~c~--~c~~~~~~~~~~~~~h~~~~~~~~~~~C~   75 (99)
                      ++.|..|...|.... .+..|      ..  .|.++  +++.|+  .|++.+... ..+..|...+++..++.+.
T Consensus       289 ~~~~~~~~~~~s~~~-~l~~~------~~~~~h~~~~~~~~~~p~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         289 PIKSKQCNISFSRSS-PLTRH------LRSVNHSGESLKPFSCPYSLCGKLFSRN-DALKRHILLHTSISPAKEK  355 (467)
T ss_pred             CCCCccccCCccccc-ccccc------ccccccccccCCceeeeccCCCcccccc-ccccCCcccccCCCccccc
Confidence            567888888888887 88888      77  68888  888888  788876666 7778888888877766654


No 62 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.92  E-value=0.37  Score=27.19  Aligned_cols=23  Identities=30%  Similarity=0.758  Sum_probs=18.6

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCceecCCCC
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCD   78 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~   78 (99)
                      .|.|++||..              +.++-|..|+.||
T Consensus       134 ~~vC~vCGy~--------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT--------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc--------------ccCCCCCcCCCCC
Confidence            6899999873              3457799999998


No 63 
>KOG2186|consensus
Probab=88.56  E-value=0.47  Score=28.54  Aligned_cols=56  Identities=20%  Similarity=0.453  Sum_probs=35.4

Q ss_pred             eeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCcee
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYK   73 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~   73 (99)
                      -|.|..||-...-.  .+..|+.-|      ++ ..|.|..|++.|..  ....+|...-+....|.
T Consensus         3 ~FtCnvCgEsvKKp--~vekH~srC------rn-~~fSCIDC~k~F~~--~sYknH~kCITEaQKYg   58 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP--QVEKHMSRC------RN-AYFSCIDCGKTFER--VSYKNHTKCITEAQKYG   58 (276)
T ss_pred             EEehhhhhhhcccc--chHHHHHhc------cC-CeeEEeeccccccc--chhhhhhhhcchHHHhh
Confidence            37789999886644  456673222      22 45889999986553  56777776655544443


No 64 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=87.47  E-value=0.53  Score=17.98  Aligned_cols=11  Identities=27%  Similarity=0.525  Sum_probs=6.2

Q ss_pred             eecCCCCcccc
Q psy3483          72 YKCFYCDYRSN   82 (99)
Q Consensus        72 ~~C~~c~~~f~   82 (99)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35666666553


No 65 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=86.39  E-value=1.2  Score=19.28  Aligned_cols=8  Identities=25%  Similarity=0.629  Sum_probs=3.6

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      ..|+.||.
T Consensus        22 ~~Cp~CG~   29 (46)
T PRK00398         22 VRCPYCGY   29 (46)
T ss_pred             eECCCCCC
Confidence            34444443


No 66 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=86.27  E-value=0.69  Score=23.18  Aligned_cols=32  Identities=19%  Similarity=0.456  Sum_probs=20.9

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccC
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~   83 (99)
                      ..|.|+.|++. ...          ..+.-.|.|..|+..|.-
T Consensus        34 ~~~~Cp~C~~~-~Vk----------R~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRT-TVK----------RIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCc-cee----------eeccCeEEcCCCCCeecc
Confidence            34789999874 211          133456999999887753


No 67 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=85.31  E-value=1  Score=18.63  Aligned_cols=15  Identities=40%  Similarity=0.707  Sum_probs=8.1

Q ss_pred             CCCCCCCcceeccCC
Q psy3483          34 VSRPTKYQRYVCCLC   48 (99)
Q Consensus        34 ~~~~~~~~~~~c~~c   48 (99)
                      -....|.+.|.|..|
T Consensus        21 G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   21 GKSPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCCCEeEecCcC
Confidence            444455555666554


No 68 
>KOG4167|consensus
Probab=84.80  E-value=0.17  Score=34.75  Aligned_cols=25  Identities=20%  Similarity=0.259  Sum_probs=22.9

Q ss_pred             ceecCCCCccccCchHHHHHHHHhc
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      .|.|.+|++.|.-...+.+|+++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4999999999999999999999884


No 69 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.45  E-value=1.3  Score=24.41  Aligned_cols=39  Identities=18%  Similarity=0.255  Sum_probs=21.7

Q ss_pred             CCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccc
Q psy3483          38 TKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRS   81 (99)
Q Consensus        38 ~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f   81 (99)
                      .....|.|+.|+..+... ..+.   .... ...|.|+.||...
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~-ea~~---~~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFL-EANQ---LLDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             cCCcEEECcCCCCEeeHH-HHHH---hcCC-CCcEECCCCCCEE
Confidence            444568888888754433 2221   1112 3348888887654


No 70 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=84.32  E-value=0.65  Score=25.12  Aligned_cols=15  Identities=13%  Similarity=0.483  Sum_probs=12.0

Q ss_pred             eeeCccccccccccc
Q psy3483           7 IVTCMYCSKILTYET   21 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~   21 (99)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            568889999988665


No 71 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=83.94  E-value=1.3  Score=23.02  Aligned_cols=25  Identities=24%  Similarity=0.724  Sum_probs=22.6

Q ss_pred             eec----CCCCccccCchHHHHHHHHhcC
Q psy3483          72 YKC----FYCDYRSNERSNVKAHMIRRHS   96 (99)
Q Consensus        72 ~~C----~~c~~~f~~~~~l~~H~~~~~~   96 (99)
                      |.|    ..|+........+..|++..+|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    8999999999999999988765


No 72 
>PF14353 CpXC:  CpXC protein
Probab=83.58  E-value=0.73  Score=24.63  Aligned_cols=13  Identities=31%  Similarity=0.843  Sum_probs=9.8

Q ss_pred             eeCcccccccccc
Q psy3483           8 VTCMYCSKILTYE   20 (99)
Q Consensus         8 ~~c~~c~~~f~~~   20 (99)
                      .+|+.|+..|...
T Consensus         2 itCP~C~~~~~~~   14 (128)
T PF14353_consen    2 ITCPHCGHEFEFE   14 (128)
T ss_pred             cCCCCCCCeeEEE
Confidence            3689999887654


No 73 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=83.57  E-value=0.56  Score=20.81  Aligned_cols=12  Identities=17%  Similarity=0.465  Sum_probs=7.9

Q ss_pred             eeeCcccccccc
Q psy3483           7 IVTCMYCSKILT   18 (99)
Q Consensus         7 ~~~c~~c~~~f~   18 (99)
                      .|.|..|+..|.
T Consensus         5 ey~C~~Cg~~fe   16 (52)
T TIGR02605         5 EYRCTACGHRFE   16 (52)
T ss_pred             EEEeCCCCCEeE
Confidence            366777777665


No 74 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=83.53  E-value=1.8  Score=18.78  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=5.5

Q ss_pred             CceecCCCCc
Q psy3483          70 RPYKCFYCDY   79 (99)
Q Consensus        70 ~~~~C~~c~~   79 (99)
                      .+..|+.||.
T Consensus        18 ~~irC~~CG~   27 (44)
T smart00659       18 DVVRCRECGY   27 (44)
T ss_pred             CceECCCCCc
Confidence            3456666654


No 75 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.44  E-value=0.75  Score=24.75  Aligned_cols=28  Identities=7%  Similarity=0.006  Sum_probs=18.3

Q ss_pred             eCccccccccccchhhhccchhhccCCCCCCCcceeccCCCccccc
Q psy3483           9 TCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHS   54 (99)
Q Consensus         9 ~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~   54 (99)
                      .|+.||+.|.    .|.+              .|..|+.||..+..
T Consensus        11 ~Cp~cg~kFY----DLnk--------------~p~vcP~cg~~~~~   38 (129)
T TIGR02300        11 ICPNTGSKFY----DLNR--------------RPAVSPYTGEQFPP   38 (129)
T ss_pred             cCCCcCcccc----ccCC--------------CCccCCCcCCccCc
Confidence            6888888876    2222              35678888875443


No 76 
>KOG3408|consensus
Probab=82.28  E-value=0.76  Score=24.51  Aligned_cols=26  Identities=15%  Similarity=0.327  Sum_probs=22.1

Q ss_pred             CCCceecCCCCccccCchHHHHHHHH
Q psy3483          68 KDRPYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        68 ~~~~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      |--.|.|.+|.+-|.....|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            34459999999999999999999775


No 77 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=82.22  E-value=1.4  Score=30.76  Aligned_cols=12  Identities=25%  Similarity=0.479  Sum_probs=7.2

Q ss_pred             eCcccccccccc
Q psy3483           9 TCMYCSKILTYE   20 (99)
Q Consensus         9 ~c~~c~~~f~~~   20 (99)
                      .|..||..+...
T Consensus       437 ~C~~Cg~v~~Cp  448 (730)
T COG1198         437 LCRDCGYIAECP  448 (730)
T ss_pred             ecccCCCcccCC
Confidence            467777665443


No 78 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=81.71  E-value=1.1  Score=24.42  Aligned_cols=23  Identities=22%  Similarity=0.473  Sum_probs=14.0

Q ss_pred             ceecCCCCccccCchHHHHHHHHhcC
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRRHS   96 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~~~   96 (99)
                      -..|.+||+.|..   |.+|+++|+|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eeEEccCCcccch---HHHHHHHccC
Confidence            4689999997754   4889988865


No 79 
>KOG2893|consensus
Probab=81.61  E-value=0.26  Score=29.46  Aligned_cols=44  Identities=25%  Similarity=0.574  Sum_probs=28.2

Q ss_pred             ceeeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHH
Q psy3483           6 LIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSH   62 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h   62 (99)
                      ++| |.+|.+.|..+. -|..|          ...+.|.|-+|.+-.++- -.|..|
T Consensus        10 kpw-cwycnrefddek-iliqh----------qkakhfkchichkkl~sg-pglsih   53 (341)
T KOG2893|consen   10 KPW-CWYCNREFDDEK-ILIQH----------QKAKHFKCHICHKKLFSG-PGLSIH   53 (341)
T ss_pred             Cce-eeecccccchhh-hhhhh----------hhhccceeeeehhhhccC-CCceee
Confidence            443 779999998877 55555          233458899988755544 344433


No 80 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=81.51  E-value=0.89  Score=17.05  Aligned_cols=10  Identities=20%  Similarity=0.524  Sum_probs=7.5

Q ss_pred             ceeeCccccc
Q psy3483           6 LIVTCMYCSK   15 (99)
Q Consensus         6 ~~~~c~~c~~   15 (99)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            3688888874


No 81 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=80.63  E-value=2.3  Score=18.74  Aligned_cols=21  Identities=33%  Similarity=0.706  Sum_probs=10.8

Q ss_pred             eecCCCCccccCc-----hHHHHHHH
Q psy3483          72 YKCFYCDYRSNER-----SNVKAHMI   92 (99)
Q Consensus        72 ~~C~~c~~~f~~~-----~~l~~H~~   92 (99)
                      ..|..|++.+...     ++|..|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3455555544433     46666655


No 82 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=80.40  E-value=1.5  Score=19.09  Aligned_cols=21  Identities=48%  Similarity=1.007  Sum_probs=15.7

Q ss_pred             eecCCCCccccCchHHHHHHH
Q psy3483          72 YKCFYCDYRSNERSNVKAHMI   92 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~   92 (99)
                      |+|..|......++.|..|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            677777777777777777765


No 83 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=80.39  E-value=2.3  Score=18.04  Aligned_cols=23  Identities=35%  Similarity=0.615  Sum_probs=10.4

Q ss_pred             CCceecCCCCccccCc----hHHHHHH
Q psy3483          69 DRPYKCFYCDYRSNER----SNVKAHM   91 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~----~~l~~H~   91 (99)
                      .....|..|++.+...    ++|..|+
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            3345566666555443    4666665


No 84 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=79.68  E-value=0.54  Score=28.50  Aligned_cols=28  Identities=21%  Similarity=0.523  Sum_probs=21.6

Q ss_pred             CCCCceecCCCCccccCchHHHHHHHHh
Q psy3483          67 TKDRPYKCFYCDYRSNERSNVKAHMIRR   94 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f~~~~~l~~H~~~~   94 (99)
                      ...+++.|+.|+.-.....+|.+..++|
T Consensus       205 ~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  205 EKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             ccCCCCCCCCCCCcccccccceeeeecc
Confidence            4567899999998877777777766655


No 85 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=79.12  E-value=0.73  Score=27.15  Aligned_cols=23  Identities=17%  Similarity=0.437  Sum_probs=11.2

Q ss_pred             ceecCCCCccccCchHHHHHHHH
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      .|.|..|++.|.....+..|+..
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhh
Confidence            35555555555555555555443


No 86 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=78.77  E-value=0.74  Score=22.28  Aligned_cols=18  Identities=28%  Similarity=0.183  Sum_probs=9.9

Q ss_pred             CCCcceecc--CCCcccccC
Q psy3483          38 TKYQRYVCC--LCSKYRHSD   55 (99)
Q Consensus        38 ~~~~~~~c~--~c~~~~~~~   55 (99)
                      ..+..++|.  .||..|...
T Consensus        23 ~~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         23 TKERYHQCQNVNCSATFITY   42 (72)
T ss_pred             hheeeeecCCCCCCCEEEEE
Confidence            334456666  677655443


