Query         psy3485
Match_columns 304
No_of_seqs    162 out of 2734
Neff          9.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:54:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3485.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3485hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 3.8E-33 8.3E-38  227.7   6.4  131  150-298   129-264 (279)
  2 KOG2462|consensus               99.9 3.6E-27 7.8E-32  192.8   5.6  112  181-302   126-240 (279)
  3 KOG1074|consensus               99.9 4.8E-23   1E-27  189.8   3.2   53  247-301   879-931 (958)
  4 KOG1074|consensus               99.8 1.8E-22   4E-27  186.0   0.7   83  214-302   606-693 (958)
  5 KOG3576|consensus               99.8 2.4E-21 5.3E-26  151.0   2.8  118  149-273   115-238 (267)
  6 KOG3608|consensus               99.8 1.5E-20 3.2E-25  158.0   7.6  166  129-301   184-376 (467)
  7 KOG3576|consensus               99.8 1.3E-20 2.9E-25  146.8   4.3  117  179-301   111-236 (267)
  8 KOG3608|consensus               99.8 4.6E-19 9.9E-24  149.1   5.5  140  152-301   178-345 (467)
  9 KOG3623|consensus               99.7 2.9E-18 6.3E-23  156.1   3.3  111  185-298   210-330 (1007)
 10 KOG3623|consensus               99.7 7.3E-18 1.6E-22  153.6   2.3   80  182-267   891-970 (1007)
 11 PLN03086 PRLI-interacting fact  99.6 1.1E-14 2.3E-19  133.7   9.5  133  151-298   407-561 (567)
 12 PHA00733 hypothetical protein   99.4 1.9E-13 4.1E-18  103.2   5.6   86  210-302    37-124 (128)
 13 PHA00733 hypothetical protein   99.3 2.2E-12 4.7E-17   97.4   4.8   85  181-273    36-125 (128)
 14 PHA02768 hypothetical protein;  99.3 1.1E-12 2.3E-17   81.7   1.8   44  247-294     5-48  (55)
 15 PLN03086 PRLI-interacting fact  99.2 2.4E-11 5.2E-16  111.9   7.3  102  152-272   454-565 (567)
 16 PHA02768 hypothetical protein;  99.1 1.6E-11 3.4E-16   76.6   1.5   40  186-227     6-45  (55)
 17 KOG3993|consensus               99.0 1.2E-10 2.5E-15  101.1   1.7  135  152-299   268-480 (500)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9   1E-09 2.2E-14   58.6   2.2   26  262-289     1-26  (26)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.3E-09 2.7E-14   58.2   1.9   24  201-224     2-25  (26)
 20 PHA00732 hypothetical protein   98.8 2.6E-09 5.7E-14   73.2   3.2   50  213-273     1-50  (79)
 21 PHA00616 hypothetical protein   98.7 5.9E-09 1.3E-13   61.9   1.6   39  247-287     1-39  (44)
 22 PHA00732 hypothetical protein   98.7   9E-09   2E-13   70.5   2.7   36  186-224     2-38  (79)
 23 KOG3993|consensus               98.7 3.7E-09   8E-14   91.9   0.1   88  184-274   266-383 (500)
 24 PHA00616 hypothetical protein   98.6 1.8E-08 3.9E-13   59.8   1.7   35  185-219     1-35  (44)
 25 PF05605 zf-Di19:  Drought indu  98.6 1.2E-07 2.6E-12   60.4   4.6   51  214-271     3-53  (54)
 26 PF05605 zf-Di19:  Drought indu  98.5 2.6E-07 5.5E-12   58.9   4.5   52  247-301     2-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.3 2.8E-07 6.1E-12   47.7   1.5   22  248-269     1-22  (23)
 28 PF00096 zf-C2H2:  Zinc finger,  98.3   5E-07 1.1E-11   46.7   1.9   23  278-300     1-23  (23)
 29 PF12756 zf-C2H2_2:  C2H2 type   98.1 1.3E-06 2.8E-11   63.3   2.3   75  187-272     1-75  (100)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.1 2.1E-06 4.5E-11   44.7   2.1   24  248-271     1-24  (24)
 31 COG5189 SFP1 Putative transcri  98.0 1.3E-06 2.9E-11   73.6   0.5   59  210-268   346-419 (423)
 32 PF13912 zf-C2H2_6:  C2H2-type   98.0 3.3E-06 7.1E-11   45.4   1.5   24  248-271     2-25  (27)
 33 PF12756 zf-C2H2_2:  C2H2 type   98.0 4.2E-06   9E-11   60.6   2.4   73  215-300     1-73  (100)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.9 5.6E-06 1.2E-10   43.0   1.8   24  278-301     1-24  (24)
 35 COG5189 SFP1 Putative transcri  97.9 2.2E-06 4.7E-11   72.3   0.2   52  183-234   347-419 (423)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.9 6.2E-06 1.3E-10   44.3   1.5   25  277-301     1-25  (27)
 37 smart00355 ZnF_C2H2 zinc finge  97.6 5.4E-05 1.2E-09   39.9   2.1   23  278-300     1-23  (26)
 38 smart00355 ZnF_C2H2 zinc finge  97.5  0.0001 2.3E-09   38.7   2.6   24  248-271     1-24  (26)
 39 PF09237 GAGA:  GAGA factor;  I  97.4 6.1E-05 1.3E-09   45.8   1.4   32  243-274    20-51  (54)
 40 PRK04860 hypothetical protein;  97.2 0.00024 5.1E-09   55.8   2.2   38  247-290   119-156 (160)
 41 PF12874 zf-met:  Zinc-finger o  97.1 0.00027 5.9E-09   37.0   1.5   22  248-269     1-22  (25)
 42 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00053 1.1E-08   35.5   2.1   23  248-271     1-23  (24)
 43 PRK04860 hypothetical protein;  96.9 0.00055 1.2E-08   53.7   2.0   38  213-260   119-156 (160)
 44 PF12874 zf-met:  Zinc-finger o  96.9 0.00053 1.1E-08   35.9   1.3   23  278-300     1-23  (25)
 45 PF09237 GAGA:  GAGA factor;  I  96.8  0.0014   3E-08   39.9   3.0   30  208-237    19-48  (54)
 46 KOG2231|consensus               96.8  0.0032 6.8E-08   59.8   6.9   89  194-298   158-260 (669)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00041 8.9E-09   37.1   0.2   22  248-269     2-23  (27)
 48 COG5048 FOG: Zn-finger [Genera  96.6 0.00026 5.6E-09   65.0  -1.9  117  185-302   289-443 (467)
 49 PF13909 zf-H2C2_5:  C2H2-type   96.6  0.0016 3.5E-08   33.6   1.7   24  278-302     1-24  (24)
 50 KOG2482|consensus               96.5    0.01 2.3E-07   51.1   6.9   23  185-207   195-217 (423)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4  0.0011 2.4E-08   35.4   0.7   23  277-299     1-23  (27)
 52 COG5236 Uncharacterized conser  96.0   0.026 5.7E-07   48.8   7.1   74  187-274   222-308 (493)
 53 KOG1146|consensus               96.0  0.0029 6.2E-08   63.6   1.5  111  188-298   439-610 (1406)
 54 KOG2231|consensus               95.7   0.028   6E-07   53.6   6.4  105  187-301   117-236 (669)
 55 PF01352 KRAB:  KRAB box;  Inte  95.7  0.0063 1.4E-07   36.0   1.4   38   21-58      2-39  (41)
 56 KOG1146|consensus               95.6  0.0041 8.9E-08   62.6   0.9   80  215-299   438-540 (1406)
 57 PF13913 zf-C2HC_2:  zinc-finge  95.6    0.01 2.3E-07   30.9   1.9   20  278-298     3-22  (25)
 58 smart00451 ZnF_U1 U1-like zinc  95.6  0.0095   2E-07   33.8   1.9   22  277-298     3-24  (35)
 59 smart00451 ZnF_U1 U1-like zinc  95.3   0.013 2.7E-07   33.3   1.9   23  247-269     3-25  (35)
 60 PF13913 zf-C2HC_2:  zinc-finge  95.1   0.019 4.2E-07   29.9   2.0   19  249-268     4-22  (25)
 61 KOG2785|consensus               94.8     0.1 2.3E-06   46.0   6.8  116  181-298    64-241 (390)
 62 KOG2785|consensus               94.5    0.08 1.7E-06   46.6   5.5   57  213-269   166-242 (390)
 63 TIGR00622 ssl1 transcription f  94.3   0.059 1.3E-06   39.3   3.6   84  212-301    14-105 (112)
 64 PF09538 FYDLN_acid:  Protein o  94.2   0.038 8.3E-07   40.3   2.5   32  246-290     8-39  (108)
 65 COG5236 Uncharacterized conser  94.0   0.049 1.1E-06   47.2   3.1  122  152-299   152-303 (493)
 66 COG5048 FOG: Zn-finger [Genera  93.8   0.012 2.7E-07   53.8  -0.9   70  212-288   288-364 (467)
 67 smart00868 zf-AD Zinc-finger a  93.3    0.13 2.7E-06   34.0   3.6   22   22-43     38-59  (73)
 68 KOG4173|consensus               93.2   0.048   1E-06   43.7   1.5   51  187-237   108-170 (253)
 69 COG4049 Uncharacterized protei  92.2   0.067 1.5E-06   33.2   0.9   31  243-273    13-43  (65)
 70 PF07776 zf-AD:  Zinc-finger as  92.1   0.056 1.2E-06   36.2   0.6   23   21-43     39-61  (75)
 71 KOG4173|consensus               91.8    0.15 3.3E-06   40.9   2.8   84  184-271    78-170 (253)
 72 COG2888 Predicted Zn-ribbon RN  91.4    0.14   3E-06   32.4   1.7    9  185-193    27-35  (61)
 73 KOG2186|consensus               91.1    0.12 2.7E-06   42.8   1.7   25  184-209    28-52  (276)
 74 cd00350 rubredoxin_like Rubred  91.1    0.12 2.6E-06   28.9   1.1   24  186-221     2-25  (33)
 75 KOG2893|consensus               90.9   0.055 1.2E-06   44.4  -0.5   49  184-237    10-58  (341)
 76 TIGR02300 FYDLN_acid conserved  90.6     0.2 4.4E-06   37.1   2.3   33  246-291     8-40  (129)
 77 PF12013 DUF3505:  Protein of u  89.4    0.63 1.4E-05   34.1   4.1   26  247-272    80-109 (109)
 78 KOG2186|consensus               89.3    0.17 3.7E-06   42.0   1.1   47  185-234     3-49  (276)
 79 PF09986 DUF2225:  Uncharacteri  89.3   0.073 1.6E-06   44.2  -1.1   45  246-290     4-61  (214)
 80 PF12013 DUF3505:  Protein of u  88.9    0.99 2.1E-05   33.0   4.9   25  278-302    81-109 (109)
 81 PF13719 zinc_ribbon_5:  zinc-r  88.2    0.32 6.9E-06   28.0   1.4   32  187-223     4-35  (37)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  88.0     0.3 6.5E-06   28.2   1.3   12  187-198     4-15  (38)
 83 PF13717 zinc_ribbon_4:  zinc-r  88.0    0.35 7.6E-06   27.6   1.5   12  187-198     4-15  (36)
 84 cd00729 rubredoxin_SM Rubredox  87.8    0.42   9E-06   26.9   1.7   26  247-286     2-27  (34)
 85 PF10571 UPF0547:  Uncharacteri  87.5    0.42 9.1E-06   25.1   1.5   11  278-288    15-25  (26)
 86 PF09538 FYDLN_acid:  Protein o  87.2    0.34 7.4E-06   35.3   1.4   15  212-226    25-39  (108)
 87 KOG2893|consensus               86.7    0.16 3.5E-06   41.8  -0.6   41  216-266    13-53  (341)
 88 PRK14890 putative Zn-ribbon RN  86.7    0.49 1.1E-05   30.1   1.7    8  247-254    48-55  (59)
 89 smart00659 RPOLCX RNA polymera  86.7     0.4 8.6E-06   28.8   1.3   27  247-286     2-28  (44)
 90 smart00614 ZnF_BED BED zinc fi  85.0    0.67 1.4E-05   28.6   1.8   21  248-268    19-44  (50)
 91 PF02892 zf-BED:  BED zinc fing  84.8    0.85 1.8E-05   27.3   2.1   12  248-259    17-28  (45)
 92 COG4049 Uncharacterized protei  84.5    0.62 1.3E-05   29.0   1.4   28  210-237    14-41  (65)
 93 TIGR00373 conserved hypothetic  84.2    0.52 1.1E-05   37.1   1.2   37  177-222   101-137 (158)
 94 PF02892 zf-BED:  BED zinc fing  84.2     0.8 1.7E-05   27.4   1.8   27  211-237    14-44  (45)
 95 PF09986 DUF2225:  Uncharacteri  83.7    0.14   3E-06   42.5  -2.3   13  248-260    49-61  (214)
 96 TIGR00373 conserved hypothetic  83.3     1.4 3.1E-05   34.6   3.4   34  243-287   105-138 (158)
 97 COG4530 Uncharacterized protei  82.9     1.4   3E-05   31.7   2.8   28  248-288    10-37  (129)
 98 PF07754 DUF1610:  Domain of un  82.7    0.72 1.6E-05   23.7   1.0    8  185-192    16-23  (24)
 99 TIGR00622 ssl1 transcription f  82.6     1.1 2.5E-05   32.7   2.3   23  245-267    79-101 (112)