No 87 
>KOG4173|consensus
Probab=78.61  E-value=0.53  Score=27.52  Aligned_cols=74  Identities=19%  Similarity=0.430  Sum_probs=49.3

Q ss_pred             eeC--ccccccccccchhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHH----------hhCCCCceecC
Q psy3483           8 VTC--MYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIR----------THTKDRPYKCF   75 (99)
Q Consensus         8 ~~c--~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~----------~~~~~~~~~C~   75 (99)
                      +-|  ..|-+.|.... .+..|      ...-.   ...|.+|.+.|.+. ..|..|+.          +-.|..-|+|.
T Consensus        80 ~~cqvagc~~~~d~lD-~~E~h------Y~~~h---~~sCs~C~r~~Pt~-hLLd~HI~E~HDs~Fqa~veRG~dMy~Cl  148 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALD-DYEHH------YHTLH---GNSCSFCKRAFPTG-HLLDAHILEWHDSLFQALVERGQDMYQCL  148 (253)
T ss_pred             ccccccchHHHHhhhh-hHHHh------hhhcc---cchhHHHHHhCCch-hhhhHHHHHHHHHHHHHHHHcCccHHHHH
Confidence            445  34666776665 66666      32211   13699999988877 77887754          23456668886


Q ss_pred             C--CCccccCchHHHHHHH
Q psy3483          76 Y--CDYRSNERSNVKAHMI   92 (99)
Q Consensus        76 ~--c~~~f~~~~~l~~H~~   92 (99)
                      +  |+..|........|+.
T Consensus       149 vEgCt~KFkT~r~RkdH~I  167 (253)
T KOG4173|consen  149 VEGCTEKFKTSRDRKDHMI  167 (253)
T ss_pred             HHhhhhhhhhhhhhhhHHH
Confidence            5  9888988887777754


No 88 
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=78.36  E-value=1.8  Score=19.83  Aligned_cols=7  Identities=43%  Similarity=1.060  Sum_probs=3.4

Q ss_pred             ceecCCC
Q psy3483          71 PYKCFYC   77 (99)
Q Consensus        71 ~~~C~~c   77 (99)
                      .|.|.+|
T Consensus        31 tYmC~eC   37 (56)
T PF09963_consen   31 TYMCDEC   37 (56)
T ss_pred             ceeChhH
Confidence            3555554


No 89 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=78.34  E-value=4.1  Score=24.71  Aligned_cols=17  Identities=12%  Similarity=0.335  Sum_probs=12.6

Q ss_pred             CCceeeCcccccccccc
Q psy3483           4 TELIVTCMYCSKILTYE   20 (99)
Q Consensus         4 ~~~~~~c~~c~~~f~~~   20 (99)
                      .++.|.|..|+..++.+
T Consensus       109 ~drqFaC~~Cd~~WwRr  125 (278)
T PF15135_consen  109 VDRQFACSSCDHMWWRR  125 (278)
T ss_pred             cceeeeccccchHHHhc
Confidence            45778999998776654


No 90 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=78.17  E-value=0.46  Score=26.50  Aligned_cols=13  Identities=23%  Similarity=0.306  Sum_probs=9.8

Q ss_pred             eeccCCCcccccC
Q psy3483          43 YVCCLCSKYRHSD   55 (99)
Q Consensus        43 ~~c~~c~~~~~~~   55 (99)
                      ++|+.||..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            7888888876554


No 91 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=77.75  E-value=2.8  Score=16.87  Aligned_cols=9  Identities=33%  Similarity=0.888  Sum_probs=4.3

Q ss_pred             ceecCCCCc
Q psy3483          71 PYKCFYCDY   79 (99)
Q Consensus        71 ~~~C~~c~~   79 (99)
                      +..|+.||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            445555554


No 92 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=77.30  E-value=1.6  Score=22.13  Aligned_cols=31  Identities=19%  Similarity=0.467  Sum_probs=19.8

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcccc
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSN   82 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~   82 (99)
                      ..|.|+.|++.....           .+.-.|.|..|++.|.
T Consensus        35 a~y~CpfCgk~~vkR-----------~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHAVKR-----------QAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCceee-----------eeeEEEEcCCCCCEEe
Confidence            347899998632211           2334689999987765


No 93 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=76.59  E-value=1.4  Score=22.80  Aligned_cols=16  Identities=13%  Similarity=0.488  Sum_probs=12.5

Q ss_pred             ceeeCccccccccccc
Q psy3483           6 LIVTCMYCSKILTYET   21 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~   21 (99)
                      .|++|..||..|..-+
T Consensus         1 MpH~CtrCG~vf~~g~   16 (112)
T COG3364           1 MPHQCTRCGEVFDDGS   16 (112)
T ss_pred             CCceeccccccccccc
Confidence            3678999999988755


No 94 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=75.92  E-value=2.2  Score=22.02  Aligned_cols=12  Identities=25%  Similarity=0.415  Sum_probs=8.0

Q ss_pred             ceeeCccccccc
Q psy3483           6 LIVTCMYCSKIL   17 (99)
Q Consensus         6 ~~~~c~~c~~~f   17 (99)
                      +.|.|+.|+.--
T Consensus        21 k~FtCp~Cghe~   32 (104)
T COG4888          21 KTFTCPRCGHEK   32 (104)
T ss_pred             ceEecCccCCee
Confidence            457788777653


No 95 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=75.46  E-value=1.1  Score=22.62  Aligned_cols=31  Identities=23%  Similarity=0.534  Sum_probs=19.1

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcccc
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSN   82 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~   82 (99)
                      ..|.|+.|++.....         ..  .-.|.|..|++.|.
T Consensus        34 ~ky~Cp~Cgk~~vkR---------~a--~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVKR---------VA--TGIWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEEE---------EE--TTEEEETTTTEEEE
T ss_pred             CCCcCCCCCCceeEE---------ee--eEEeecCCCCCEEe
Confidence            347899998743211         12  23589999987664


No 96 
>KOG2186|consensus
Probab=75.31  E-value=1.2  Score=26.86  Aligned_cols=44  Identities=16%  Similarity=0.489  Sum_probs=23.1

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccCchHHHHH
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNERSNVKAH   90 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~~~~l~~H   90 (99)
                      |.|.+||-. .-. ..+..|+..-.+ .-|.|.-|+..|-. .++..|
T Consensus         4 FtCnvCgEs-vKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH   47 (276)
T KOG2186|consen    4 FTCNVCGES-VKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNH   47 (276)
T ss_pred             Eehhhhhhh-ccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhh
Confidence            456666653 222 445556555444 45666666666655 334444


No 97 
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=75.07  E-value=2.6  Score=20.24  Aligned_cols=60  Identities=17%  Similarity=0.292  Sum_probs=29.0

Q ss_pred             eeeCccccccccccc--hhhhccchhhccCCCCCCCcceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccc
Q psy3483           7 IVTCMYCSKILTYET--ETIMNHCKFCKAVSRPTKYQRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRS   81 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~--~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f   81 (99)
                      -..++-|++.|.-..  ..+.+|      .......+...|..|+..+... ..       ..+ ..+.|+.|+..|
T Consensus        10 ~~~~~cC~~~y~C~~CHde~~~H------~~~~~~~~~v~Cg~C~~~~~~~-~~-------~c~-~~~~C~~C~~~~   71 (71)
T PF05495_consen   10 AIRFPCCGKYYPCRFCHDELEDH------PFDRWPVKRVICGKCRTEQPID-EY-------SCG-ADYFCPICGLYF   71 (71)
T ss_dssp             EEEETTTTEEESSHHHHHHCSSS---------TTT--EEEETTT--EEES--SB-------TT---SEEETTTTEEE
T ss_pred             EEECCcccCeecHHHHHHHhccC------ccccccccCeECCCCCCccChh-hh-------hcC-CCccCcCcCCCC
Confidence            356777888876442  123344      2222333467899998754433 11       111 468888887543


No 98 
>KOG2593|consensus
Probab=74.90  E-value=2  Score=27.94  Aligned_cols=10  Identities=50%  Similarity=1.009  Sum_probs=5.0

Q ss_pred             cceeccCCCc
Q psy3483          41 QRYVCCLCSK   50 (99)
Q Consensus        41 ~~~~c~~c~~   50 (99)
                      +.|.|+.|.+
T Consensus       127 ~~Y~Cp~C~k  136 (436)
T KOG2593|consen  127 AGYVCPNCQK  136 (436)
T ss_pred             ccccCCcccc
Confidence            3455555554


No 99 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=74.02  E-value=1.4  Score=21.78  Aligned_cols=12  Identities=17%  Similarity=0.470  Sum_probs=5.7

Q ss_pred             ceeccCCCcccc
Q psy3483          42 RYVCCLCSKYRH   53 (99)
Q Consensus        42 ~~~c~~c~~~~~   53 (99)
                      ...|..|+..|.
T Consensus        46 ~~~C~~Cg~~~~   57 (81)
T PF05129_consen   46 ILSCRVCGESFQ   57 (81)
T ss_dssp             EEEESSS--EEE
T ss_pred             EEEecCCCCeEE
Confidence            356777766443


No 100
>PRK14873 primosome assembly protein PriA; Provisional
Probab=73.76  E-value=2.6  Score=29.15  Aligned_cols=10  Identities=20%  Similarity=0.567  Sum_probs=6.0

Q ss_pred             eCcccccccc
Q psy3483           9 TCMYCSKILT   18 (99)
Q Consensus         9 ~c~~c~~~f~   18 (99)
                      .|..||..+.
T Consensus       385 ~C~~Cg~~~~  394 (665)
T PRK14873        385 ACARCRTPAR  394 (665)
T ss_pred             EhhhCcCeeE
Confidence            4666666654


No 101
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=73.66  E-value=0.48  Score=21.31  Aligned_cols=24  Identities=21%  Similarity=0.310  Sum_probs=8.6

Q ss_pred             ceecCCCCccccCchHHHHHHHHh
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRR   94 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~   94 (99)
                      .|.|+.|...|-..=++-+|...|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-
T ss_pred             eEECCCCCCccccCcChhhhcccc
Confidence            355555555555444444444433


No 102
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=73.42  E-value=1.8  Score=21.99  Aligned_cols=30  Identities=23%  Similarity=0.553  Sum_probs=19.0

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcccc
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSN   82 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~   82 (99)
                      .|.|+.|++.....           .+.-.|.|..|++.|.
T Consensus        35 ~y~CpfCgk~~vkR-----------~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        35 KYVCPFCGKKTVKR-----------GSTGIWTCRKCGAKFA   64 (91)
T ss_pred             CccCCCCCCCceEE-----------EeeEEEEcCCCCCEEe
Confidence            47799888632211           2334689999987764


No 103
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=73.22  E-value=4.3  Score=15.34  Aligned_cols=19  Identities=16%  Similarity=0.361  Sum_probs=10.0

Q ss_pred             ecCCCCccccCchHHHHHHH
Q psy3483          73 KCFYCDYRSNERSNVKAHMI   92 (99)
Q Consensus        73 ~C~~c~~~f~~~~~l~~H~~   92 (99)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666655 3345555543


No 104
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=72.86  E-value=2.6  Score=17.89  Aligned_cols=12  Identities=33%  Similarity=0.636  Sum_probs=8.7

Q ss_pred             ceeeCccccccc
Q psy3483           6 LIVTCMYCSKIL   17 (99)
Q Consensus         6 ~~~~c~~c~~~f   17 (99)
                      ++..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            456788888766


No 105
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=71.91  E-value=3.9  Score=18.24  Aligned_cols=8  Identities=38%  Similarity=1.269  Sum_probs=4.2

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      |.|..||+
T Consensus         7 Y~C~~Cg~   14 (49)
T COG1996           7 YKCARCGR   14 (49)
T ss_pred             EEhhhcCC
Confidence            45555555


No 106
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=71.70  E-value=1.4  Score=30.60  Aligned_cols=56  Identities=21%  Similarity=0.459  Sum_probs=28.3

Q ss_pred             CccccccccccchhhhccchhhccCCCCCCCcce-eccCCCcccccChhHHHHHHHhhCCCCceecCCCCcc
Q psy3483          10 CMYCSKILTYETETIMNHCKFCKAVSRPTKYQRY-VCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYR   80 (99)
Q Consensus        10 c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~-~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~   80 (99)
                      |..||-+|.-.. .|..-       +.++.-+.| .|+.|.+.+... ...    +.|  ..|..|+.||..
T Consensus       126 CT~CGPRfTIi~-alPYD-------R~nTsM~~F~lC~~C~~EY~dP-~nR----RfH--AQp~aCp~CGP~  182 (750)
T COG0068         126 CTNCGPRFTIIE-ALPYD-------RENTSMADFPLCPFCDKEYKDP-LNR----RFH--AQPIACPKCGPH  182 (750)
T ss_pred             cCCCCcceeeec-cCCCC-------cccCccccCcCCHHHHHHhcCc-ccc----ccc--cccccCcccCCC
Confidence            677777776544 33332       223322221 366676543333 222    222  447888888863


No 107
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=71.51  E-value=3  Score=16.25  Aligned_cols=18  Identities=28%  Similarity=0.610  Sum_probs=10.4