100 PRK06266 transcription initiat  82.3    0.66 1.4E-05   37.3   1.2   34  243-287   113-146 (178)
101 COG1996 RPC10 DNA-directed RNA  82.2    0.66 1.4E-05   28.4   0.9   30  245-286     4-33  (49)
102 PRK06266 transcription initiat  81.8    0.74 1.6E-05   37.0   1.3   36  179-223   111-146 (178)
103 smart00614 ZnF_BED BED zinc fi  81.8     1.1 2.4E-05   27.6   1.8   25  277-301    18-48  (50)
104 smart00531 TFIIE Transcription  81.7    0.75 1.6E-05   35.7   1.2   15  246-260    98-112 (147)
105 PF05443 ROS_MUCR:  ROS/MUCR tr  81.4    0.81 1.8E-05   34.7   1.3   27  245-274    70-96  (132)
106 smart00834 CxxC_CXXC_SSSS Puta  80.3     0.4 8.6E-06   28.1  -0.6   30  248-286     6-35  (41)
107 COG1592 Rubrerythrin [Energy p  79.1     1.2 2.6E-05   35.1   1.6    8  277-284   149-156 (166)
108 TIGR02300 FYDLN_acid conserved  79.0     1.2 2.6E-05   33.2   1.4   29  187-226    11-39  (129)
109 COG1997 RPL43A Ribosomal prote  78.8     1.2 2.5E-05   30.8   1.2   31  246-288    34-64  (89)
110 smart00531 TFIIE Transcription  78.8     1.2 2.6E-05   34.6   1.5   39  181-223    95-133 (147)
111 PF08274 PhnA_Zn_Ribbon:  PhnA   78.6    0.83 1.8E-05   24.9   0.4   26  249-287     4-29  (30)
112 smart00734 ZnF_Rad18 Rad18-lik  78.1     2.1 4.5E-05   22.4   1.8   18  249-267     3-20  (26)
113 PRK00464 nrdR transcriptional   78.1    0.36 7.9E-06   37.6  -1.5   12  248-259    29-40  (154)
114 PF15269 zf-C2H2_7:  Zinc-finge  78.0     1.5 3.2E-05   26.0   1.4   21  214-234    21-41  (54)
115 KOG2482|consensus               77.3     4.3 9.4E-05   35.6   4.5   23  247-269   195-217 (423)
116 COG1592 Rubrerythrin [Energy p  76.6     1.5 3.3E-05   34.6   1.5   12  209-220   145-156 (166)
117 TIGR02605 CxxC_CxxC_SSSS putat  76.6    0.61 1.3E-05   29.0  -0.6   13  248-260     6-18  (52)
118 KOG2071|consensus               76.4       2 4.4E-05   40.4   2.5   27  183-209   416-442 (579)
119 PF03604 DNA_RNApol_7kD:  DNA d  76.1     1.8   4E-05   23.9   1.3   26  248-286     1-26  (32)
120 PRK09678 DNA-binding transcrip  75.9    0.72 1.6E-05   30.9  -0.4   15  211-225    25-41  (72)
121 KOG2907|consensus               75.1    0.54 1.2E-05   34.0  -1.2   29  170-198    10-38  (116)
122 COG5151 SSL1 RNA polymerase II  75.1     1.7 3.8E-05   37.4   1.6   84  212-301   321-412 (421)
123 PF09723 Zn-ribbon_8:  Zinc rib  74.9       1 2.2E-05   26.7   0.1   29  248-285     6-34  (42)
124 COG1198 PriA Primosomal protei  74.3     1.7 3.6E-05   42.8   1.5   27  243-286   458-484 (730)
125 PRK09678 DNA-binding transcrip  73.9    0.47   1E-05   31.8  -1.7   12  278-289    28-41  (72)
126 KOG2272|consensus               73.1     2.7 5.8E-05   35.1   2.2   62  186-260   164-234 (332)
127 KOG4167|consensus               71.1     1.2 2.6E-05   42.9  -0.3   28  246-273   791-818 (907)
128 PHA00626 hypothetical protein   70.2     2.4 5.1E-05   26.6   1.0   14  212-225    22-35  (59)
129 PF14353 CpXC:  CpXC protein     69.5    0.37 7.9E-06   36.5  -3.4   14  277-290    38-51  (128)
130 PF06524 NOA36:  NOA36 protein;  69.3     1.1 2.3E-05   37.6  -0.9   24  276-299   208-231 (314)
131 PF04959 ARS2:  Arsenite-resist  66.9     3.7   8E-05   33.9   1.8   26  212-237    76-101 (214)
132 KOG1280|consensus               66.7     4.2 9.2E-05   35.7   2.1   72  177-254    45-116 (381)
133 PF01363 FYVE:  FYVE zinc finge  66.5     2.8   6E-05   27.7   0.8   28  247-288     9-36  (69)
134 PRK00398 rpoP DNA-directed RNA  66.2     3.3 7.2E-05   24.9   1.1   13  185-197     3-15  (46)
135 COG0068 HypF Hydrogenase matur  65.8     1.4 3.1E-05   42.5  -1.0   56  187-255   125-181 (750)
136 PF15269 zf-C2H2_7:  Zinc-finge  64.4     5.4 0.00012   23.7   1.6   33  237-269     9-42  (54)
137 KOG4124|consensus               63.8     1.3 2.8E-05   38.7  -1.4   28  211-238   347-376 (442)
138 COG1997 RPL43A Ribosomal prote  63.7       3 6.6E-05   28.8   0.6   15  182-196    50-64  (89)
139 COG4957 Predicted transcriptio  62.8     3.4 7.5E-05   31.0   0.8   24  248-274    77-100 (148)
140 smart00661 RPOL9 RNA polymeras  62.7     3.8 8.3E-05   25.2   0.9   13  185-197    20-32  (52)
141 TIGR01206 lysW lysine biosynth  61.9     2.9 6.4E-05   26.3   0.2   30  248-287     3-32  (54)
142 PF04959 ARS2:  Arsenite-resist  61.8     3.8 8.2E-05   33.9   0.9   32  243-274    73-104 (214)
143 PF08790 zf-LYAR:  LYAR-type C2  61.3     1.5 3.2E-05   23.4  -1.0   19  249-268     2-20  (28)
144 PF09416 UPF1_Zn_bind:  RNA hel  60.7     7.8 0.00017   30.0   2.4   44  243-286    10-69  (152)
145 PF15135 UPF0515:  Uncharacteri  60.3      18  0.0004   30.3   4.6   20  146-165   107-126 (278)
146 TIGR00595 priA primosomal prot  59.4     4.6 9.9E-05   38.3   1.2   27  243-286   236-262 (505)
147 PF04216 FdhE:  Protein involve  58.6     1.1 2.5E-05   39.0  -2.8   14  182-195   194-207 (290)
148 KOG2593|consensus               58.6     8.3 0.00018   35.1   2.5   18  183-200   126-143 (436)
149 cd00065 FYVE FYVE domain; Zinc  58.4     7.4 0.00016   24.4   1.7   26  249-288     4-29  (57)
150 PRK04023 DNA polymerase II lar  57.9       8 0.00017   39.1   2.5   10  185-194   626-635 (1121)
151 COG3091 SprT Zn-dependent meta  57.4     4.4 9.6E-05   31.2   0.6   32  247-285   117-148 (156)
152 KOG4167|consensus               57.3     3.3 7.3E-05   40.0  -0.1   24  213-237   792-815 (907)
153 COG1198 PriA Primosomal protei  56.4     6.4 0.00014   38.8   1.6   34  152-192   436-469 (730)
154 KOG3408|consensus               55.2     9.2  0.0002   28.2   1.9   27  243-269    53-79  (129)
155 PF02176 zf-TRAF:  TRAF-type zi  55.1     5.3 0.00011   25.4   0.6   41  184-225     8-54  (60)
156 smart00064 FYVE Protein presen  54.6     8.7 0.00019   25.1   1.6   27  248-288    11-37  (68)
157 PF07975 C1_4:  TFIIH C1-like d  54.4     3.5 7.7E-05   25.5  -0.3   25  277-301    21-45  (51)
158 PF14311 DUF4379:  Domain of un  54.2     8.6 0.00019   24.1   1.5   18  248-265    29-46  (55)
159 PRK14873 primosome assembly pr  53.5     3.5 7.6E-05   40.4  -0.7   47  215-286   385-431 (665)
160 PRK04023 DNA polymerase II lar  53.1      13 0.00028   37.7   3.1    9  186-194   639-647 (1121)
161 PF07282 OrfB_Zn_ribbon:  Putat  52.9     6.9 0.00015   25.7   0.9   16  182-197    43-58  (69)
162 KOG1280|consensus               52.7      14 0.00031   32.5   2.9   42  244-285    76-117 (381)
163 PF14369 zf-RING_3:  zinc-finge  52.1     9.5 0.00021   21.5   1.2   10  187-196    23-32  (35)
164 PF05443 ROS_MUCR:  ROS/MUCR tr  52.0     8.8 0.00019   29.1   1.4   23  277-302    72-94  (132)
165 KOG0978|consensus               51.7     5.4 0.00012   38.8   0.3   49  152-203   644-696 (698)
166 COG1645 Uncharacterized Zn-fin  51.6     7.9 0.00017   29.2   1.1   27  168-196    29-55  (131)
167 COG5151 SSL1 RNA polymerase II  50.3     6.3 0.00014   34.1   0.5   77  184-268   321-409 (421)
168 COG2331 Uncharacterized protei  49.4     7.9 0.00017   26.0   0.7   18  152-169    13-31  (82)
169 TIGR03826 YvyF flagellar opero  48.9     8.7 0.00019   29.3   1.0   23  153-176     5-27  (137)
170 PF13878 zf-C2H2_3:  zinc-finge  48.7      18 0.00038   21.2   2.1   25  185-209    13-39  (41)
171 PF07295 DUF1451:  Protein of u  48.5     7.4 0.00016   30.1   0.6   10  247-256   112-121 (146)
172 PF09332 Mcm10:  Mcm10 replicat  48.2     3.3 7.1E-05   36.9  -1.6   65  213-294   252-320 (344)
173 smart00154 ZnF_AN1 AN1-like Zi  47.7       9  0.0002   22.2   0.7   13  277-289    12-24  (39)
174 KOG4124|consensus               47.6     2.3   5E-05   37.3  -2.5   52  183-234   347-419 (442)
175 PF09297 zf-NADH-PPase:  NADH p  47.6      11 0.00023   20.7   1.0   26  170-195     6-31  (32)
176 PF04423 Rad50_zn_hook:  Rad50   46.6     6.4 0.00014   24.6  -0.1   20  279-298    22-43  (54)
177 KOG2593|consensus               46.4      20 0.00043   32.7   2.9   20  209-228   124-143 (436)
178 PF12760 Zn_Tnp_IS1595:  Transp  46.4     4.7  0.0001   24.3  -0.7    9  277-285    37-45  (46)
179 PF06524 NOA36:  NOA36 protein;  46.3     7.3 0.00016   32.8   0.2   25  245-269   207-231 (314)
180 smart00440 ZnF_C2C2 C2C2 Zinc   45.8     1.8   4E-05   25.3  -2.4   10  248-257    29-38  (40)
181 PF06220 zf-U1:  U1 zinc finger  45.8      15 0.00033   21.1   1.4   12  247-258     3-14  (38)
182 PF09845 DUF2072:  Zn-ribbon co  45.8     6.3 0.00014   29.6  -0.2   25  151-175     1-27  (131)
183 PRK12380 hydrogenase nickel in  45.5     9.3  0.0002   28.1   0.7   12  248-259    71-82  (113)
184 PRK03564 formate dehydrogenase  45.4      11 0.00024   33.1   1.2   77  184-289   186-264 (309)
185 PRK14873 primosome assembly pr  45.2      12 0.00025   36.9   1.4   35  152-193   384-418 (665)
186 KOG3408|consensus               45.2      13 0.00028   27.5   1.3   28  180-207    52-79  (129)
187 PRK14714 DNA polymerase II lar  44.7      12 0.00026   39.0   1.4   36  152-196   668-703 (1337)
188 KOG0782|consensus               44.4     4.3 9.4E-05   38.1  -1.5   35  187-227   255-290 (1004)
189 COG4888 Uncharacterized Zn rib  44.2     2.1 4.6E-05   30.3  -2.7   37  245-287    20-56  (104)
190 PTZ00255 60S ribosomal protein  44.0     6.1 0.00013   27.7  -0.5   15  182-196    51-65  (90)
191 PF01780 Ribosomal_L37ae:  Ribo  43.5     3.3 7.2E-05   29.0  -1.8   27  170-196    38-64  (90)
192 KOG4727|consensus               43.2      12 0.00026   29.4   1.0   22  277-298    75-96  (193)
193 PRK03824 hypA hydrogenase nick  43.1     7.7 0.00017   29.6  -0.1   10  152-161    71-80  (135)
194 PF12907 zf-met2:  Zinc-binding  43.0      24 0.00053   20.6   2.0    7  187-193     3-9   (40)
195 KOG0717|consensus               42.9      14  0.0003   34.1   1.4   22  248-269   293-314 (508)
196 PF13240 zinc_ribbon_2:  zinc-r  42.4      12 0.00025   18.9   0.5    6  188-193    16-21  (23)
197 PF05290 Baculo_IE-1:  Baculovi  42.1     6.8 0.00015   29.5  -0.5   18  150-167    79-96  (140)
198 KOG2636|consensus               41.9      16 0.00036   33.3   1.8   27  208-234   396-423 (497)
199 TIGR00244 transcriptional regu  41.8      11 0.00024   29.1   0.5   19  184-202    27-45  (147)
200 COG0068 HypF Hydrogenase matur  41.7     4.3 9.3E-05   39.3  -2.0   57  215-286   125-182 (750)
201 PF01428 zf-AN1:  AN1-like Zinc  40.8     8.5 0.00018   22.8  -0.1   11  277-287    13-23  (43)
202 PF08792 A2L_zn_ribbon:  A2L zi  40.6      11 0.00025   20.9   0.4   12  184-195    20-31  (33)
203 TIGR01562 FdhE formate dehydro  40.5      14  0.0003   32.4   1.1   77  185-289   184-264 (305)
204 TIGR00280 L37a ribosomal prote  40.1     7.2 0.00016   27.3  -0.6   15  182-196    50-64  (91)
205 TIGR00686 phnA alkylphosphonat  39.5      14 0.00031   26.7   0.8   28  249-289     4-31  (109)
206 PF10263 SprT-like:  SprT-like   39.0     8.4 0.00018   29.9  -0.4   32  247-288   123-154 (157)
207 TIGR01053 LSD1 zinc finger dom  38.6      18 0.00039   19.8   1.0   24  170-193     4-27  (31)
208 TIGR00595 priA primosomal prot  38.4      18  0.0004   34.3   1.6   36  152-194   214-249 (505)
209 KOG0717|consensus               38.1      18 0.00038   33.4   1.4   22  186-207   293-314 (508)
210 PTZ00448 hypothetical protein;  37.9      23 0.00049   31.8   2.0   23  247-269   314-336 (373)
211 KOG0402|consensus               37.6      17 0.00037   24.8   0.9   27  170-196    39-65  (92)
212 PRK05580 primosome assembly pr  37.5      17 0.00036   35.9   1.2   27  243-286   404-430 (679)
213 PF01286 XPA_N:  XPA protein N-  37.4      13 0.00027   20.9   0.2   14  278-291     4-17  (34)
214 COG4306 Uncharacterized protei  37.3      10 0.00022   28.1  -0.2   39  187-225    41-80  (160)
215 PRK10220 hypothetical protein;  37.0      21 0.00045   25.9   1.3   29  249-290     5-33  (111)
216 COG1675 TFA1 Transcription ini  36.6      21 0.00047   28.5   1.5   19  181-199   109-127 (176)
217 PF14445 Prok-RING_2:  Prokaryo  36.2     7.6 0.00016   23.7  -0.8   16  152-167     8-23  (57)
218 PRK14892 putative transcriptio  35.9      11 0.00023   27.1  -0.3   36  246-290    20-55  (99)
219 PF13451 zf-trcl:  Probable zin  35.6      20 0.00043   22.0   0.9   12  185-196     4-15  (49)
220 KOG2071|consensus               35.6      23 0.00049   33.7   1.7   31  244-274   415-445 (579)
221 COG1571 Predicted DNA-binding   35.5      19 0.00042   32.9   1.2   14  247-260   367-380 (421)
222 COG1594 RPB9 DNA-directed RNA   35.4     7.3 0.00016   28.7  -1.2   15  184-198    21-35  (113)
223 PF10276 zf-CHCC:  Zinc-finger   35.1      13 0.00029   21.7   0.1   11  247-257    29-39  (40)
224 PRK03976 rpl37ae 50S ribosomal  34.9     9.1  0.0002   26.8  -0.7   16  181-196    50-65  (90)
225 TIGR00100 hypA hydrogenase nic  34.5      15 0.00032   27.2   0.2   15  183-197    68-82  (115)
226 smart00731 SprT SprT homologue  34.4      18 0.00038   27.9   0.7   32  213-257   112-143 (146)
227 PF08209 Sgf11:  Sgf11 (transcr  34.0      20 0.00044   20.0   0.7   16  152-167     5-24  (33)
228 KOG2461|consensus               33.6      13 0.00029   33.9  -0.1   87  191-285   309-395 (396)
229 PRK00432 30S ribosomal protein  33.2      21 0.00046   22.0   0.8    9  213-221    37-45  (50)
230 PF05495 zf-CHY:  CHY zinc fing  32.9     5.6 0.00012   26.6  -2.0   14  247-260    41-54  (71)
231 PF13453 zf-TFIIB:  Transcripti  32.9      21 0.00045   20.8   0.7   21  277-297    19-39  (41)
232 COG1656 Uncharacterized conser  32.8      36 0.00078   26.8   2.1   11  278-288   131-141 (165)
233 COG4640 Predicted membrane pro  32.7      27 0.00059   31.4   1.7   19  247-265    15-33  (465)
234 COG1327 Predicted transcriptio  32.4      17 0.00038   28.0   0.3   17  183-199    26-42  (156)
235 PF15135 UPF0515:  Uncharacteri  32.3      22 0.00047   29.9   0.9   18  209-226   151-168 (278)
236 PF13821 DUF4187:  Domain of un  32.1      51  0.0011   20.7   2.4   29  228-266    18-46  (55)
237 PF10013 DUF2256:  Uncharacteri  31.9      26 0.00057   20.6   1.0   17  215-231    10-26  (42)
238 KOG0696|consensus               31.5      13 0.00029   34.0  -0.4   47  202-254    82-128 (683)
239 PF11931 DUF3449:  Domain of un  31.5      16 0.00034   29.8   0.0    8  185-192   101-108 (196)
240 PRK04351 hypothetical protein;  31.5      22 0.00048   27.6   0.8   32  247-288   112-143 (149)
241 PF04931 DNA_pol_phi:  DNA poly  31.4      38 0.00083   34.1   2.7   13   27-39    606-618 (784)
242 PRK12496 hypothetical protein;  31.3      29 0.00063   27.4   1.5   10  248-257   128-137 (164)
243 COG1998 RPS31 Ribosomal protei  31.2      11 0.00023   23.1  -0.7   16  152-167    20-36  (51)
244 KOG2807|consensus               31.0      44 0.00096   29.3   2.6   73  212-301   289-369 (378)
245 KOG0320|consensus               30.8      27 0.00058   27.8   1.2   53  182-260   128-180 (187)
246 PRK01343 zinc-binding protein;  30.7      28 0.00061   22.1   1.0   13  246-258     8-20  (57)
247 COG5112 UFD2 U1-like Zn-finger  30.5      26 0.00056   25.2   0.9   26  243-268    51-76  (126)
248 KOG0782|consensus               30.2      17 0.00036   34.4  -0.1   57  228-297   240-298 (1004)
249 COG5152 Uncharacterized conser  30.0      27  0.0006   28.2   1.1   17  183-199   194-210 (259)
250 PF01096 TFIIS_C:  Transcriptio  29.9      28  0.0006   20.1   0.8    9  214-222    29-37  (39)
251 KOG0957|consensus               29.8      32 0.00069   32.0   1.6   45  152-197   545-601 (707)
252 PF04780 DUF629:  Protein of un  29.8      33 0.00072   31.9   1.8   32  180-211    52-84  (466)
253 PF04810 zf-Sec23_Sec24:  Sec23  29.6      21 0.00046   20.7   0.3    9  212-220    23-31  (40)
254 PF05191 ADK_lid:  Adenylate ki  29.3      27 0.00058   19.8   0.7   10  187-196     3-12  (36)
255 KOG3214|consensus               29.0      16 0.00035   25.9  -0.3   42  245-292    21-62  (109)
256 COG1571 Predicted DNA-binding   28.5      29 0.00063   31.8   1.1   30  187-227   352-381 (421)
257 PF14787 zf-CCHC_5:  GAG-polypr  28.2      29 0.00062   19.7   0.7   13  277-289     2-14  (36)
258 PF07295 DUF1451:  Protein of u  28.1      22 0.00048   27.5   0.3    9  152-160   113-121 (146)
259 PRK05580 primosome assembly pr  27.9      34 0.00073   33.8   1.6   36  152-194   382-417 (679)
260 COG5112 UFD2 U1-like Zn-finger  27.9      22 0.00047   25.5   0.2   22  277-298    55-76  (126)
261 COG3364 Zn-ribbon containing p  27.4      35 0.00076   24.4   1.1   14  247-260     2-15  (112)
262 TIGR00143 hypF [NiFe] hydrogen  27.1     9.7 0.00021   37.7  -2.3   39  187-226    92-131 (711)
263 KOG2807|consensus               27.0      79  0.0017   27.9   3.4   22  183-204   288-309 (378)
264 PRK11827 hypothetical protein;  26.7      34 0.00073   22.0   0.9   28  170-197    11-38  (60)
265 COG1773 Rubredoxin [Energy pro  26.6      28  0.0006   22.0   0.5   11  277-287     3-13  (55)
266 PF09963 DUF2197:  Uncharacteri  26.5      19 0.00042   22.7  -0.2    9  187-195     4-12  (56)
267 PRK00564 hypA hydrogenase nick  26.4      26 0.00056   26.0   0.4   14  184-197    70-83  (117)
268 COG3677 Transposase and inacti  26.4      29 0.00064   26.2   0.7   36  247-289    30-65  (129)
269 PTZ00303 phosphatidylinositol   26.3      20 0.00044   35.3  -0.3   12  215-226   462-473 (1374)
270 PF13824 zf-Mss51:  Zinc-finger  26.2      46 0.00099   21.0   1.4   10  185-194    14-23  (55)
271 PF00628 PHD:  PHD-finger;  Int  26.1      40 0.00088   20.3   1.2   20  179-198     8-27  (51)
272 PF04780 DUF629:  Protein of un  25.4      69  0.0015   29.9   3.0   22  248-269    58-79  (466)
273 PF05741 zf-nanos:  Nanos RNA b  25.4      24 0.00053   22.2   0.1   10  277-286    33-42  (55)
274 smart00132 LIM Zinc-binding do  25.4      11 0.00023   21.1  -1.5   10  278-287    28-37  (39)
275 PTZ00448 hypothetical protein;  25.2      49  0.0011   29.7   1.9   24  184-207   313-336 (373)
276 PF03833 PolC_DP2:  DNA polymer  25.2      24 0.00051   35.2   0.0   36  152-196   656-691 (900)
277 KOG1729|consensus               25.1      19 0.00042   31.2  -0.6    8  152-159   169-176 (288)
278 KOG2636|consensus               25.0      47   0.001   30.5   1.8   29  178-206   394-423 (497)
279 PF09082 DUF1922:  Domain of un  24.8      25 0.00055   23.2   0.1   23  173-196     8-30  (68)
280 PF12647 RNHCP:  RNHCP domain;   24.5      14 0.00031   25.9  -1.2   29  150-178     3-35  (92)
281 COG4896 Uncharacterized protei  24.3      39 0.00085   21.7   0.8   16  244-259    28-43  (68)
282 PF06397 Desulfoferrod_N:  Desu  24.1      31 0.00066   19.7   0.3   11  277-287     6-16  (36)
283 PF14255 Cys_rich_CPXG:  Cystei  24.1      36 0.00078   21.2   0.6   11  278-288     1-11  (52)
284 COG5188 PRP9 Splicing factor 3  24.1      49  0.0011   29.4   1.7   28  207-234   368-396 (470)
285 cd00924 Cyt_c_Oxidase_Vb Cytoc  23.5      30 0.00066   24.7   0.3   12  212-223    78-89  (97)
286 KOG1842|consensus               23.4      43 0.00094   30.7   1.3   11  279-289    81-91  (505)
287 PLN02294 cytochrome c oxidase   23.3      25 0.00053   27.8  -0.2   12  277-288   141-152 (174)
288 COG4391 Uncharacterized protei  23.3      33 0.00072   22.1   0.4   12  277-288    48-59  (62)
289 PF09332 Mcm10:  Mcm10 replicat  23.3      10 0.00022   33.8  -2.7   45  245-290   250-298 (344)
290 PF01155 HypA:  Hydrogenase exp  23.3      29 0.00062   25.5   0.1   10  152-161    71-80  (113)
291 COG5188 PRP9 Splicing factor 3  22.9      37 0.00081   30.1   0.8   24  245-268   236-259 (470)
292 COG3464 Transposase and inacti  22.8      21 0.00045   32.8  -0.8   10  214-223    39-48  (402)
293 PRK11032 hypothetical protein;  22.4      30 0.00065   27.2   0.1   31  152-198   125-155 (160)
294 PF14803 Nudix_N_2:  Nudix N-te  22.4      40 0.00088   18.9   0.6   11  184-194    21-31  (34)
295 CHL00174 accD acetyl-CoA carbo  22.0      58  0.0013   28.5   1.7   11  278-288    58-68  (296)
296 TIGR00515 accD acetyl-CoA carb  22.0      54  0.0012   28.5   1.6   11  248-258    46-56  (285)
297 KOG1842|consensus               21.9      59  0.0013   29.9   1.8   28  184-211    14-42  (505)
298 PRK03681 hypA hydrogenase nick  21.8      26 0.00057   25.8  -0.3    9  152-160    71-79  (114)
299 KOG2330|consensus               21.7      32 0.00068   31.4   0.1   55    1-55    284-353 (500)
300 COG1779 C4-type Zn-finger prot  21.3      18 0.00039   29.4  -1.4   11  248-258    44-54  (201)
301 PRK05978 hypothetical protein;  21.2      26 0.00057   27.2  -0.5   10  249-258    54-63  (148)
302 PF01844 HNH:  HNH endonuclease  21.0      14 0.00031   21.8  -1.6   11  280-290     1-11  (47)
303 KOG0978|consensus               20.4      34 0.00075   33.5   0.1   21  277-297   678-698 (698)
304 PF10083 DUF2321:  Uncharacteri  20.3      19 0.00041   28.0  -1.4   40  187-226    41-81  (158)
305 PF11494 Ta0938:  Ta0938;  Inte  20.1      58  0.0013   23.0   1.1   36  152-198    15-50  (105)