Q ss_pred             eeCccccccccccchhhhcc
Q psy3483           8 VTCMYCSKILTYETETIMNH   27 (99)
Q Consensus         8 ~~c~~c~~~f~~~~~~~~~h   27 (99)
                      |.|-.|++.|...  .+..|
T Consensus         1 ~sCiDC~~~F~~~--~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDFDGD--SYKSH   18 (28)
T ss_dssp             EEETTTTEEEEGG--GTTT-
T ss_pred             CeeecCCCCcCcC--CcCCC
Confidence            4577788888433  34444


No 108
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=71.37  E-value=2.2  Score=17.89  Aligned_cols=15  Identities=20%  Similarity=0.436  Sum_probs=12.1

Q ss_pred             eeeCccccccccccc
Q psy3483           7 IVTCMYCSKILTYET   21 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~   21 (99)
                      |+.|..|++.|-.+-
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            788999999987543


No 109
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=71.26  E-value=4.2  Score=21.50  Aligned_cols=27  Identities=19%  Similarity=0.224  Sum_probs=23.5

Q ss_pred             CCceecCCCCccccCchHHHHHHHHhc
Q psy3483          69 DRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      ...|.|..|...|...-++.+|...|+
T Consensus        79 ~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        79 SHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ccceeCCCCCCccccccchhhhhhccC
Confidence            447999999999999999999988775


No 110
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=71.19  E-value=2.2  Score=17.65  Aligned_cols=14  Identities=14%  Similarity=0.301  Sum_probs=10.4

Q ss_pred             eeeCcccccccccc
Q psy3483           7 IVTCMYCSKILTYE   20 (99)
Q Consensus         7 ~~~c~~c~~~f~~~   20 (99)
                      .|.|..||..|...
T Consensus         5 ~y~C~~Cg~~fe~~   18 (41)
T smart00834        5 EYRCEDCGHTFEVL   18 (41)
T ss_pred             EEEcCCCCCEEEEE
Confidence            47888999887633


No 111
>PLN02294 cytochrome c oxidase subunit Vb
Probab=70.59  E-value=2.6  Score=24.00  Aligned_cols=16  Identities=19%  Similarity=0.472  Sum_probs=11.9

Q ss_pred             CceeeCcccccccccc
Q psy3483           5 ELIVTCMYCSKILTYE   20 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~   20 (99)
                      .+|..|+.||..|..+
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            3577888888887755


No 112
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=70.46  E-value=3.5  Score=19.31  Aligned_cols=11  Identities=18%  Similarity=0.341  Sum_probs=3.7

Q ss_pred             ceecCCCCccc
Q psy3483          71 PYKCFYCDYRS   81 (99)
Q Consensus        71 ~~~C~~c~~~f   81 (99)
                      .+.|..||..|
T Consensus        25 rhhCr~CG~~v   35 (69)
T PF01363_consen   25 RHHCRNCGRVV   35 (69)
T ss_dssp             EEE-TTT--EE
T ss_pred             eEccCCCCCEE
Confidence            34455544443


No 113
>KOG1280|consensus
Probab=69.83  E-value=3.4  Score=26.23  Aligned_cols=22  Identities=27%  Similarity=0.407  Sum_probs=10.7

Q ss_pred             CceeeCccccccccccchhhhcc
Q psy3483           5 ELIVTCMYCSKILTYETETIMNH   27 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~~~~~~~h   27 (99)
                      +..|+|++|+..-..+. .|.-|
T Consensus        77 ~qSftCPyC~~~Gfte~-~f~~H   98 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTER-QFGTH   98 (381)
T ss_pred             cccccCCcccccccchh-HHHHH
Confidence            34566666665433333 34444


No 114
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=69.43  E-value=2.3  Score=21.52  Aligned_cols=31  Identities=16%  Similarity=0.449  Sum_probs=19.4

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcccc
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSN   82 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~   82 (99)
                      ..|.|+.|++.....           .+.-.|.|..|++.|.
T Consensus        35 a~y~CpfCgk~~vkR-----------~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         35 AKHVCPVCGRPKVKR-----------VGTGIWECRKCGAKFA   65 (90)
T ss_pred             cCccCCCCCCCceEE-----------EEEEEEEcCCCCCEEe
Confidence            347899887632211           2234689999987764


No 115
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=68.97  E-value=6.3  Score=17.93  Aligned_cols=11  Identities=18%  Similarity=0.540  Sum_probs=7.6

Q ss_pred             eeCcccccccc
Q psy3483           8 VTCMYCSKILT   18 (99)
Q Consensus         8 ~~c~~c~~~f~   18 (99)
                      +.|+.||..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            56778887654


No 116
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=68.66  E-value=4.3  Score=27.13  Aligned_cols=10  Identities=40%  Similarity=0.796  Sum_probs=5.7

Q ss_pred             eCcccccccc
Q psy3483           9 TCMYCSKILT   18 (99)
Q Consensus         9 ~c~~c~~~f~   18 (99)
                      .|..||....
T Consensus       215 ~C~~Cg~~~~  224 (505)
T TIGR00595       215 LCRSCGYILC  224 (505)
T ss_pred             EhhhCcCccC
Confidence            4666666544


No 117
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=66.96  E-value=3.9  Score=22.84  Aligned_cols=33  Identities=24%  Similarity=0.525  Sum_probs=23.2

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      -+|.|. |+..+.+    ...|..+-.|+ .|.|..|+-
T Consensus       116 ~~Y~C~-C~q~~l~----~RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         116 YPYRCQ-CQQHYLR----IRRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eeEEee-cCCccch----hhhcccccccc-eEEeccCCc
Confidence            468898 9885443    35566666677 899999964


No 118
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=65.30  E-value=3.9  Score=17.10  Aligned_cols=8  Identities=63%  Similarity=1.817  Sum_probs=5.3

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (39)
T PF01096_consen   29 YVCCNCGH   36 (39)
T ss_dssp             EEESSSTE
T ss_pred             EEeCCCCC
Confidence            66777765


No 119
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=65.12  E-value=6.7  Score=16.48  Aligned_cols=8  Identities=50%  Similarity=1.356  Sum_probs=4.6

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            55666654


No 120
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=64.28  E-value=2.9  Score=17.82  Aligned_cols=16  Identities=25%  Similarity=0.526  Sum_probs=10.1

Q ss_pred             ceeeCccccccccccc
Q psy3483           6 LIVTCMYCSKILTYET   21 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~~   21 (99)
                      .|+.|..|++.|-.+-
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            5789999999987553


No 121
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.91  E-value=5.7  Score=18.56  Aligned_cols=9  Identities=33%  Similarity=1.003  Sum_probs=4.8

Q ss_pred             ceeccCCCc
Q psy3483          42 RYVCCLCSK   50 (99)
Q Consensus        42 ~~~c~~c~~   50 (99)
                      .|.|++|..
T Consensus        31 tymC~eC~~   39 (68)
T COG4896          31 TYMCPECEH   39 (68)
T ss_pred             eEechhhHh
Confidence            355666543


No 122
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=63.37  E-value=4.2  Score=18.13  Aligned_cols=15  Identities=20%  Similarity=0.611  Sum_probs=9.5

Q ss_pred             CceeeCccccccccc
Q psy3483           5 ELIVTCMYCSKILTY   19 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~   19 (99)
                      ++.+.|..||..|..
T Consensus         2 Dk~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVF   16 (49)
T ss_pred             CeeEEcccCCCeEEE
Confidence            456677777776643


No 123
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=62.86  E-value=10  Score=16.55  Aligned_cols=10  Identities=30%  Similarity=0.949  Sum_probs=5.1

Q ss_pred             ceecCCCCcc
Q psy3483          71 PYKCFYCDYR   80 (99)
Q Consensus        71 ~~~C~~c~~~   80 (99)
                      .+.|+.|+..
T Consensus        20 ~~vC~~Cg~~   29 (52)
T smart00661       20 RFVCRKCGYE   29 (52)
T ss_pred             EEECCcCCCe
Confidence            3555555544


No 124
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=62.64  E-value=6.4  Score=20.00  Aligned_cols=27  Identities=22%  Similarity=0.479  Sum_probs=16.2

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCC
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCD   78 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~   78 (99)
                      +|-.|..||..|...           .-.+|-.|+.|.
T Consensus        57 ~Pa~CkkCGfef~~~-----------~ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDD-----------KIKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCcccccc-----------ccCCcccCCcch
Confidence            355677787655432           224567777775


No 125
>KOG3507|consensus
Probab=62.49  E-value=7  Score=18.11  Aligned_cols=31  Identities=23%  Similarity=0.502  Sum_probs=19.7

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccC
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~   83 (99)
                      ..|.|..|+.....            .....+.|.+||....+
T Consensus        19 miYiCgdC~~en~l------------k~~D~irCReCG~RIly   49 (62)
T KOG3507|consen   19 MIYICGDCGQENTL------------KRGDVIRCRECGYRILY   49 (62)
T ss_pred             EEEEeccccccccc------------cCCCcEehhhcchHHHH
Confidence            34888888863221            22457889999875443


No 126
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=61.54  E-value=7.4  Score=16.48  Aligned_cols=10  Identities=20%  Similarity=0.550  Sum_probs=6.8

Q ss_pred             eeCccccccc
Q psy3483           8 VTCMYCSKIL   17 (99)
Q Consensus         8 ~~c~~c~~~f   17 (99)
                      +.|+.|+...
T Consensus         1 m~Cp~Cg~~~   10 (43)
T PF08271_consen    1 MKCPNCGSKE   10 (43)
T ss_dssp             ESBTTTSSSE
T ss_pred             CCCcCCcCCc
Confidence            4678888753


No 127
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=60.91  E-value=8.4  Score=15.85  Aligned_cols=10  Identities=30%  Similarity=0.823  Sum_probs=5.8

Q ss_pred             eCcccccccc
Q psy3483           9 TCMYCSKILT   18 (99)
Q Consensus         9 ~c~~c~~~f~   18 (99)
                      .|+.||+.|-
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            4666666644


No 128
>KOG2482|consensus
Probab=59.27  E-value=5.3  Score=25.47  Aligned_cols=33  Identities=24%  Similarity=0.462  Sum_probs=23.9

Q ss_pred             eeeCccccccccccchhhhccchhhccCCCCCCC
Q psy3483           7 IVTCMYCSKILTYETETIMNHCKFCKAVSRPTKY   40 (99)
Q Consensus         7 ~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~   40 (99)
                      .+.|-+|.+.|..+- .|+.|++-.++.+.++..
T Consensus       195 r~~CLyCekifrdkn-tLkeHMrkK~HrrinPkn  227 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKN-TLKEHMRKKRHRRINPKN  227 (423)
T ss_pred             hheeeeeccccCCcH-HHHHHHHhccCcccCCCc
Confidence            478999999999998 899995544444444433


No 129
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=57.97  E-value=8.9  Score=20.21  Aligned_cols=24  Identities=21%  Similarity=0.366  Sum_probs=15.1

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      ..|..|+..|...             ...+.|+.||.
T Consensus        71 ~~C~~Cg~~~~~~-------------~~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIH-------------QHDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecC-------------CcCccCcCCCC
Confidence            5688888654432             23456888874


No 130
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=55.74  E-value=4.5  Score=18.10  Aligned_cols=12  Identities=33%  Similarity=0.708  Sum_probs=6.3

Q ss_pred             eCcccccccccc
Q psy3483           9 TCMYCSKILTYE   20 (99)
Q Consensus         9 ~c~~c~~~f~~~   20 (99)
                      .||.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999988654


No 131
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=55.36  E-value=11  Score=19.96  Aligned_cols=24  Identities=25%  Similarity=0.456  Sum_probs=15.5

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      ..|..|+..+...             +..+.|+.|+.
T Consensus        71 ~~C~~Cg~~~~~~-------------~~~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPE-------------IDLYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecC-------------CcCccCcCCcC
Confidence            5688888754432             12467888874


No 132
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.27  E-value=11  Score=20.60  Aligned_cols=13  Identities=15%  Similarity=0.621  Sum_probs=8.7

Q ss_pred             eeeCccccccccc
Q psy3483           7 IVTCMYCSKILTY   19 (99)
Q Consensus         7 ~~~c~~c~~~f~~   19 (99)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            4677777776654


No 133
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.10  E-value=7.9  Score=18.13  Aligned_cols=12  Identities=42%  Similarity=0.800  Sum_probs=8.7

Q ss_pred             eeeCcccccccc
Q psy3483           7 IVTCMYCSKILT   18 (99)
Q Consensus         7 ~~~c~~c~~~f~   18 (99)
                      .-.|++|+..|.
T Consensus        48 ev~CPYC~t~y~   59 (62)
T COG4391          48 EVVCPYCSTRYR   59 (62)
T ss_pred             cEecCccccEEE
Confidence            346888888775


No 134
>KOG2482|consensus
Probab=54.85  E-value=8.5  Score=24.63  Aligned_cols=23  Identities=26%  Similarity=0.816  Sum_probs=20.9

Q ss_pred             eecCCCCccccCchHHHHHHHHh
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRR   94 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~   94 (99)
                      +.|..|.+.|..+..|..||+.-
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhc
Confidence            78999999999999999999853