No 1  
>KOG2462|consensus
Probab=99.98  E-value=3.8e-33  Score=227.70  Aligned_cols=131  Identities=20%  Similarity=0.338  Sum_probs=122.8

Q ss_pred             CccccCCCchHH-----HHHHHHHHhhhhccccccCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhcc
Q psy3485         150 DQFFCIHCNGCV-----LYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAA  224 (304)
Q Consensus       150 ~~~~C~~C~~~f-----l~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~  224 (304)
                      .+|+|..||+.+     |.+|.+.||.        -...+.|.|++|||.|.+.-+|..|+|+|+  -+++|.+|||.|.
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~--------~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRS--------LDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFS  198 (279)
T ss_pred             Cceeccccccccccccccchhhccccc--------ccccccccCCCCCceeeehHHHhhHhhccC--CCccccccccccc
Confidence            459999999999     9999998832        334678999999999999999999999998  7799999999999


Q ss_pred             CHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHh
Q psy3485         225 SKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWIS  298 (304)
Q Consensus       225 ~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~  298 (304)
                      ..+.|+.|+| .|     ||||||.|..|+|+|+.+++|+.||+||.+.+  +|+|+.|+|+|+.++.|-.|..
T Consensus       199 RPWLLQGHiR-TH-----TGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K--~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  199 RPWLLQGHIR-TH-----TGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK--KHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             chHHhhcccc-cc-----cCCCCccCCcccchhcchHHHHHHHHhhcCCc--cccCcchhhHHHHHHHHHHhhh
Confidence            9999999999 99     99999999999999999999999999999997  9999999999999999999975