No 135
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=54.56  E-value=17  Score=18.97  Aligned_cols=13  Identities=23%  Similarity=0.554  Sum_probs=9.3

Q ss_pred             ceeeCcccccccc
Q psy3483           6 LIVTCMYCSKILT   18 (99)
Q Consensus         6 ~~~~c~~c~~~f~   18 (99)
                      +|-.|++||..-.
T Consensus         1 ~p~~CpYCg~~~~   13 (102)
T PF11672_consen    1 KPIICPYCGGPAE   13 (102)
T ss_pred             CCcccCCCCCeeE
Confidence            4667999997643


No 136
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=54.51  E-value=7.4  Score=17.40  Aligned_cols=25  Identities=28%  Similarity=0.580  Sum_probs=14.4

Q ss_pred             eccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          44 VCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        44 ~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      .|+.||..     ..+..|.      ..|.|..|+.
T Consensus        21 ~CPrCG~g-----vfmA~H~------dR~~CGkCgy   45 (51)
T COG1998          21 FCPRCGPG-----VFMADHK------DRWACGKCGY   45 (51)
T ss_pred             cCCCCCCc-----chhhhcC------ceeEeccccc
Confidence            47888763     2233331      2578888875


No 137
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.91  E-value=7.6  Score=20.49  Aligned_cols=14  Identities=14%  Similarity=0.078  Sum_probs=9.7

Q ss_pred             CCceecCCCCcccc
Q psy3483          69 DRPYKCFYCDYRSN   82 (99)
Q Consensus        69 ~~~~~C~~c~~~f~   82 (99)
                      ..|..|+.||++|+
T Consensus        24 rdPiVsPytG~s~P   37 (129)
T COG4530          24 RDPIVSPYTGKSYP   37 (129)
T ss_pred             CCccccCcccccch
Confidence            55777777777763


No 138
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=53.83  E-value=11  Score=20.04  Aligned_cols=11  Identities=27%  Similarity=0.407  Sum_probs=7.5

Q ss_pred             eeccCCCcccc
Q psy3483          43 YVCCLCSKYRH   53 (99)
Q Consensus        43 ~~c~~c~~~~~   53 (99)
                      ..|..||..+.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            56888886443


No 140
>KOG1146|consensus
Probab=53.10  E-value=7.9  Score=29.16  Aligned_cols=53  Identities=21%  Similarity=0.432  Sum_probs=36.0

Q ss_pred             cceeccCCCcccccChhHHHHHHHh-----------------hCCCCceecCCCCccccCchHHHHHHHHhc
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRT-----------------HTKDRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~-----------------~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      ..|.|..|...|... .-+..|.+.                 +....+| |..|...|.....|.+|++.-.
T Consensus      1283 ~~~~~~~~~~~~~~~-~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1283 HRYLCRQCKMAFDGE-APLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             hhHHHHHHHhhhcch-hHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhh
Confidence            457788887655555 556666531                 1122345 9999999999999999988543


No 141
>KOG4167|consensus
Probab=52.67  E-value=2.9  Score=29.29  Aligned_cols=25  Identities=24%  Similarity=0.452  Sum_probs=21.0

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhC
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHT   67 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~   67 (99)
                      .|.|.+|++.|+-. .++..|+++|.
T Consensus       792 iFpCreC~kvF~Ki-KSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKI-KSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHH-hhhhHHHHHHH
Confidence            48899999988776 88999998874


No 142
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=52.52  E-value=14  Score=16.40  Aligned_cols=8  Identities=25%  Similarity=0.758  Sum_probs=4.0

Q ss_pred             eccCCCcc
Q psy3483          44 VCCLCSKY   51 (99)
Q Consensus        44 ~c~~c~~~   51 (99)
                      .|..||..
T Consensus        20 ~Cr~Cg~~   27 (57)
T cd00065          20 HCRNCGRI   27 (57)
T ss_pred             ccCcCcCC
Confidence            35555543


No 143
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=52.14  E-value=15  Score=16.79  Aligned_cols=7  Identities=29%  Similarity=0.657  Sum_probs=3.0

Q ss_pred             eecCCCC
Q psy3483          72 YKCFYCD   78 (99)
Q Consensus        72 ~~C~~c~   78 (99)
                      ..|+.|+
T Consensus        22 VvCp~Cg   28 (54)
T PF14446_consen   22 VVCPECG   28 (54)
T ss_pred             EECCCCC
Confidence            4444443


No 144
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=51.22  E-value=15  Score=24.41  Aligned_cols=8  Identities=38%  Similarity=1.132  Sum_probs=3.8

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      |.|..||.
T Consensus         8 y~C~~Cg~   15 (454)
T TIGR00416         8 FVCQHCGA   15 (454)
T ss_pred             EECCcCCC
Confidence            44544543


No 145
>PRK12496 hypothetical protein; Provisional
Probab=50.77  E-value=13  Score=21.07  Aligned_cols=11  Identities=27%  Similarity=0.522  Sum_probs=7.5

Q ss_pred             eeCcccccccc
Q psy3483           8 VTCMYCSKILT   18 (99)
Q Consensus         8 ~~c~~c~~~f~   18 (99)
                      +.|..|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            55777777765


No 146
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=50.25  E-value=22  Score=15.03  Aligned_cols=7  Identities=29%  Similarity=0.837  Sum_probs=4.0

Q ss_pred             eccCCCc
Q psy3483          44 VCCLCSK   50 (99)
Q Consensus        44 ~c~~c~~   50 (99)
                      .|.+||-
T Consensus        15 ~C~~CgM   21 (41)
T PF13878_consen   15 TCPTCGM   21 (41)
T ss_pred             CCCCCCC
Confidence            4666654


No 147
>PRK11823 DNA repair protein RadA; Provisional
Probab=49.98  E-value=16  Score=24.14  Aligned_cols=8  Identities=50%  Similarity=1.207  Sum_probs=4.3

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      |.|..||.
T Consensus         8 y~C~~Cg~   15 (446)
T PRK11823          8 YVCQECGA   15 (446)
T ss_pred             EECCcCCC
Confidence            55555554


No 148
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=49.72  E-value=27  Score=26.55  Aligned_cols=34  Identities=26%  Similarity=0.483  Sum_probs=19.3

Q ss_pred             eeCccccccccccchhhhccchhhccCCCCCCCcceeccCCCcc
Q psy3483           8 VTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSKY   51 (99)
Q Consensus         8 ~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~~   51 (99)
                      +.|+.||.....      .-|..|++..    ...+.|+.||..
T Consensus       668 rkCPkCG~~t~~------~fCP~CGs~t----e~vy~CPsCGae  701 (1337)
T PRK14714        668 RRCPSCGTETYE------NRCPDCGTHT----EPVYVCPDCGAE  701 (1337)
T ss_pred             EECCCCCCcccc------ccCcccCCcC----CCceeCccCCCc
Confidence            679999975321      1244443332    124678888863


No 149
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=49.32  E-value=9.7  Score=21.17  Aligned_cols=8  Identities=38%  Similarity=0.891  Sum_probs=5.1

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      +.|..||.
T Consensus       113 l~C~~Cg~  120 (146)
T PF07295_consen  113 LVCENCGH  120 (146)
T ss_pred             EecccCCC
Confidence            56666665


No 150
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=49.05  E-value=5.8  Score=20.76  Aligned_cols=23  Identities=13%  Similarity=0.137  Sum_probs=19.3

Q ss_pred             ceecCCCCccccCchHHHHHHHH
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      .+.|.+|.+-|.....|..|.+.
T Consensus        55 qhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhcc
Confidence            37899999999999899888763


No 151
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.72  E-value=8.2  Score=16.60  Aligned_cols=12  Identities=25%  Similarity=0.789  Sum_probs=9.3

Q ss_pred             eCcccccccccc
Q psy3483           9 TCMYCSKILTYE   20 (99)
Q Consensus         9 ~c~~c~~~f~~~   20 (99)
                      .|+.|++.|.-.
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            489999988654


No 152
>PRK05580 primosome assembly protein PriA; Validated
Probab=48.69  E-value=14  Score=25.81  Aligned_cols=8  Identities=25%  Similarity=0.721  Sum_probs=4.1

Q ss_pred             Cccccccc
Q psy3483          10 CMYCSKIL   17 (99)
Q Consensus        10 c~~c~~~f   17 (99)
                      |..||...
T Consensus       384 C~~Cg~~~  391 (679)
T PRK05580        384 CRDCGWVA  391 (679)
T ss_pred             hhhCcCcc
Confidence            55555543


No 153
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=48.62  E-value=12  Score=19.23  Aligned_cols=17  Identities=18%  Similarity=0.352  Sum_probs=13.1

Q ss_pred             hCCCCceecCCCCccccC
Q psy3483          66 HTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus        66 ~~~~~~~~C~~c~~~f~~   83 (99)
                      +.+ +|..|.+||..|..
T Consensus        75 ~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          75 EKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             eCC-CceeCCCCCcEEEE
Confidence            344 79999999988864


No 154
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=48.10  E-value=15  Score=19.36  Aligned_cols=25  Identities=24%  Similarity=0.491  Sum_probs=14.4

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      ..|..|+..+... .           ...+.|+.||.
T Consensus        71 ~~C~~Cg~~~~~~-~-----------~~~~~CP~Cgs   95 (114)
T PRK03681         71 CWCETCQQYVTLL-T-----------QRVRRCPQCHG   95 (114)
T ss_pred             EEcccCCCeeecC-C-----------ccCCcCcCcCC
Confidence            5688888744322 0           11256888874


No 155
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=47.10  E-value=10  Score=22.78  Aligned_cols=17  Identities=18%  Similarity=0.487  Sum_probs=13.4

Q ss_pred             CceeeCccccccccccc
Q psy3483           5 ELIVTCMYCSKILTYET   21 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~~   21 (99)
                      .++..|+.||..|....
T Consensus       179 GkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        179 GFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCccCCCCCcEEEEEE
Confidence            45789999999988543


No 156
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=46.82  E-value=9.3  Score=22.48  Aligned_cols=12  Identities=25%  Similarity=0.401  Sum_probs=6.3

Q ss_pred             eeeCcccccccc
Q psy3483           7 IVTCMYCSKILT   18 (99)
Q Consensus         7 ~~~c~~c~~~f~   18 (99)
                      ||.|..|.+.|.
T Consensus       196 PF~C~iCKkdy~  207 (259)
T COG5152         196 PFLCGICKKDYE  207 (259)
T ss_pred             ceeehhchhhcc
Confidence            455555555544


No 157
>PRK04023 DNA polymerase II large subunit; Validated
Probab=46.46  E-value=27  Score=25.99  Aligned_cols=9  Identities=33%  Similarity=0.656  Sum_probs=5.9

Q ss_pred             eeCcccccc
Q psy3483           8 VTCMYCSKI   16 (99)
Q Consensus         8 ~~c~~c~~~   16 (99)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            457777765


No 158
>COG2879 Uncharacterized small protein [Function unknown]
Probab=45.31  E-value=27  Score=16.48  Aligned_cols=16  Identities=38%  Similarity=0.569  Sum_probs=11.1

Q ss_pred             chHHHHHHHHhcCCCC
Q psy3483          84 RSNVKAHMIRRHSVKP   99 (99)
Q Consensus        84 ~~~l~~H~~~~~~~kp   99 (99)
                      =.++..|++.++.++|
T Consensus        25 YdnYVehmr~~hPd~p   40 (65)
T COG2879          25 YDNYVEHMRKKHPDKP   40 (65)
T ss_pred             HHHHHHHHHHhCcCCC
Confidence            3467778887777665


No 159
>PF14369 zf-RING_3:  zinc-finger
Probab=45.17  E-value=10  Score=15.45  Aligned_cols=11  Identities=18%  Similarity=0.392  Sum_probs=8.8

Q ss_pred             eCccccccccc
Q psy3483           9 TCMYCSKILTY   19 (99)
Q Consensus         9 ~c~~c~~~f~~   19 (99)
                      .|+.|+.+|..
T Consensus        23 ~CP~C~~gFvE   33 (35)
T PF14369_consen   23 ACPRCHGGFVE   33 (35)
T ss_pred             CCcCCCCcEeE
Confidence            49999988864


No 160
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=44.19  E-value=6.4  Score=20.70  Aligned_cols=25  Identities=20%  Similarity=0.393  Sum_probs=14.2

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCcc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYR   80 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~   80 (99)
                      ..|..||..|... .            ..+.|+.|+..
T Consensus        71 ~~C~~Cg~~~~~~-~------------~~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPD-E------------FDFSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECH-H------------CCHH-SSSSSS
T ss_pred             EECCCCCCEEecC-C------------CCCCCcCCcCC
Confidence            5788898865433 1            12558888754


No 161
>COG1773 Rubredoxin [Energy production and conversion]
Probab=44.06  E-value=13  Score=17.08  Aligned_cols=12  Identities=25%  Similarity=0.866  Sum_probs=6.8

Q ss_pred             ceecCCCCcccc
Q psy3483          71 PYKCFYCDYRSN   82 (99)
Q Consensus        71 ~~~C~~c~~~f~   82 (99)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            356666665543