No 2  
>KOG2462|consensus
Probab=99.94  E-value=3.6e-27  Score=192.80  Aligned_cols=112  Identities=21%  Similarity=0.402  Sum_probs=104.6

Q ss_pred             CCCCCcccCCCcccccChHHHHHHHHhhCC---CCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccC
Q psy3485         181 PMRRNFMCFACPYYCRYGSSMAIHLRTHTK---EKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTS  257 (304)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~---~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F  257 (304)
                      .....|+|+.||+.+.+.++|.+|..+|..   .+.+.|.+|||.|.+..+|..|+| +|     +  -+++|.+|||.|
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH-----~--l~c~C~iCGKaF  197 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-TH-----T--LPCECGICGKAF  197 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-cc-----C--CCcccccccccc
Confidence            345679999999999999999999999963   577999999999999999999999 77     4  689999999999


Q ss_pred             CChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHhhccc
Q psy3485         258 PTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWISVDVN  302 (304)
Q Consensus       258 ~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~~~~~  302 (304)
                      .+.+-|.-|+|+|+|++  ||.|++|+|.|+.++||+.||++|++
T Consensus       198 SRPWLLQGHiRTHTGEK--PF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  198 SRPWLLQGHIRTHTGEK--PFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             cchHHhhcccccccCCC--CccCCcccchhcchHHHHHHHHhhcC
Confidence            99999999999999997  99999999999999999999999986


No 3  
>KOG1074|consensus
Probab=99.86  E-value=4.8e-23  Score=189.79  Aligned_cols=53  Identities=11%  Similarity=0.135  Sum_probs=51.0

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHhhcc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      ...|..||+.|.+.++|..|||+|++++  ||.|.+|++.|.++.+|.+|+.+|.
T Consensus       879 ~h~C~vCgk~FsSSsALqiH~rTHtg~K--PF~C~fC~~aFttrgnLKvHMgtH~  931 (958)
T KOG1074|consen  879 AHVCNVCGKQFSSSAALEIHMRTHTGPK--PFFCHFCEEAFTTRGNLKVHMGTHM  931 (958)
T ss_pred             hhhhccchhcccchHHHHHhhhcCCCCC--Cccchhhhhhhhhhhhhhhhhcccc
Confidence            3899999999999999999999999997  9999999999999999999999985


No 4  
>KOG1074|consensus
Probab=99.84  E-value=1.8e-22  Score=186.00  Aligned_cols=83  Identities=20%  Similarity=0.329  Sum_probs=76.8

Q ss_pred             cccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCC--CCcccC---CCccccc
Q psy3485         214 FACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTS--GPTIQP---ECIKILW  288 (304)
Q Consensus       214 ~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~--~~~~C~---~C~k~F~  288 (304)
                      -+|-+|.++..-++.|+.|.| .|     +|||||+|.+||+.|.++.+|+.||-+|.-.-.  -+|.|+   +|-+-|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyr-tH-----tGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYR-TH-----TGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             cceeeeeecccchhhhhhhhh-cc-----cCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccc
Confidence            479999999999999999999 88     999999999999999999999999988877641  258999   9999999


Q ss_pred             chhHHHHHHhhccc
Q psy3485         289 SFLSYFIWISVDVN  302 (304)
Q Consensus       289 ~~~~l~~h~~~~~~  302 (304)
                      +.-.|-+|||+|.+
T Consensus       680 n~V~lpQhIriH~~  693 (958)
T KOG1074|consen  680 NAVTLPQHIRIHLG  693 (958)
T ss_pred             ccccccceEEeecC
Confidence            99999999999984


No 5  
>KOG3576|consensus
Probab=99.82  E-value=2.4e-21  Score=150.97  Aligned_cols=118  Identities=23%  Similarity=0.406  Sum_probs=89.4

Q ss_pred             CCccccCCCchHH-HHHHHHHHhhhhccccccCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHH
Q psy3485         149 DDQFFCIHCNGCV-LYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKI  227 (304)
Q Consensus       149 ~~~~~C~~C~~~f-l~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~  227 (304)
                      +..|.|.+|||.| |++=+.+|       ++-|...+.+-|..|||.|.....|.+|+|+|+|.+||+|..|+|.|+.+.
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh-------~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrc  187 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRH-------LKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRC  187 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHH-------hhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhc
Confidence            3458888888888 66666666       667777788888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHhhcCCC-----CCCCCCccccccCCccCCChHHHHHHHHhhcCC
Q psy3485         228 AIYAHMRTTHIMP-----DTSEERRYHCAFCNFTSPTQWAINRHTKYTHMN  273 (304)
Q Consensus       228 ~L~~H~~~~H~~~-----~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~  273 (304)
                      .|..|.+.+|+++     ....++.|+|+.||.+-.....+-.|.+.||.-
T Consensus       188 sleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  188 SLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             cHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            8888887777543     112346677777777777777777777777765


No 6  
>KOG3608|consensus
Probab=99.82  E-value=1.5e-20  Score=158.00  Aligned_cols=166  Identities=23%  Similarity=0.451  Sum_probs=134.5

Q ss_pred             hhhHhHHHHHHhhcCCCCCCCCc-cccCCCchHH-----HHHHHHHH---------hhhhccc------cccCCC--CCC
Q psy3485         129 KQLMAIEEKIKAARHPLFSPDDQ-FFCIHCNGCV-----LYADLLDH---------CKLCLRR------KRKNPM--RRN  185 (304)
Q Consensus       129 ~~~~~~~~~~~~~~~~~~~~~~~-~~C~~C~~~f-----l~~H~~~h---------C~~C~~~------~~~h~~--~~~  185 (304)
                      .+...++.+..+.+|.+.|+++. ..|+.||..|     |.-|+++-         |..|.|+      +..|..  ..-
T Consensus       184 ~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~  263 (467)
T KOG3608|consen  184 MCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNC  263 (467)
T ss_pred             hhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhc
Confidence            34556677788899988888775 7899999999     66676655         8888776      222211  245


Q ss_pred             cccCCCcccccChHHHHHHHHh-hCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCcccccc--CCccCCChHH
Q psy3485         186 FMCFACPYYCRYGSSMAIHLRT-HTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAF--CNFTSPTQWA  262 (304)
Q Consensus       186 ~~C~~C~k~f~~~~~l~~H~~~-H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~--C~k~F~~~~~  262 (304)
                      |.|+.|+.+....++|..|++. |...|||+|+.|++.|.+.+.|.+|.. +|     + +-.|.|..  |..+|++...
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~-~H-----S-~~~y~C~h~~C~~s~r~~~q  336 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ-VH-----S-KTVYQCEHPDCHYSVRTYTQ  336 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH-hc-----c-ccceecCCCCCcHHHHHHHH
Confidence            8999999999999999999885 899999999999999999999999999 88     5 56799988  9999999999


Q ss_pred             HHHHHHhhc-CCCCCCcccCCCcccccchhHHHHHHhhcc
Q psy3485         263 INRHTKYTH-MNTSGPTIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       263 L~~H~r~h~-~~~~~~~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      |++|++-|| |....+|.|..|.+.|.+-.+|-+|.+-.+
T Consensus       337 ~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH  376 (467)
T KOG3608|consen  337 MRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKH  376 (467)
T ss_pred             HHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhh
Confidence            999998888 555567999999999999999999986443


No 7  
>KOG3576|consensus
Probab=99.81  E-value=1.3e-20  Score=146.85  Aligned_cols=117  Identities=19%  Similarity=0.360  Sum_probs=109.1