No 162
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=42.25  E-value=23  Score=23.79  Aligned_cols=23  Identities=17%  Similarity=0.379  Sum_probs=20.3

Q ss_pred             ceecCCCCccccCchHHHHHHHH
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      -|.|+.|.+.|.....+..|+..
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHH
Confidence            47899999999999999999764


No 163
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=41.28  E-value=33  Score=15.26  Aligned_cols=11  Identities=27%  Similarity=0.815  Sum_probs=8.2

Q ss_pred             CceecCCCCcc
Q psy3483          70 RPYKCFYCDYR   80 (99)
Q Consensus        70 ~~~~C~~c~~~   80 (99)
                      ..+.|..|+..
T Consensus        36 ~r~~C~~Cgyt   46 (50)
T PRK00432         36 DRWHCGKCGYT   46 (50)
T ss_pred             CcEECCCcCCE
Confidence            46888888864


No 164
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=40.86  E-value=25  Score=22.77  Aligned_cols=7  Identities=29%  Similarity=0.809  Sum_probs=3.8

Q ss_pred             eccCCCc
Q psy3483          44 VCCLCSK   50 (99)
Q Consensus        44 ~c~~c~~   50 (99)
                      .|+.|+.
T Consensus        16 ~cp~c~~   22 (372)
T cd01121          16 KCPECGE   22 (372)
T ss_pred             ECcCCCC
Confidence            4666653


No 165
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=40.36  E-value=25  Score=19.37  Aligned_cols=22  Identities=14%  Similarity=0.227  Sum_probs=15.0

Q ss_pred             eecCCCCccccCchHHHHHHHHhcC
Q psy3483          72 YKCFYCDYRSNERSNVKAHMIRRHS   96 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~~~~~   96 (99)
                      ..|.++|+.|   ..|.+|+.+|.|
T Consensus        77 IicLEDGkkf---KSLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKF---KSLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcch---HHHHHHHhcccC
Confidence            4577777765   467778777765


No 166
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=40.21  E-value=34  Score=15.88  Aligned_cols=16  Identities=19%  Similarity=0.673  Sum_probs=11.5

Q ss_pred             CCCCceecCCCCcccc
Q psy3483          67 TKDRPYKCFYCDYRSN   82 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f~   82 (99)
                      ...+.|.|+.||....
T Consensus        42 ~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   42 RSGRVFTCPNCGFEMD   57 (69)
T ss_pred             cccceEEcCCCCCEEC
Confidence            4466789999987644


No 167
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=39.98  E-value=17  Score=16.85  Aligned_cols=13  Identities=15%  Similarity=0.427  Sum_probs=8.0

Q ss_pred             CCCCceecCCCCc
Q psy3483          67 TKDRPYKCFYCDY   79 (99)
Q Consensus        67 ~~~~~~~C~~c~~   79 (99)
                      .|++...|+.|..
T Consensus        40 ~GE~VArCPSCSL   52 (67)
T COG5216          40 NGEVVARCPSCSL   52 (67)
T ss_pred             CCceEEEcCCceE
Confidence            4566666666654


No 168
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=39.67  E-value=35  Score=17.71  Aligned_cols=7  Identities=29%  Similarity=0.913  Sum_probs=4.6

Q ss_pred             eeCcccc
Q psy3483           8 VTCMYCS   14 (99)
Q Consensus         8 ~~c~~c~   14 (99)
                      |.|+.|+
T Consensus        22 f~CP~Cg   28 (99)
T PRK14892         22 FECPRCG   28 (99)
T ss_pred             eECCCCC
Confidence            5666666


No 169
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=39.65  E-value=15  Score=15.00  Aligned_cols=12  Identities=25%  Similarity=0.379  Sum_probs=4.8

Q ss_pred             ecCCCCccccCc
Q psy3483          73 KCFYCDYRSNER   84 (99)
Q Consensus        73 ~C~~c~~~f~~~   84 (99)
                      .|.+|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            566676666544


No 170
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=39.06  E-value=22  Score=20.49  Aligned_cols=8  Identities=25%  Similarity=0.820  Sum_probs=4.1

Q ss_pred             eecCCCCc
Q psy3483          72 YKCFYCDY   79 (99)
Q Consensus        72 ~~C~~c~~   79 (99)
                      |.|+.||.
T Consensus       133 F~Cp~Cg~  140 (176)
T COG1675         133 FTCPKCGE  140 (176)
T ss_pred             CCCCCCCc
Confidence            55555543


No 171
>KOG2231|consensus
Probab=38.39  E-value=32  Score=24.24  Aligned_cols=18  Identities=17%  Similarity=0.619  Sum_probs=11.6

Q ss_pred             eCccccccccccchhhhcc
Q psy3483           9 TCMYCSKILTYETETIMNH   27 (99)
Q Consensus         9 ~c~~c~~~f~~~~~~~~~h   27 (99)
                      .|..|...|.... .|..|
T Consensus       184 ~C~~C~~~fld~~-el~rH  201 (669)
T KOG2231|consen  184 LCKFCHERFLDDD-ELYRH  201 (669)
T ss_pred             cchhhhhhhccHH-HHHHh
Confidence            4666777666665 66666


No 172
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=37.45  E-value=7.7  Score=24.24  Aligned_cols=16  Identities=25%  Similarity=0.663  Sum_probs=9.5

Q ss_pred             CCCCCCCcceeccCCCc
Q psy3483          34 VSRPTKYQRYVCCLCSK   50 (99)
Q Consensus        34 ~~~~~~~~~~~c~~c~~   50 (99)
                      ++.|.+.+|+ |++|..
T Consensus        52 IR~hL~~qp~-CP~Cr~   67 (391)
T COG5432          52 IRRHLGTQPF-CPVCRE   67 (391)
T ss_pred             HHHHhcCCCC-Cccccc
Confidence            3445666665 777753


No 173
>PHA02998 RNA polymerase subunit; Provisional
Probab=37.43  E-value=30  Score=20.08  Aligned_cols=12  Identities=17%  Similarity=0.304  Sum_probs=7.1

Q ss_pred             eecCCCCccccC
Q psy3483          72 YKCFYCDYRSNE   83 (99)
Q Consensus        72 ~~C~~c~~~f~~   83 (99)
                      |.|..|+..|..
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            566666665543


No 174
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=37.14  E-value=19  Score=19.50  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=13.6

Q ss_pred             CCCCceecCCCCccccCc
Q psy3483          67 TKDRPYKCFYCDYRSNER   84 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f~~~   84 (99)
                      .+...|.|..|++.|...
T Consensus        49 ~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          49 RGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccccCCcCcceeee
Confidence            346679999999888754


No 175
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=37.10  E-value=15  Score=16.57  Aligned_cols=10  Identities=30%  Similarity=1.002  Sum_probs=7.7

Q ss_pred             eCcccccccc
Q psy3483           9 TCMYCSKILT   18 (99)
Q Consensus         9 ~c~~c~~~f~   18 (99)
                      .|++||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5888888765


No 176
>KOG2785|consensus
Probab=36.99  E-value=60  Score=21.27  Aligned_cols=23  Identities=26%  Similarity=0.625  Sum_probs=18.2

Q ss_pred             ceecCCCC---ccccCchHHHHHHHH
Q psy3483          71 PYKCFYCD---YRSNERSNVKAHMIR   93 (99)
Q Consensus        71 ~~~C~~c~---~~f~~~~~l~~H~~~   93 (99)
                      .+.|..|.   +.|........||..
T Consensus       217 ~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  217 GFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CceEEEeccccCcccccHHHHHHHhh
Confidence            36777787   888888889999874


No 177
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=36.98  E-value=32  Score=13.96  Aligned_cols=7  Identities=43%  Similarity=1.070  Sum_probs=3.4

Q ss_pred             eeccCCC
Q psy3483          43 YVCCLCS   49 (99)
Q Consensus        43 ~~c~~c~   49 (99)
                      +.|+.||
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            3455554


No 178
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=36.54  E-value=30  Score=22.89  Aligned_cols=14  Identities=29%  Similarity=0.750  Sum_probs=9.2

Q ss_pred             ceecCCCCccccCc
Q psy3483          71 PYKCFYCDYRSNER   84 (99)
Q Consensus        71 ~~~C~~c~~~f~~~   84 (99)
                      -|.|..|+..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            67777777665443


No 179
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=36.29  E-value=14  Score=22.86  Aligned_cols=13  Identities=23%  Similarity=0.230  Sum_probs=7.8

Q ss_pred             CCCceecCCCCcc
Q psy3483          68 KDRPYKCFYCDYR   80 (99)
Q Consensus        68 ~~~~~~C~~c~~~   80 (99)
                      +.+.+.|..|+.-
T Consensus       235 ~~rve~C~~C~~Y  247 (290)
T PF04216_consen  235 AYRVEVCESCGSY  247 (290)
T ss_dssp             SEEEEEETTTTEE
T ss_pred             cEEEEECCcccch
Confidence            3445677777643


No 180
>PF12773 DZR:  Double zinc ribbon
Probab=36.27  E-value=42  Score=14.40  Aligned_cols=8  Identities=25%  Similarity=0.480  Sum_probs=3.3

Q ss_pred             eecCCCCc
Q psy3483          72 YKCFYCDY   79 (99)
Q Consensus        72 ~~C~~c~~   79 (99)
                      ..|..|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            33444443


No 181
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=36.13  E-value=38  Score=17.33  Aligned_cols=26  Identities=27%  Similarity=0.522  Sum_probs=17.2

Q ss_pred             ceeeCcccccccccc--chhhhccchhh
Q psy3483           6 LIVTCMYCSKILTYE--TETIMNHCKFC   31 (99)
Q Consensus         6 ~~~~c~~c~~~f~~~--~~~~~~h~~~~   31 (99)
                      ..|.|..||....-.  -+...+||..|
T Consensus         3 ~~F~C~~CG~~V~p~~~g~~~RNHCP~C   30 (92)
T PF12647_consen    3 ESFTCVHCGLTVSPLAAGSAHRNHCPSC   30 (92)
T ss_pred             cccCccccCCCcccCCCCCCccCcCccc
Confidence            578999999875332  11466776666


No 182
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=35.25  E-value=67  Score=18.97  Aligned_cols=10  Identities=20%  Similarity=0.468  Sum_probs=4.7

Q ss_pred             eecCCCCccc
Q psy3483          72 YKCFYCDYRS   81 (99)
Q Consensus        72 ~~C~~c~~~f   81 (99)
                      +.|..||..+
T Consensus        31 vrC~eCG~V~   40 (201)
T COG1326          31 VRCEECGTVH   40 (201)
T ss_pred             EEccCCCcEe
Confidence            4455554433


No 183
>PRK06260 threonine synthase; Validated
Probab=33.81  E-value=40  Score=21.88  Aligned_cols=9  Identities=33%  Similarity=0.807  Sum_probs=5.9

Q ss_pred             ceeccCCCc
Q psy3483          42 RYVCCLCSK   50 (99)
Q Consensus        42 ~~~c~~c~~   50 (99)
                      .+.|+.|+.
T Consensus        19 ~~~Cp~cg~   27 (397)
T PRK06260         19 IYTCPECGG   27 (397)
T ss_pred             cccCCCCCC
Confidence            356777765


No 184
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=33.64  E-value=62  Score=20.37  Aligned_cols=25  Identities=20%  Similarity=0.517  Sum_probs=18.6

Q ss_pred             CCceecCCCCccccCchHHHHHHHH
Q psy3483          69 DRPYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      ..-|.|..|.+-|.....+.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            4567888888888888888887663


No 185
>KOG3362|consensus
Probab=33.45  E-value=14  Score=20.56  Aligned_cols=20  Identities=25%  Similarity=0.541  Sum_probs=14.1

Q ss_pred             eecCCCCccccCchHHHHHH
Q psy3483          72 YKCFYCDYRSNERSNVKAHM   91 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~   91 (99)
                      |.|..||-.+....-+..|.
T Consensus       130 ysC~~CG~kyCsv~C~~~Hn  149 (156)
T KOG3362|consen  130 YSCVNCGTKYCSVRCLKTHN  149 (156)
T ss_pred             hHHHhcCCceeechhhhhcc
Confidence            77778887777766666654


No 186
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=33.29  E-value=23  Score=15.57  Aligned_cols=11  Identities=36%  Similarity=1.017  Sum_probs=6.4

Q ss_pred             eecCCCCcccc
Q psy3483          72 YKCFYCDYRSN   82 (99)
Q Consensus        72 ~~C~~c~~~f~   82 (99)
                      |+|..|+..+.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            56666665543


No 187
>KOG0717|consensus
Probab=32.98  E-value=31  Score=23.21  Aligned_cols=21  Identities=19%  Similarity=0.400  Sum_probs=17.4

Q ss_pred             eecCCCCccccCchHHHHHHH
Q psy3483          72 YKCFYCDYRSNERSNVKAHMI   92 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~   92 (99)
                      +.|..|++.|.....+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            788889999988888888764


No 188
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=32.95  E-value=28  Score=15.67  Aligned_cols=16  Identities=31%  Similarity=0.847  Sum_probs=9.6

Q ss_pred             CCceeeCccccccccc
Q psy3483           4 TELIVTCMYCSKILTY   19 (99)
Q Consensus         4 ~~~~~~c~~c~~~f~~   19 (99)
                      +...+.|.+|++.+..
T Consensus        32 ~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   32 EPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTCEEEETTT--EEEH
T ss_pred             CCCEEEeeCCCCEecc
Confidence            3445788999887754


No 189
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=32.73  E-value=47  Score=18.73  Aligned_cols=50  Identities=22%  Similarity=0.363  Sum_probs=19.5

Q ss_pred             CCCCceeeCccccccccccc-----hhhhccchhh--cc----CCCCCCCcceeccCCCcc
Q psy3483           2 KSTELIVTCMYCSKILTYET-----ETIMNHCKFC--KA----VSRPTKYQRYVCCLCSKY   51 (99)
Q Consensus         2 h~~~~~~~c~~c~~~f~~~~-----~~~~~h~~~~--~~----~~~~~~~~~~~c~~c~~~   51 (99)
                      |.++--.+|..|++.|-...     +++..|...-  ..    -....++...+|-.||..
T Consensus         9 ~~p~~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~~   69 (152)
T PF09416_consen    9 HDPSCVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGSR   69 (152)
T ss_dssp             --CCCEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT---
T ss_pred             CCcccEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCCC
Confidence            44455577889999884432     1344442111  11    122334556788888853


No 190
>PRK05978 hypothetical protein; Provisional
Probab=32.66  E-value=28  Score=19.45  Aligned_cols=8  Identities=25%  Similarity=0.638  Sum_probs=5.1

Q ss_pred             eCcccccc
Q psy3483           9 TCMYCSKI   16 (99)
Q Consensus         9 ~c~~c~~~   16 (99)
                      +|+.||+.
T Consensus        35 rCP~CG~G   42 (148)
T PRK05978         35 RCPACGEG   42 (148)
T ss_pred             cCCCCCCC
Confidence            56777765


No 191
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=32.45  E-value=25  Score=19.34  Aligned_cols=21  Identities=24%  Similarity=0.302  Sum_probs=14.8

Q ss_pred             CCceecCCCCccccCchHHHH
Q psy3483          69 DRPYKCFYCDYRSNERSNVKA   89 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~   89 (99)
                      +.-+.|+.|++.|=.-+.+..
T Consensus       122 ~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  122 DEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CeEEECCCCCCEecccccHHH
Confidence            446899999998865554443


No 192
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=32.36  E-value=22  Score=15.85  Aligned_cols=11  Identities=36%  Similarity=1.026  Sum_probs=7.2

Q ss_pred             eecCCCCcccc
Q psy3483          72 YKCFYCDYRSN   82 (99)
Q Consensus        72 ~~C~~c~~~f~   82 (99)
                      |+|..||..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56777776654


No 193
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=31.50  E-value=20  Score=16.51  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=9.3

Q ss_pred             CCceecCCCCccccCc
Q psy3483          69 DRPYKCFYCDYRSNER   84 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~   84 (99)
                      ...|.|..|+..+.-+
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            4467777777665543


No 194
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=31.38  E-value=59  Score=14.54  Aligned_cols=16  Identities=19%  Similarity=0.227  Sum_probs=11.8

Q ss_pred             hhCCCCceecCCCCcc
Q psy3483          65 THTKDRPYKCFYCDYR   80 (99)
Q Consensus        65 ~~~~~~~~~C~~c~~~   80 (99)
                      ...++....|+.|++.
T Consensus        40 i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   40 IRKGDEIVFCPNCGRI   55 (56)
T ss_pred             HHcCCCeEECcCCCcc
Confidence            3445778899999874


No 195
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=31.36  E-value=84  Score=20.01  Aligned_cols=10  Identities=20%  Similarity=0.547  Sum_probs=7.3

Q ss_pred             eeeCcccccc
Q psy3483           7 IVTCMYCSKI   16 (99)
Q Consensus         7 ~~~c~~c~~~   16 (99)
                      .-.|+.||..
T Consensus       187 ~~~CPvCGs~  196 (309)
T PRK03564        187 RQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCc
Confidence            3568888875


No 196
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=30.92  E-value=74  Score=20.01  Aligned_cols=12  Identities=25%  Similarity=0.437  Sum_probs=7.3

Q ss_pred             eeccCCCccccc
Q psy3483          43 YVCCLCSKYRHS   54 (99)
Q Consensus        43 ~~c~~c~~~~~~   54 (99)
                      +.|+.|+..+.-
T Consensus        47 ~vc~~c~~h~rl   58 (292)
T PRK05654         47 NVCPKCGHHMRI   58 (292)
T ss_pred             CCCCCCCCCeeC
Confidence            457777765443


No 197
>KOG4727|consensus
Probab=30.90  E-value=31  Score=19.86  Aligned_cols=22  Identities=27%  Similarity=0.477  Sum_probs=18.1

Q ss_pred             ceecCCCCccccCchHHHHHHH
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMI   92 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~   92 (99)
                      -|.|.+|+-.+...-++..|+-
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            3899999998888888887753


No 198
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.83  E-value=16  Score=16.22  Aligned_cols=13  Identities=15%  Similarity=0.700  Sum_probs=9.8

Q ss_pred             eCccccccccccc
Q psy3483           9 TCMYCSKILTYET   21 (99)
Q Consensus         9 ~c~~c~~~f~~~~   21 (99)
                      .|+.|++.|....
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            4899999886553


No 199
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=30.18  E-value=30  Score=21.55  Aligned_cols=12  Identities=25%  Similarity=0.694  Sum_probs=7.8

Q ss_pred             eCcccccccccc
Q psy3483           9 TCMYCSKILTYE   20 (99)
Q Consensus         9 ~c~~c~~~f~~~   20 (99)
                      +|+.|+.....+
T Consensus        28 ~c~~c~~~~~~~   39 (285)
T TIGR00515        28 KCPKCGQVLYTK   39 (285)
T ss_pred             ECCCCcchhhHH
Confidence            477777765544


No 200
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=29.81  E-value=42  Score=17.36  Aligned_cols=39  Identities=13%  Similarity=0.159  Sum_probs=13.7

Q ss_pred             CCceeeCccccccccccchhhhccchhhccCCCCCCCc-ceeccCCCcccccC
Q psy3483           4 TELIVTCMYCSKILTYETETIMNHCKFCKAVSRPTKYQ-RYVCCLCSKYRHSD   55 (99)
Q Consensus         4 ~~~~~~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~-~~~c~~c~~~~~~~   55 (99)
                      |.+.-.|..||+++-...    .        .. .+++ .|-|+.|.+.|...
T Consensus        11 g~ke~~CalCG~tWg~~y----~--------Ev-~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDYY----E--------EV-DGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             -SGGGS-SS---S---SS-------------B--TT--BSSS--SSSS-TTS-
T ss_pred             ccccccccccCCcHHHHH----H--------hh-cCCEEEEEcHHHHHHHHHH
Confidence            455667999998875222    1        12 2333 35678888766554


No 201
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=29.55  E-value=28  Score=14.40  Aligned_cols=10  Identities=40%  Similarity=0.680  Sum_probs=3.8

Q ss_pred             ceecCCCCcc
Q psy3483          71 PYKCFYCDYR   80 (99)
Q Consensus        71 ~~~C~~c~~~   80 (99)
                      .|.|..||..
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            3566666543


No 202
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=29.52  E-value=51  Score=13.30  Aligned_cols=20  Identities=20%  Similarity=0.439  Sum_probs=9.1

Q ss_pred             eeccCCCcccccChhHHHHHHH
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIR   64 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~   64 (99)
                      +.|+.|++... . .-+..|..
T Consensus         5 ~~C~nC~R~v~-a-~RfA~HLe   24 (33)
T PF08209_consen    5 VECPNCGRPVA-A-SRFAPHLE   24 (33)
T ss_dssp             EE-TTTSSEEE-G-GGHHHHHH
T ss_pred             EECCCCcCCcc-h-hhhHHHHH
Confidence            45666666322 2 44454543


No 203
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=28.87  E-value=53  Score=17.40  Aligned_cols=12  Identities=50%  Similarity=0.993  Sum_probs=8.5

Q ss_pred             ceecCCCCcccc
Q psy3483          71 PYKCFYCDYRSN   82 (99)
Q Consensus        71 ~~~C~~c~~~f~   82 (99)
                      -|.|..||..+.
T Consensus       100 Fy~C~~Cg~~wr  111 (113)
T COG1594         100 FYKCTRCGYRWR  111 (113)
T ss_pred             EEEecccCCEee
Confidence            378888887653


No 204
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=28.76  E-value=66  Score=14.27  Aligned_cols=20  Identities=25%  Similarity=0.665  Sum_probs=10.3

Q ss_pred             hHHHHHHHhhCCCCceecCC
Q psy3483          57 SKMRSHIRTHTKDRPYKCFY   76 (99)
Q Consensus        57 ~~~~~h~~~~~~~~~~~C~~   76 (99)
                      ..+..|....-..++..|..
T Consensus        24 ~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   24 KELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHccCCCCcEECCC
Confidence            45566655444445555655


No 205
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=28.62  E-value=31  Score=15.22  Aligned_cols=8  Identities=38%  Similarity=1.078  Sum_probs=3.6

Q ss_pred             eecCCCCc
Q psy3483          72 YKCFYCDY   79 (99)
Q Consensus        72 ~~C~~c~~   79 (99)
                      |.|+.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            99998874


No 206
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=28.42  E-value=19  Score=21.38  Aligned_cols=30  Identities=20%  Similarity=0.387  Sum_probs=0.0

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCcee
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYK   73 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~   73 (99)
                      ...|++||.... . ..+..|+++...+..|+
T Consensus       168 ~~~cPitGe~IP-~-~e~~eHmRi~LlDP~wk  197 (229)
T PF12230_consen  168 MIICPITGEMIP-A-DEMDEHMRIELLDPRWK  197 (229)
T ss_dssp             --------------------------------
T ss_pred             cccccccccccc-c-ccccccccccccccccc
Confidence            367888887433 3 67888888776665553


No 207
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=28.40  E-value=47  Score=24.28  Aligned_cols=6  Identities=33%  Similarity=0.944  Sum_probs=2.5

Q ss_pred             ccCCCc
Q psy3483          45 CCLCSK   50 (99)
Q Consensus        45 c~~c~~   50 (99)
                      |..||.
T Consensus       484 CRkCGr  489 (1374)
T PTZ00303        484 CRSCGI  489 (1374)
T ss_pred             ccCCcc
Confidence            444443


No 208
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=28.39  E-value=33  Score=14.21  Aligned_cols=14  Identities=21%  Similarity=0.214  Sum_probs=7.8

Q ss_pred             ecCCCCccccCchH
Q psy3483          73 KCFYCDYRSNERSN   86 (99)
Q Consensus        73 ~C~~c~~~f~~~~~   86 (99)
                      .|+.|++.|.-.++
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            57788887654443


No 209
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=28.25  E-value=89  Score=19.77  Aligned_cols=11  Identities=18%  Similarity=0.443  Sum_probs=6.9

Q ss_pred             eeccCCCcccc
Q psy3483          43 YVCCLCSKYRH   53 (99)
Q Consensus        43 ~~c~~c~~~~~   53 (99)
                      +.|+.|+.-+.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            45777776444


No 210
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.11  E-value=27  Score=21.19  Aligned_cols=17  Identities=18%  Similarity=0.460  Sum_probs=14.1

Q ss_pred             CceeeCccccccccccc
Q psy3483           5 ELIVTCMYCSKILTYET   21 (99)
Q Consensus         5 ~~~~~c~~c~~~f~~~~   21 (99)
                      ++...||+|+..|..+.
T Consensus        17 kk~ieCPvC~tkFkkee   33 (267)
T COG1655          17 KKTIECPVCNTKFKKEE   33 (267)
T ss_pred             hceeccCcccchhhhhh
Confidence            45688999999998775


No 211
>KOG1842|consensus
Probab=27.58  E-value=34  Score=22.92  Aligned_cols=21  Identities=19%  Similarity=0.352  Sum_probs=11.9

Q ss_pred             eecCCCCccccCchHHHHHHH
Q psy3483          72 YKCFYCDYRSNERSNVKAHMI   92 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~~   92 (99)
                      |.|+.|...|.+...|..|..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHh
Confidence            555555555555555555543


No 212
>KOG2071|consensus
Probab=26.89  E-value=75  Score=22.13  Aligned_cols=29  Identities=28%  Similarity=0.483  Sum_probs=22.4

Q ss_pred             CCCCceecCCCCccccCchHHHHHHHHhc
Q psy3483          67 TKDRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      ....|-+|..||..|-.......|+..|-
T Consensus       414 y~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  414 YKDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             ccCCcchhcccccccccchhhhhHhhhhh
Confidence            45667899999999988877777766653


No 213
>KOG0227|consensus
Probab=26.56  E-value=39  Score=19.90  Aligned_cols=20  Identities=30%  Similarity=0.524  Sum_probs=13.8

Q ss_pred             eecCCCCccccCchHHHHHH
Q psy3483          72 YKCFYCDYRSNERSNVKAHM   91 (99)
Q Consensus        72 ~~C~~c~~~f~~~~~l~~H~   91 (99)
                      |.|..|.-...+..++..|.
T Consensus        54 yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   54 YECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             eeehhhhhhhcchhhhhhhh
Confidence            77777777666666666664