Q ss_pred             cCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCC
Q psy3485         179 KNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSP  258 (304)
Q Consensus       179 ~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~  258 (304)
                      .-.+...|.|.+|+|.|.....|.+|++.|...++|-|..|||.|.....|++|+| +|     +|.+||+|..|+|+|.
T Consensus       111 sssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~r-th-----tgvrpykc~~c~kaft  184 (267)
T KOG3576|consen  111 SSSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTR-TH-----TGVRPYKCSLCEKAFT  184 (267)
T ss_pred             CCCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhc-cc-----cCccccchhhhhHHHH
Confidence            33456779999999999999999999999999999999999999999999999999 88     9999999999999999


Q ss_pred             ChHHHHHHHHhhcCCC---------CCCcccCCCcccccchhHHHHHHhhcc
Q psy3485         259 TQWAINRHTKYTHMNT---------SGPTIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       259 ~~~~L~~H~r~h~~~~---------~~~~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      .+-+|..|.+..||..         .+.|.|+.||.+-...--++.|+.+|+
T Consensus       185 qrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  185 QRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             hhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcC
Confidence            9999999999999986         246999999999999999999999875


No 8  
>KOG3608|consensus
Probab=99.76  E-value=4.6e-19  Score=149.14  Aligned_cols=140  Identities=16%  Similarity=0.350  Sum_probs=102.0

Q ss_pred             cccCC--CchHH-----HHHHHHHH-------hhhhccc------------cccCCCCCCcccCCCcccccChHHHHHHH
Q psy3485         152 FFCIH--CNGCV-----LYADLLDH-------CKLCLRR------------KRKNPMRRNFMCFACPYYCRYGSSMAIHL  205 (304)
Q Consensus       152 ~~C~~--C~~~f-----l~~H~~~h-------C~~C~~~------------~~~h~~~~~~~C~~C~k~f~~~~~l~~H~  205 (304)
                      +.|..  |.+.|     |++|++.|       |+.|+..            ...-....+|+|.+|-|.|.+..+|..|+
T Consensus       178 ~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv  257 (467)
T KOG3608|consen  178 TMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHV  257 (467)
T ss_pred             eeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHH
Confidence            67764  77777     88888877       7777654            22223345677777777777777777777


Q ss_pred             HhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCC--C
Q psy3485         206 RTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPE--C  283 (304)
Q Consensus       206 ~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~--C  283 (304)
                      ++|-+-  |+|+.|+.+....+.|..||+..|     ...|||+|+.|+++|.+-+.|.+|..+|+..   -|.|+.  |
T Consensus       258 ~rHvn~--ykCplCdmtc~~~ssL~~H~r~rH-----s~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~---~y~C~h~~C  327 (467)
T KOG3608|consen  258 VRHVNC--YKCPLCDMTCSSASSLTTHIRYRH-----SKDKPFKCDECDTRCVRESDLAKHVQVHSKT---VYQCEHPDC  327 (467)
T ss_pred             HHhhhc--ccccccccCCCChHHHHHHHHhhh-----ccCCCccccchhhhhccHHHHHHHHHhcccc---ceecCCCCC
Confidence            777543  777777777777777777777777     7777788887888887778888887777743   577777  7


Q ss_pred             cccccchhHHHHHHhhcc
Q psy3485         284 IKILWSFLSYFIWISVDV  301 (304)
Q Consensus       284 ~k~F~~~~~l~~h~~~~~  301 (304)
                      ..+|.+..+|+.|++-|.
T Consensus       328 ~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  328 HYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             cHHHHHHHHHHHHHHHhc
Confidence            777777777777776544


No 9  
>KOG3623|consensus
Probab=99.71  E-value=2.9e-18  Score=156.13  Aligned_cols=111  Identities=23%  Similarity=0.376  Sum_probs=96.8

Q ss_pred             CcccCCCcccccChHHHHHHHHh-h-CCCCccccccchhhccCHHHHHHHHHhhcCCCCC--------CCCCccccccCC
Q psy3485         185 NFMCFACPYYCRYGSSMAIHLRT-H-TKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDT--------SEERRYHCAFCN  254 (304)
Q Consensus       185 ~~~C~~C~k~f~~~~~l~~H~~~-H-~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~--------~~~~~~~C~~C~  254 (304)
                      ...|++|++.+.+...|+.|++. | .++..|.|..|..+|..+..|.+||. .|...++        .+-|+|+|+.||
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~-~hkpg~dqa~sltqsa~lRKFKCtECg  288 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQ-LHKPGGDQAISLTQSALLRKFKCTECG  288 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHH-hhcCCCcccccccchhhhccccccccc
Confidence            36899999999999999999764 5 46677999999999999999999999 7753322        235889999999


Q ss_pred             ccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHh
Q psy3485         255 FTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWIS  298 (304)
Q Consensus       255 k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~  298 (304)
                      |.|+.+..|+.|.|+|.|++  ||.|+-|+|.|+...++-.||+
T Consensus       289 KAFKfKHHLKEHlRIHSGEK--PfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  289 KAFKFKHHLKEHLRIHSGEK--PFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhhHHHHHhhheeecCCC--CcCCcccccccccCCccccccc
Confidence            99999999999999999997  9999999999999999999986


No 10 
>KOG3623|consensus
Probab=99.68  E-value=7.3e-18  Score=153.58  Aligned_cols=80  Identities=24%  Similarity=0.431  Sum_probs=65.3

Q ss_pred             CCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChH
Q psy3485         182 MRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQW  261 (304)
Q Consensus       182 ~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~  261 (304)
                      ...+|.|++|+|.|...++|.+|...|+|.|||+|.+|.|.|+.+..|..|+| .|     .|||||+|+.|+|+|.+..
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkR-LH-----SGEKPfQCdKClKRFSHSG  964 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKR-LH-----SGEKPFQCDKCLKRFSHSG  964 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhh-hc-----cCCCcchhhhhhhhccccc
Confidence            35678888888888888888888888888888888888888888888888888 77     8888888888888888888


Q ss_pred             HHHHHH
Q psy3485         262 AINRHT  267 (304)
Q Consensus       262 ~L~~H~  267 (304)
                      ++.+||
T Consensus       965 SYSQHM  970 (1007)
T KOG3623|consen  965 SYSQHM  970 (1007)
T ss_pred             chHhhh
Confidence            888887


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.56  E-value=1.1e-14  Score=133.73  Aligned_cols=133  Identities=17%  Similarity=0.285  Sum_probs=110.3

Q ss_pred             ccccCCCchHHHHHHHHHH----------hhh--hccccccCCCCCCcccCCCcccccChHHHHHHHHhhCCCCcccccc
Q psy3485         151 QFFCIHCNGCVLYADLLDH----------CKL--CLRRKRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEM  218 (304)
Q Consensus       151 ~~~C~~C~~~fl~~H~~~h----------C~~--C~~~~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~  218 (304)
                      .-.|..|......+++..|          |+.  |+.......-+..+.|+.|++.|. ...|..|++.|+  +++.|+ 
T Consensus       407 ~V~C~NC~~~i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-  482 (567)
T PLN03086        407 TVECRNCKHYIPSRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-  482 (567)
T ss_pred             eEECCCCCCccchhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-
Confidence            3689999998855555555          653  888877777788899999999996 678999999975  889999 


Q ss_pred             chhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCC----------ChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         219 CNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSP----------TQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       219 C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~----------~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      ||+.| .+..|..|+. .|     ...+++.|..|++.|.          ..+.|..|..+. |..  ++.|..||+.|.
T Consensus       483 Cg~~~-~R~~L~~H~~-th-----Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~r--t~~C~~Cgk~Vr  552 (567)
T PLN03086        483 CGVVL-EKEQMVQHQA-ST-----CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSR--TAPCDSCGRSVM  552 (567)
T ss_pred             CCCCc-chhHHHhhhh-cc-----CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCc--ceEccccCCeee
Confidence            99755 6799999998 88     9999999999999995          246899999986 664  999999999998


Q ss_pred             chhHHHHHHh
Q psy3485         289 SFLSYFIWIS  298 (304)
Q Consensus       289 ~~~~l~~h~~  298 (304)
                      .+. |..|+.
T Consensus       553 lrd-m~~H~~  561 (567)
T PLN03086        553 LKE-MDIHQI  561 (567)
T ss_pred             ehh-HHHHHH
Confidence            775 555543


No 12 
>PHA00733 hypothetical protein
Probab=99.43  E-value=1.9e-13  Score=103.18  Aligned_cols=86  Identities=14%  Similarity=0.234  Sum_probs=59.7

Q ss_pred             CCCccccccchhhccCHHHHHHH--HHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         210 KEKPFACEMCNYRAASKIAIYAH--MRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       210 ~~~~~~C~~C~k~F~~~~~L~~H--~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      ..+++.|.+|.+.|.+...|..|  ++ .|.  ...+.+||.|+.||+.|.+.++|..|++.|  ..  +|.|+.|++.|
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~-~~~--~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~--~~~C~~CgK~F  109 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLY-KLL--TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EH--SKVCPVCGKEF  109 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHH-hhc--ccCCCCCccCCCCCCcCCCHHHHHHHHhcC--Cc--CccCCCCCCcc
Confidence            35667777777777777666665  22 110  114577888888888888888888888776  22  68888888888


Q ss_pred             cchhHHHHHHhhccc
Q psy3485         288 WSFLSYFIWISVDVN  302 (304)
Q Consensus       288 ~~~~~l~~h~~~~~~  302 (304)
                      ...++|..|+.-.+|
T Consensus       110 ~~~~sL~~H~~~~h~  124 (128)
T PHA00733        110 RNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCHHHHHHHHHHhcC
Confidence            888888888775544


No 13 
>PHA00733 hypothetical protein
Probab=99.31  E-value=2.2e-12  Score=97.44  Aligned_cols=85  Identities=14%  Similarity=0.230  Sum_probs=70.6