No 214
>PTZ00448 hypothetical protein; Provisional
Probab=26.26  E-value=55  Score=21.38  Aligned_cols=24  Identities=17%  Similarity=0.314  Sum_probs=19.4

Q ss_pred             ceecCCCCccccCchHHHHHHHHh
Q psy3483          71 PYKCFYCDYRSNERSNVKAHMIRR   94 (99)
Q Consensus        71 ~~~C~~c~~~f~~~~~l~~H~~~~   94 (99)
                      .|.|..|+..|........|.++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            578999999998777888887653


No 215
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=26.18  E-value=39  Score=13.55  Aligned_cols=10  Identities=20%  Similarity=0.663  Sum_probs=5.0

Q ss_pred             eecCCCCccc
Q psy3483          72 YKCFYCDYRS   81 (99)
Q Consensus        72 ~~C~~c~~~f   81 (99)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            4455555443


No 216
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=26.08  E-value=32  Score=13.54  Aligned_cols=7  Identities=43%  Similarity=0.994  Sum_probs=2.9

Q ss_pred             eeccCCC
Q psy3483          43 YVCCLCS   49 (99)
Q Consensus        43 ~~c~~c~   49 (99)
                      +.|++|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            3344443


No 217
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=25.91  E-value=41  Score=14.00  Aligned_cols=12  Identities=17%  Similarity=0.490  Sum_probs=6.0

Q ss_pred             CceeeCcccccc
Q psy3483           5 ELIVTCMYCSKI   16 (99)
Q Consensus         5 ~~~~~c~~c~~~   16 (99)
                      .+.|.|+.|+..
T Consensus        22 ~~~w~C~~C~~~   33 (40)
T PF04810_consen   22 GKTWICNFCGTK   33 (40)
T ss_dssp             TTEEEETTT--E
T ss_pred             CCEEECcCCCCc
Confidence            345667776654


No 218
>PRK04351 hypothetical protein; Provisional
Probab=25.87  E-value=65  Score=18.02  Aligned_cols=33  Identities=21%  Similarity=0.465  Sum_probs=20.8

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccccC
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f~~   83 (99)
                      .|.|..|+..+... .      +.  ....|.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r~-R------r~--n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-R------RI--NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-e------ec--CCCcEEeCCCCcEeee
Confidence            48898899754432 1      11  2356999999865543


No 219
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=25.67  E-value=61  Score=16.52  Aligned_cols=36  Identities=25%  Similarity=0.416  Sum_probs=18.1

Q ss_pred             eeccCCCcccccChhHHHHHHHhh--CCCCceecCCCCccc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTH--TKDRPYKCFYCDYRS   81 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~--~~~~~~~C~~c~~~f   81 (99)
                      ..|+.||..-... ..+  ..++.  .-..-|.|..|+..+
T Consensus        63 ~~Cp~Cg~~~a~f-~~~--Q~RsadE~~T~fy~C~~C~~~w  100 (104)
T TIGR01384        63 VECPKCGHKEAYY-WLL--QTRRADEPETRFYKCTKCGYVW  100 (104)
T ss_pred             CCCCCCCCCeeEE-EEe--ccCCCCCCcEEEEEeCCCCCee
Confidence            5788888632111 111  12221  122348888888654


No 220
>KOG2907|consensus
Probab=25.61  E-value=41  Score=17.95  Aligned_cols=37  Identities=19%  Similarity=0.364  Sum_probs=19.9

Q ss_pred             eeccCCCcccccChhHHHHHHH-h-hCCC-CceecCCCCccccC
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIR-T-HTKD-RPYKCFYCDYRSNE   83 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~-~-~~~~-~~~~C~~c~~~f~~   83 (99)
                      ..|+.||.. .   ......|. + ..|+ .-|-|+.|+..|..
T Consensus        75 ~kCpkCghe-~---m~Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHE-E---MSYHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCc-h---hhhhhhhcccccCCceEEEEcCccceeeec
Confidence            568888863 1   11222222 1 2222 23889999987754


No 221
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.21  E-value=69  Score=20.02  Aligned_cols=10  Identities=20%  Similarity=0.418  Sum_probs=4.6

Q ss_pred             eecCCCCccc
Q psy3483          72 YKCFYCDYRS   81 (99)
Q Consensus        72 ~~C~~c~~~f   81 (99)
                      |.|+.|.-.|
T Consensus       256 yvCs~Clsi~  265 (279)
T TIGR00627       256 FVCSVCLSVL  265 (279)
T ss_pred             EECCCccCCc
Confidence            4444444433


No 222
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=24.78  E-value=33  Score=14.45  Aligned_cols=10  Identities=20%  Similarity=0.391  Sum_probs=6.7

Q ss_pred             eeeCcccccc
Q psy3483           7 IVTCMYCSKI   16 (99)
Q Consensus         7 ~~~c~~c~~~   16 (99)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            4567888854


No 223
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=24.27  E-value=68  Score=17.58  Aligned_cols=32  Identities=22%  Similarity=0.403  Sum_probs=17.8

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccc
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRS   81 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f   81 (99)
                      .|.|..|+..+...       .+ +.....|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~~~-------rr-~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLRV-------RR-SNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCceE-------cc-ccCcceEEcCCCCCEE
Confidence            57887787643322       11 1112458888887654


No 224
>KOG1088|consensus
Probab=24.11  E-value=50  Score=17.77  Aligned_cols=12  Identities=17%  Similarity=0.124  Sum_probs=5.4

Q ss_pred             eeccCCCccccc
Q psy3483          43 YVCCLCSKYRHS   54 (99)
Q Consensus        43 ~~c~~c~~~~~~   54 (99)
                      ..|+.||..|..
T Consensus        99 l~CpetG~vfpI  110 (124)
T KOG1088|consen   99 LVCPETGRVFPI  110 (124)
T ss_pred             EecCCCCcEeec
Confidence            345555544433


No 225
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=24.07  E-value=1e+02  Score=18.98  Aligned_cols=16  Identities=25%  Similarity=0.698  Sum_probs=10.7

Q ss_pred             CCceecCCCCccccCc
Q psy3483          69 DRPYKCFYCDYRSNER   84 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~   84 (99)
                      .+.|.|+.||..+...
T Consensus       320 ~r~~~C~~cg~~~~rD  335 (364)
T COG0675         320 GRLFKCPRCGFVHDRD  335 (364)
T ss_pred             ceeEECCCCCCeehhh
Confidence            4568888888655443


No 226
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=24.06  E-value=70  Score=20.85  Aligned_cols=75  Identities=19%  Similarity=0.514  Sum_probs=35.7

Q ss_pred             eCccccccccccchhhhccchhhccCCCCCCCcceeccCCCc---ccccChhHHHHHHHhhCCCCceecCC--C--C--c
Q psy3483           9 TCMYCSKILTYETETIMNHCKFCKAVSRPTKYQRYVCCLCSK---YRHSDASKMRSHIRTHTKDRPYKCFY--C--D--Y   79 (99)
Q Consensus         9 ~c~~c~~~f~~~~~~~~~h~~~~~~~~~~~~~~~~~c~~c~~---~~~~~~~~~~~h~~~~~~~~~~~C~~--c--~--~   79 (99)
                      .|..|...|..-. .|..||+.     .|  ++-+.|+.-+.   .++-.+..|-    .|.....|.|..  |  +  .
T Consensus       222 ~C~FC~~~FYdDD-EL~~HcR~-----~H--E~ChICD~v~p~~~QYFK~Y~~Le----~HF~~~hy~ct~qtc~~~k~~  289 (493)
T COG5236         222 LCIFCKIYFYDDD-ELRRHCRL-----RH--EACHICDMVGPIRYQYFKSYEDLE----AHFRNAHYCCTFQTCRVGKCY  289 (493)
T ss_pred             hhhhccceecChH-HHHHHHHh-----hh--hhhhhhhccCccchhhhhCHHHHH----HHhhcCceEEEEEEEecCcEE
Confidence            3667776666665 66666322     12  22233433321   0111112222    333344466643  2  1  2


Q ss_pred             cccCchHHHHHHHHhc
Q psy3483          80 RSNERSNVKAHMIRRH   95 (99)
Q Consensus        80 ~f~~~~~l~~H~~~~~   95 (99)
                      .|.....|..|+-.-+
T Consensus       290 vf~~~~el~~h~~~~h  305 (493)
T COG5236         290 VFPYHTELLEHLTRFH  305 (493)
T ss_pred             EeccHHHHHHHHHHHh
Confidence            5777778888865444


No 227
>PRK12722 transcriptional activator FlhC; Provisional
Probab=24.05  E-value=71  Score=18.72  Aligned_cols=28  Identities=18%  Similarity=0.383  Sum_probs=16.5

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCCc
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDY   79 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~   79 (99)
                      ..|..||..|...         .+.....|.|+.|..
T Consensus       135 ~~C~~Cgg~fv~~---------~~e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTH---------AHDPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecc---------ccccCCCCcCCCCCC
Confidence            3577777655433         123344688888864


No 228
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=24.02  E-value=50  Score=15.15  Aligned_cols=15  Identities=13%  Similarity=0.443  Sum_probs=10.9

Q ss_pred             CCCCceecCCCCccc
Q psy3483          67 TKDRPYKCFYCDYRS   81 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f   81 (99)
                      .+...|.|+.||-.+
T Consensus        10 ~~~v~~~Cp~cGipt   24 (55)
T PF13824_consen   10 PAHVNFECPDCGIPT   24 (55)
T ss_pred             ccccCCcCCCCCCcC
Confidence            446679999998643


No 229
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=23.81  E-value=47  Score=19.00  Aligned_cols=9  Identities=44%  Similarity=0.980  Sum_probs=4.7

Q ss_pred             eeccCCCcc
Q psy3483          43 YVCCLCSKY   51 (99)
Q Consensus        43 ~~c~~c~~~   51 (99)
                      +.|+.||+.
T Consensus       131 ~~C~~Cgki  139 (165)
T COG1656         131 YRCPKCGKI  139 (165)
T ss_pred             eECCCCccc
Confidence            345566553


No 230
>KOG1813|consensus
Probab=23.72  E-value=78  Score=20.08  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=9.1

Q ss_pred             ceeeCccccccccc
Q psy3483           6 LIVTCMYCSKILTY   19 (99)
Q Consensus         6 ~~~~c~~c~~~f~~   19 (99)
                      -||.|..|.+.|..
T Consensus       240 ~Pf~c~icr~~f~~  253 (313)
T KOG1813|consen  240 LPFKCFICRKYFYR  253 (313)
T ss_pred             CCcccccccccccc
Confidence            46677777776653


No 231
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=23.59  E-value=69  Score=21.56  Aligned_cols=25  Identities=20%  Similarity=0.498  Sum_probs=21.3

Q ss_pred             CCceecCCCCccccCchHHHHHHHH
Q psy3483          69 DRPYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      ..-|.|..|.+-|.....|..|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            4468999999999999999999874


No 232
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=23.46  E-value=31  Score=19.02  Aligned_cols=16  Identities=19%  Similarity=0.463  Sum_probs=12.4

Q ss_pred             CCceecCCCCccccCc
Q psy3483          69 DRPYKCFYCDYRSNER   84 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~   84 (99)
                      .++..|.+||..|...
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            4589999999887643


No 233
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=23.44  E-value=24  Score=25.00  Aligned_cols=12  Identities=25%  Similarity=0.517  Sum_probs=7.8

Q ss_pred             Cccccccccccc
Q psy3483          10 CMYCSKILTYET   21 (99)
Q Consensus        10 c~~c~~~f~~~~   21 (99)
                      |..||-.|.-..
T Consensus        93 Ct~CGPr~~i~~  104 (711)
T TIGR00143        93 CTHCGPRFTIIE  104 (711)
T ss_pred             ccCCCCCeEEee
Confidence            677777765444


No 234
>KOG1994|consensus
Probab=22.83  E-value=45  Score=20.22  Aligned_cols=24  Identities=21%  Similarity=0.753  Sum_probs=19.9

Q ss_pred             CCCCceecCCCCccccCchHHHHH
Q psy3483          67 TKDRPYKCFYCDYRSNERSNVKAH   90 (99)
Q Consensus        67 ~~~~~~~C~~c~~~f~~~~~l~~H   90 (99)
                      ...-.|.|..||-.|.....|..|
T Consensus       235 LR~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  235 LRSEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             HhccceEEEEeccccCCHHHHHHh
Confidence            345569999999999999888876


No 235
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=22.72  E-value=34  Score=15.68  Aligned_cols=10  Identities=20%  Similarity=0.537  Sum_probs=2.6

Q ss_pred             eeeCcccccc
Q psy3483           7 IVTCMYCSKI   16 (99)
Q Consensus         7 ~~~c~~c~~~   16 (99)
                      .+.|+.||.+
T Consensus        33 ~y~Cp~CgAt   42 (55)
T PF05741_consen   33 KYVCPICGAT   42 (55)
T ss_dssp             G---TTT---
T ss_pred             cCcCCCCcCc
Confidence            3667777765