Q ss_pred             CCCCCcccCCCcccccChHHHHHH--HHh---hCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCc
Q psy3485         181 PMRRNFMCFACPYYCRYGSSMAIH--LRT---HTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNF  255 (304)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~l~~H--~~~---H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k  255 (304)
                      ...+++.|.+|.+.|.....|..|  ++.   +.+.+||.|+.||+.|.+.+.|..|++ .|     +  .+|.|..|++
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r-~h-----~--~~~~C~~CgK  107 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIR-YT-----E--HSKVCPVCGK  107 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHh-cC-----C--cCccCCCCCC
Confidence            345778999999999888777776  332   445889999999999999999999999 55     3  4799999999


Q ss_pred             cCCChHHHHHHHHhhcCC
Q psy3485         256 TSPTQWAINRHTKYTHMN  273 (304)
Q Consensus       256 ~F~~~~~L~~H~r~h~~~  273 (304)
                      +|.....|.+|++..|+.
T Consensus       108 ~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        108 EFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             ccCCHHHHHHHHHHhcCc
Confidence            999999999999988874


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.29  E-value=1.1e-12  Score=81.72  Aligned_cols=44  Identities=18%  Similarity=0.314  Sum_probs=38.8

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHH
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYF  294 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~  294 (304)
                      .|.|+.||+.|...++|..|||+|+  +  +|+|..|++.|+.++.|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k--~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--T--NLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--C--cccCCcccceecccceeE
Confidence            4899999999999999999999988  3  899999999999888775


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.21  E-value=2.4e-11  Score=111.90  Aligned_cols=102  Identities=15%  Similarity=0.279  Sum_probs=79.6

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhcc-------
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAA-------  224 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~-------  224 (304)
                      +.|+.|++.|....+..|       +..|.  .++.|+ ||+.| .+..|..|+.+|.+.+++.|..|++.|.       
T Consensus       454 ~~C~~Cgk~f~~s~LekH-------~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d  522 (567)
T PLN03086        454 VHCEKCGQAFQQGEMEKH-------MKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMD  522 (567)
T ss_pred             ccCCCCCCccchHHHHHH-------HHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccc
Confidence            567777777722222232       23332  789999 99765 6789999999999999999999999995       


Q ss_pred             ---CHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcC
Q psy3485         225 ---SKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHM  272 (304)
Q Consensus       225 ---~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~  272 (304)
                         ..+.|..|.. .      .|.+++.|..||+.|..+ .|..|+...|.
T Consensus       523 ~~d~~s~Lt~HE~-~------CG~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        523 VRDRLRGMSEHES-I------CGSRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             hhhhhhhHHHHHH-h------cCCcceEccccCCeeeeh-hHHHHHHHhhc
Confidence               2468999998 6      588999999999998776 78889877665


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.14  E-value=1.6e-11  Score=76.57  Aligned_cols=40  Identities=23%  Similarity=0.316  Sum_probs=19.0

Q ss_pred             cccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHH
Q psy3485         186 FMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKI  227 (304)
Q Consensus       186 ~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~  227 (304)
                      |.|+.||+.|+...+|..|+++|+  ++|+|..|++.|...+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s   45 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTG   45 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccc
Confidence            444444444444444444444444  3444444444444433


No 17 
>KOG3993|consensus
Probab=99.00  E-value=1.2e-10  Score=101.09  Aligned_cols=135  Identities=13%  Similarity=0.160  Sum_probs=101.2

Q ss_pred             cccCCCchHH-----HHHHHHHHhhhhccccccCCCCCCcccCCCcccccChHHHHHHHHhhC--------CC-------
Q psy3485         152 FFCIHCNGCV-----LYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHT--------KE-------  211 (304)
Q Consensus       152 ~~C~~C~~~f-----l~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~--------~~-------  211 (304)
                      |.|..|...|     |.+|.=-        .-+|   .-|+|+.|+|.|+-.++|..|.|.|.        +.       
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~--------RIV~---vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~  336 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCP--------RIVH---VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAV  336 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCC--------eeEE---eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhh
Confidence            9999999888     6666421        2233   34999999999999999999999983        11       


Q ss_pred             ------------------CccccccchhhccCHHHHHHHHHhhcCCCCC-------------------------------
Q psy3485         212 ------------------KPFACEMCNYRAASKIAIYAHMRTTHIMPDT-------------------------------  242 (304)
Q Consensus       212 ------------------~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~-------------------------------  242 (304)
                                        ..|.|.+|+|.|+....|+.|+.++|..+..                               
T Consensus       337 ~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~  416 (500)
T KOG3993|consen  337 ETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDS  416 (500)
T ss_pred             hhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccc
Confidence                              2389999999999999999999866642100                               


Q ss_pred             -C--------CCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHhh
Q psy3485         243 -S--------EERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWISV  299 (304)
Q Consensus       243 -~--------~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~~  299 (304)
                       .        ..-...|++||-.|.++..=-.|.|.-+-.+  -|.|.+|.-+|.+...|-+||..
T Consensus       417 ~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q--~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  417 HGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQ--GFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             cccceeeeeccccccCCCCCCCCcccCCCCCccccccchhh--ccccccchHhhhcCcchHhHhhh
Confidence             0        0122456777777777766666665555554  69999999999999999999975


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=1e-09  Score=58.60  Aligned_cols=26  Identities=23%  Similarity=0.318  Sum_probs=17.1

Q ss_pred             HHHHHHHhhcCCCCCCcccCCCcccccc
Q psy3485         262 AINRHTKYTHMNTSGPTIQPECIKILWS  289 (304)
Q Consensus       262 ~L~~H~r~h~~~~~~~~~C~~C~k~F~~  289 (304)
                      +|++|+++|++++  ||.|++|++.|++
T Consensus         1 ~l~~H~~~H~~~k--~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEK--PYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSS--SEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCC--CCCCCCCcCeeCc
Confidence            4666777766665  6777777776653


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.86  E-value=1.3e-09  Score=58.21  Aligned_cols=24  Identities=42%  Similarity=0.854  Sum_probs=11.2

Q ss_pred             HHHHHHhhCCCCccccccchhhcc
Q psy3485         201 MAIHLRTHTKEKPFACEMCNYRAA  224 (304)
Q Consensus       201 l~~H~~~H~~~~~~~C~~C~k~F~  224 (304)
                      |..|+++|+|++||+|++|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            444444444444444444444443


No 20 
>PHA00732 hypothetical protein
Probab=98.83  E-value=2.6e-09  Score=73.20  Aligned_cols=50  Identities=24%  Similarity=0.499  Sum_probs=35.0

Q ss_pred             ccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCC
Q psy3485         213 PFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMN  273 (304)
Q Consensus       213 ~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~  273 (304)
                      ||+|..||+.|.+...|..|++.+|     .   ++.|+.||++|.   .|..|.+++.+-
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H-----~---~~~C~~CgKsF~---~l~~H~~~~~~~   50 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNH-----T---LTKCPVCNKSYR---RLNQHFYSQYDI   50 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhccc-----C---CCccCCCCCEeC---ChhhhhcccCCc
Confidence            4777888888888888888877445     3   356788888777   467777665553


No 21 
>PHA00616 hypothetical protein
Probab=98.71  E-value=5.9e-09  Score=61.86  Aligned_cols=39  Identities=13%  Similarity=0.109  Sum_probs=30.2

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      ||+|..||+.|..+++|+.|++.||+..  ++.|++=-..|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~--~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQN--KLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCC--ccceeEEEEEE
Confidence            5788888888888888888888888886  88777644333


No 22 
>PHA00732 hypothetical protein
Probab=98.71  E-value=9e-09  Score=70.55  Aligned_cols=36  Identities=28%  Similarity=0.478  Sum_probs=17.4

Q ss_pred             cccCCCcccccChHHHHHHHHh-hCCCCccccccchhhcc
Q psy3485         186 FMCFACPYYCRYGSSMAIHLRT-HTKEKPFACEMCNYRAA  224 (304)
Q Consensus       186 ~~C~~C~k~f~~~~~l~~H~~~-H~~~~~~~C~~C~k~F~  224 (304)
                      |.|+.|++.|.+..+|..|++. |.+   +.|+.||+.|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC
Confidence            4455555555555555555442 332   34555555554


No 23 
>KOG3993|consensus
Probab=98.67  E-value=3.7e-09  Score=91.93  Aligned_cols=88  Identities=17%  Similarity=0.319  Sum_probs=71.1

Q ss_pred             CCcccCCCcccccChHHHHHHHH--h-hCCCCccccccchhhccCHHHHHHHHHhhcCCCCC------------------
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLR--T-HTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDT------------------  242 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~--~-H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~------------------  242 (304)
                      .-|.|..|--.|-....|.+|.-  + |-   -|+|..|+|.|+-..+|-.|.|||-.-+..                  
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~v---EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~  342 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHV---EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEV  342 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEe---eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhh
Confidence            45999999999999999999943  3 43   399999999999999999999954321100                  


Q ss_pred             ---------CCCCccccccCCccCCChHHHHHHHHhhcCCC
Q psy3485         243 ---------SEERRYHCAFCNFTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       243 ---------~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~  274 (304)
                               .....|.|.+|+|.|++...|+.|+.+|+...
T Consensus       343 ~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  343 QEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             hhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                     12246999999999999999999999988754


No 24 
>PHA00616 hypothetical protein
Probab=98.61  E-value=1.8e-08  Score=59.77  Aligned_cols=35  Identities=20%  Similarity=0.334  Sum_probs=23.8

Q ss_pred             CcccCCCcccccChHHHHHHHHhhCCCCccccccc
Q psy3485         185 NFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMC  219 (304)
Q Consensus       185 ~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C  219 (304)
                      ||+|..||+.|..++.|..|++.|+|+++++|+.-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEE
Confidence            46677777777777777777777777777666643


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.56  E-value=1.2e-07  Score=60.40  Aligned_cols=51  Identities=25%  Similarity=0.496  Sum_probs=22.1

Q ss_pred             cccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhc
Q psy3485         214 FACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTH  271 (304)
Q Consensus       214 ~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~  271 (304)
                      |.|++|++ ..+...|..|....|.    .+.+.+.|++|...+.  .+|.+|++.+|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~----~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHR----SESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCc----CCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            44555555 2333445555444441    1123345555554333  24455544444