No 236
>KOG0320|consensus
Probab=22.54  E-value=13  Score=21.46  Aligned_cols=10  Identities=30%  Similarity=0.587  Sum_probs=5.6

Q ss_pred             eecCCCCccc
Q psy3483          72 YKCFYCDYRS   81 (99)
Q Consensus        72 ~~C~~c~~~f   81 (99)
                      ..|+.|.+..
T Consensus       168 ~~CP~C~kkI  177 (187)
T KOG0320|consen  168 NKCPTCRKKI  177 (187)
T ss_pred             CCCCCccccc
Confidence            5566666533


No 237
>PRK00420 hypothetical protein; Validated
Probab=22.36  E-value=76  Score=16.90  Aligned_cols=7  Identities=43%  Similarity=0.757  Sum_probs=4.0

Q ss_pred             eccCCCc
Q psy3483          44 VCCLCSK   50 (99)
Q Consensus        44 ~c~~c~~   50 (99)
                      .|+.||.
T Consensus        42 ~Cp~Cg~   48 (112)
T PRK00420         42 VCPVHGK   48 (112)
T ss_pred             ECCCCCC
Confidence            3666665


No 238
>PTZ00064 histone acetyltransferase; Provisional
Probab=22.34  E-value=89  Score=21.51  Aligned_cols=25  Identities=24%  Similarity=0.238  Sum_probs=21.4

Q ss_pred             CCceecCCCCccccCchHHHHHHHH
Q psy3483          69 DRPYKCFYCDYRSNERSNVKAHMIR   93 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~H~~~   93 (99)
                      ..-|.|..|.+-|.....|.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            4458999999999999999999874


No 239
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=22.31  E-value=1e+02  Score=18.89  Aligned_cols=13  Identities=38%  Similarity=0.621  Sum_probs=10.9

Q ss_pred             CCCceecCCCCcc
Q psy3483          68 KDRPYKCFYCDYR   80 (99)
Q Consensus        68 ~~~~~~C~~c~~~   80 (99)
                      +.....|+.||+.
T Consensus       218 ~d~iv~CP~CgRI  230 (239)
T COG1579         218 KDEIVFCPYCGRI  230 (239)
T ss_pred             CCCCccCCccchH
Confidence            6778889999975


No 240
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=21.99  E-value=54  Score=15.79  Aligned_cols=10  Identities=30%  Similarity=0.820  Sum_probs=4.0

Q ss_pred             eeCcccccccc
Q psy3483           8 VTCMYCSKILT   18 (99)
Q Consensus         8 ~~c~~c~~~f~   18 (99)
                      |.| .||+...
T Consensus         4 frC-~Cgr~ly   13 (68)
T PF09082_consen    4 FRC-DCGRYLY   13 (68)
T ss_dssp             EEE-TTS--EE
T ss_pred             EEe-cCCCEEE
Confidence            455 4665533


No 241
>KOG2272|consensus
Probab=21.98  E-value=1.4e+02  Score=18.57  Aligned_cols=19  Identities=16%  Similarity=0.260  Sum_probs=11.4

Q ss_pred             hhCCCCceecCCCCccccC
Q psy3483          65 THTKDRPYKCFYCDYRSNE   83 (99)
Q Consensus        65 ~~~~~~~~~C~~c~~~f~~   83 (99)
                      .|.-...|.|..|.+-|.-
T Consensus       215 KhWHveHFvCa~CekPFlG  233 (332)
T KOG2272|consen  215 KHWHVEHFVCAKCEKPFLG  233 (332)
T ss_pred             cccchhheeehhcCCcccc
Confidence            3444456777777766643


No 242
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=21.90  E-value=47  Score=14.99  Aligned_cols=10  Identities=20%  Similarity=0.886  Sum_probs=6.5

Q ss_pred             eeeCcccccc
Q psy3483           7 IVTCMYCSKI   16 (99)
Q Consensus         7 ~~~c~~c~~~   16 (99)
                      ..+|+.||..
T Consensus         3 LkPCPFCG~~   12 (61)
T PF14354_consen    3 LKPCPFCGSA   12 (61)
T ss_pred             CcCCCCCCCc
Confidence            3468888755


No 243
>PRK01343 zinc-binding protein; Provisional
Probab=21.87  E-value=43  Score=15.47  Aligned_cols=12  Identities=33%  Similarity=0.467  Sum_probs=8.8

Q ss_pred             eeeCcccccccc
Q psy3483           7 IVTCMYCSKILT   18 (99)
Q Consensus         7 ~~~c~~c~~~f~   18 (99)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            356999998754


No 244
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=21.83  E-value=52  Score=20.32  Aligned_cols=7  Identities=43%  Similarity=1.113  Sum_probs=3.6

Q ss_pred             eecCCCC
Q psy3483          72 YKCFYCD   78 (99)
Q Consensus        72 ~~C~~c~   78 (99)
                      |+|..|-
T Consensus       242 FKCD~CR  248 (258)
T PF10071_consen  242 FKCDPCR  248 (258)
T ss_pred             ccCCcce
Confidence            5555553


No 245
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=21.82  E-value=53  Score=14.59  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=8.7

Q ss_pred             eeCccccccccc
Q psy3483           8 VTCMYCSKILTY   19 (99)
Q Consensus         8 ~~c~~c~~~f~~   19 (99)
                      +.|+.||..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            778888776654


No 246
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=21.77  E-value=52  Score=17.54  Aligned_cols=13  Identities=31%  Similarity=0.588  Sum_probs=8.9

Q ss_pred             ceeeCcccccccc
Q psy3483           6 LIVTCMYCSKILT   18 (99)
Q Consensus         6 ~~~~c~~c~~~f~   18 (99)
                      ....||.|++..+
T Consensus        68 v~V~CP~C~K~TK   80 (114)
T PF11023_consen   68 VQVECPNCGKQTK   80 (114)
T ss_pred             eeeECCCCCChHh
Confidence            4566888887754


No 247
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=21.68  E-value=32  Score=12.73  Aligned_cols=6  Identities=33%  Similarity=1.065  Sum_probs=3.0

Q ss_pred             Cccccc
Q psy3483          10 CMYCSK   15 (99)
Q Consensus        10 c~~c~~   15 (99)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            555554


No 248
>PRK07591 threonine synthase; Validated
Probab=21.45  E-value=86  Score=20.69  Aligned_cols=8  Identities=38%  Similarity=0.604  Sum_probs=4.1

Q ss_pred             eeccCCCc
Q psy3483          43 YVCCLCSK   50 (99)
Q Consensus        43 ~~c~~c~~   50 (99)
                      +.|+.|+.
T Consensus        34 ~~C~~cg~   41 (421)
T PRK07591         34 HVCEECFG   41 (421)
T ss_pred             ccCCCCCC
Confidence            44555553


No 249
>PRK12860 transcriptional activator FlhC; Provisional
Probab=21.28  E-value=80  Score=18.54  Aligned_cols=27  Identities=22%  Similarity=0.593  Sum_probs=16.0

Q ss_pred             eeccCCCcccccChhHHHHHHHhhCCCCceecCCCC
Q psy3483          43 YVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCD   78 (99)
Q Consensus        43 ~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~   78 (99)
                      ..|..||..|...         .+.....|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~---------~~e~~~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTH---------AHDLRHNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeecc---------ccccCCCCcCCCCC
Confidence            4577777654432         22334468888885


No 250
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=21.16  E-value=44  Score=13.86  Aligned_cols=11  Identities=36%  Similarity=0.788  Sum_probs=4.3

Q ss_pred             Ccccccccccc
Q psy3483          10 CMYCSKILTYE   20 (99)
Q Consensus        10 c~~c~~~f~~~   20 (99)
                      |..|++.+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            67888887655


No 251
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=21.13  E-value=73  Score=20.43  Aligned_cols=27  Identities=19%  Similarity=0.298  Sum_probs=22.4

Q ss_pred             CCceecCCCCccccCchHHHHHHHHhc
Q psy3483          69 DRPYKCFYCDYRSNERSNVKAHMIRRH   95 (99)
Q Consensus        69 ~~~~~C~~c~~~f~~~~~l~~H~~~~~   95 (99)
                      ...|.|..|...|...-+..+|...|.
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHhh
Confidence            446999999999999989989987763


No 252
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=21.13  E-value=48  Score=15.22  Aligned_cols=6  Identities=33%  Similarity=1.242  Sum_probs=3.1

Q ss_pred             ccCCCc
Q psy3483          45 CCLCSK   50 (99)
Q Consensus        45 c~~c~~   50 (99)
                      |+.|+.
T Consensus        42 CPfC~~   47 (55)
T PF14447_consen   42 CPFCGT   47 (55)
T ss_pred             CCCCCC
Confidence            555554


No 253
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=20.83  E-value=53  Score=15.16  Aligned_cols=12  Identities=33%  Similarity=0.838  Sum_probs=5.1

Q ss_pred             eeCccccccccc
Q psy3483           8 VTCMYCSKILTY   19 (99)
Q Consensus         8 ~~c~~c~~~f~~   19 (99)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            467777776543


No 254
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=20.79  E-value=1.1e+02  Score=13.96  Aligned_cols=31  Identities=10%  Similarity=0.156  Sum_probs=13.3

Q ss_pred             cceeccCCCcccccChhHHHHHHHhhCCCCceecCC
Q psy3483          41 QRYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFY   76 (99)
Q Consensus        41 ~~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~   76 (99)
                      .|.....|+..|. . ..+..+.   .......|+.
T Consensus        23 ~PV~s~~C~H~fe-k-~aI~~~i---~~~~~~~CPv   53 (57)
T PF11789_consen   23 DPVKSKKCGHTFE-K-EAILQYI---QRNGSKRCPV   53 (57)
T ss_dssp             SEEEESSS--EEE-H-HHHHHHC---TTTS-EE-SC
T ss_pred             CCcCcCCCCCeec-H-HHHHHHH---HhcCCCCCCC
Confidence            4455566776443 2 4444443   2344566665


No 255
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=20.72  E-value=59  Score=14.03  Aligned_cols=7  Identities=29%  Similarity=0.799  Sum_probs=3.8

Q ss_pred             Ccccccc
Q psy3483          10 CMYCSKI   16 (99)
Q Consensus        10 c~~c~~~   16 (99)
                      |+.||..
T Consensus         2 CP~Cg~~    8 (47)
T PF04606_consen    2 CPHCGSK    8 (47)
T ss_pred             cCCCCCe
Confidence            5556554


No 256
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=20.68  E-value=79  Score=17.28  Aligned_cols=31  Identities=26%  Similarity=0.552  Sum_probs=17.7

Q ss_pred             ceeccCCCcccccChhHHHHHHHhhCCCCceecCCCCccc
Q psy3483          42 RYVCCLCSKYRHSDASKMRSHIRTHTKDRPYKCFYCDYRS   81 (99)
Q Consensus        42 ~~~c~~c~~~~~~~~~~~~~h~~~~~~~~~~~C~~c~~~f   81 (99)
                      .|.|..|+..+... .      ++  ....|.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r~-~------~~--~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKRH-R------RS--KRKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeeee-c------cc--chhhEECCCCCCEE
Confidence            47788888643322 1      11  22348888887554


No 257
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.58  E-value=88  Score=12.93  Aligned_cols=12  Identities=33%  Similarity=0.725  Sum_probs=4.4

Q ss_pred             ceecCCCCcccc
Q psy3483          71 PYKCFYCDYRSN   82 (99)
Q Consensus        71 ~~~C~~c~~~f~   82 (99)
                      .|-|..|+..|.
T Consensus         3 ryyCdyC~~~~~   14 (38)
T PF06220_consen    3 RYYCDYCKKYLT   14 (38)
T ss_dssp             S-B-TTT--B-S
T ss_pred             Ceecccccceec
Confidence            366777777663


No 258
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=20.57  E-value=44  Score=13.83  Aligned_cols=11  Identities=18%  Similarity=0.555  Sum_probs=7.1

Q ss_pred             eeCcccccccc
Q psy3483           8 VTCMYCSKILT   18 (99)
Q Consensus         8 ~~c~~c~~~f~   18 (99)
                      +.|+.||..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            45777776543


No 259
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=20.18  E-value=1.3e+02  Score=20.36  Aligned_cols=9  Identities=22%  Similarity=0.707  Sum_probs=5.5

Q ss_pred             ceecCCCCc
Q psy3483          71 PYKCFYCDY   79 (99)
Q Consensus        71 ~~~C~~c~~   79 (99)
                      .|.|+.|+-
T Consensus       458 ~~~cp~c~~  466 (479)
T PRK05452        458 NFLCPECSL  466 (479)
T ss_pred             CCcCcCCCC
Confidence            366777663


No 260
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=20.07  E-value=80  Score=12.21  Aligned_cols=10  Identities=20%  Similarity=0.571  Sum_probs=4.3

Q ss_pred             CCceecCCCC
Q psy3483          69 DRPYKCFYCD   78 (99)
Q Consensus        69 ~~~~~C~~c~   78 (99)
                      +..-.|+.|+
T Consensus        19 g~~r~C~~Cg   28 (32)
T PF09297_consen   19 GWARRCPSCG   28 (32)
T ss_dssp             SS-EEESSSS
T ss_pred             cCEeECCCCc
Confidence            3344555554


Done!