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.47  E-value=2.6e-07  Score=58.87  Aligned_cols=52  Identities=13%  Similarity=0.293  Sum_probs=35.6

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHhhcc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      .|.|++|++ ..+..+|..|....|....+.+.||+|...+.  .+|+.||..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            377888888 45566788886665555445678888887654  37788877665


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.32  E-value=2.8e-07  Score=47.67  Aligned_cols=22  Identities=23%  Similarity=0.650  Sum_probs=10.7

Q ss_pred             cccccCCccCCChHHHHHHHHh
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      |.|+.|++.|.++.+|++|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3444455555555555544444


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.28  E-value=5e-07  Score=46.71  Aligned_cols=23  Identities=17%  Similarity=-0.034  Sum_probs=15.9

Q ss_pred             cccCCCcccccchhHHHHHHhhc
Q psy3485         278 TIQPECIKILWSFLSYFIWISVD  300 (304)
Q Consensus       278 ~~C~~C~k~F~~~~~l~~h~~~~  300 (304)
                      |.|+.|++.|+++++|..||++|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777654


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.13  E-value=1.3e-06  Score=63.33  Aligned_cols=75  Identities=15%  Similarity=0.280  Sum_probs=21.4

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHH
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRH  266 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H  266 (304)
                      +|..|+..|.+...|..|+...++-.   .. ....+.....+..+++ .      .-...+.|..|++.|.+...|..|
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~---~~-~~~~l~~~~~~~~~~~-~------~~~~~~~C~~C~~~f~s~~~l~~H   69 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD---IP-DQKYLVDPNRLLNYLR-K------KVKESFRCPYCNKTFRSREALQEH   69 (100)
T ss_dssp             -----------------------------------------------------------SSEEBSSSS-EESSHHHHHHH
T ss_pred             Cccccccccccccccccccccccccc---cc-cccccccccccccccc-c------ccCCCCCCCccCCCCcCHHHHHHH
Confidence            47888888888888888886633321   11 2222334444444544 1      112368999999999999999999


Q ss_pred             HHhhcC
Q psy3485         267 TKYTHM  272 (304)
Q Consensus       267 ~r~h~~  272 (304)
                      |+.++.
T Consensus        70 m~~~~H   75 (100)
T PF12756_consen   70 MRSKHH   75 (100)
T ss_dssp             HHHTTT
T ss_pred             HcCccC
Confidence            987543


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.10  E-value=2.1e-06  Score=44.68  Aligned_cols=24  Identities=17%  Similarity=0.580  Sum_probs=11.6

Q ss_pred             cccccCCccCCChHHHHHHHHhhc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTH  271 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~  271 (304)
                      |.|++|++.|.+...|+.|+++||
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            345555555555555555555543


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.02  E-value=1.3e-06  Score=73.56  Aligned_cols=59  Identities=22%  Similarity=0.521  Sum_probs=43.3

Q ss_pred             CCCcccccc--chhhccCHHHHHHHHHhhcCCC--------CC-----CCCCccccccCCccCCChHHHHHHHH
Q psy3485         210 KEKPFACEM--CNYRAASKIAIYAHMRTTHIMP--------DT-----SEERRYHCAFCNFTSPTQWAINRHTK  268 (304)
Q Consensus       210 ~~~~~~C~~--C~k~F~~~~~L~~H~~~~H~~~--------~~-----~~~~~~~C~~C~k~F~~~~~L~~H~r  268 (304)
                      ++|||+|++  |.|.|++...|+.||+--|--+        .+     ...|||.|++|+|+|+.-..|+.|+.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            358899987  8899999999999988545211        11     12388888888888888888888853


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.98  E-value=3.3e-06  Score=45.44  Aligned_cols=24  Identities=21%  Similarity=0.408  Sum_probs=12.0

Q ss_pred             cccccCCccCCChHHHHHHHHhhc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTH  271 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~  271 (304)
                      |.|..|++.|.+..+|..|++.|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            445555555555555555554443


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.98  E-value=4.2e-06  Score=60.59  Aligned_cols=73  Identities=14%  Similarity=0.052  Sum_probs=20.2

Q ss_pred             ccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHH
Q psy3485         215 ACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYF  294 (304)
Q Consensus       215 ~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~  294 (304)
                      +|..|+..|.+...|..||...|.     -    .-. ....+.....|..+.+.-...   .+.|.+|++.|.+...|.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~-----~----~~~-~~~~l~~~~~~~~~~~~~~~~---~~~C~~C~~~f~s~~~l~   67 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHG-----F----DIP-DQKYLVDPNRLLNYLRKKVKE---SFRCPYCNKTFRSREALQ   67 (100)
T ss_dssp             ----------------------------------------------------------S---SEEBSSSS-EESSHHHHH
T ss_pred             Cccccccccccccccccccccccc-----c----ccc-cccccccccccccccccccCC---CCCCCccCCCCcCHHHHH
Confidence            488899999999999999987882     1    111 222333555555565543333   589999999999999999


Q ss_pred             HHHhhc
Q psy3485         295 IWISVD  300 (304)
Q Consensus       295 ~h~~~~  300 (304)
                      .|++.+
T Consensus        68 ~Hm~~~   73 (100)
T PF12756_consen   68 EHMRSK   73 (100)
T ss_dssp             HHHHHT
T ss_pred             HHHcCc
Confidence            999854


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.93  E-value=5.6e-06  Score=42.99  Aligned_cols=24  Identities=17%  Similarity=-0.011  Sum_probs=20.5

Q ss_pred             cccCCCcccccchhHHHHHHhhcc
Q psy3485         278 TIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       278 ~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      |.|++|++.|.++..|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999874


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.93  E-value=2.2e-06  Score=72.34  Aligned_cols=52  Identities=23%  Similarity=0.561  Sum_probs=45.9

Q ss_pred             CCCcccCC--CcccccChHHHHHHHHh-hC------------------CCCccccccchhhccCHHHHHHHHH
Q psy3485         183 RRNFMCFA--CPYYCRYGSSMAIHLRT-HT------------------KEKPFACEMCNYRAASKIAIYAHMR  234 (304)
Q Consensus       183 ~~~~~C~~--C~k~f~~~~~l~~H~~~-H~------------------~~~~~~C~~C~k~F~~~~~L~~H~~  234 (304)
                      ++||+|++  |+|.|.....|+.|+.- |.                  ..|||+|++|+|.|++...|+.|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            59999987  99999999999999765 51                  3489999999999999999999987


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.89  E-value=6.2e-06  Score=44.34  Aligned_cols=25  Identities=20%  Similarity=0.070  Sum_probs=23.6

Q ss_pred             CcccCCCcccccchhHHHHHHhhcc
Q psy3485         277 PTIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      +|.|..|++.|.+..+|+.|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999999885


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.56  E-value=5.4e-05  Score=39.87  Aligned_cols=23  Identities=22%  Similarity=0.148  Sum_probs=12.5

Q ss_pred             cccCCCcccccchhHHHHHHhhc
Q psy3485         278 TIQPECIKILWSFLSYFIWISVD  300 (304)
Q Consensus       278 ~~C~~C~k~F~~~~~l~~h~~~~  300 (304)
                      |.|+.|++.|.+..+|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            34555555555555555555544


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.49  E-value=0.0001  Score=38.71  Aligned_cols=24  Identities=21%  Similarity=0.455  Sum_probs=15.2

Q ss_pred             cccccCCccCCChHHHHHHHHhhc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTH  271 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~  271 (304)
                      |.|..|+++|.+...|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            456666666666666666666543


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.45  E-value=6.1e-05  Score=45.76  Aligned_cols=32  Identities=19%  Similarity=0.432  Sum_probs=20.4

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCC
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~  274 (304)
                      ..+.|-.|++|+..+.+..+|++|+..+|+.+
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            55667778888888888888888887777764


No 40 
>PRK04860 hypothetical protein; Provisional
Probab=97.16  E-value=0.00024  Score=55.77  Aligned_cols=38  Identities=21%  Similarity=0.334  Sum_probs=31.5

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccch
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSF  290 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~  290 (304)
                      +|.|. |++   ....+++|.++|++++  +|.|..|++.|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~--~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEA--VYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCc--cEECCCCCceeEEe
Confidence            68898 887   7778899999999886  89999999888643


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.11  E-value=0.00027  Score=36.99  Aligned_cols=22  Identities=18%  Similarity=0.561  Sum_probs=11.0

Q ss_pred             cccccCCccCCChHHHHHHHHh
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      |.|.+|++.|.+...|+.|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3455555555555555555443


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.03  E-value=0.00053  Score=35.51  Aligned_cols=23  Identities=30%  Similarity=0.854  Sum_probs=10.7

Q ss_pred             cccccCCccCCChHHHHHHHHhhc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTH  271 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~  271 (304)
                      |.|+.|+.+.. ...|.+|++.||
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            34555555544 555555555544


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.89  E-value=0.00055  Score=53.74  Aligned_cols=38  Identities=26%  Similarity=0.599  Sum_probs=24.6

Q ss_pred             ccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCCh
Q psy3485         213 PFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQ  260 (304)
Q Consensus       213 ~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~  260 (304)
                      +|.|. |++   ....+.+|++ .|     +++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~r-i~-----~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNR-VV-----RGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHH-Hh-----cCCccEECCCCCceeEEe
Confidence            46776 765   4555666777 55     677777777777766543


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.88  E-value=0.00053  Score=35.87  Aligned_cols=23  Identities=17%  Similarity=-0.087  Sum_probs=21.1

Q ss_pred             cccCCCcccccchhHHHHHHhhc
Q psy3485         278 TIQPECIKILWSFLSYFIWISVD  300 (304)
Q Consensus       278 ~~C~~C~k~F~~~~~l~~h~~~~  300 (304)
                      |.|.+|++.|++...|..|++-+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999854


No 45 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.84  E-value=0.0014  Score=39.94  Aligned_cols=30  Identities=20%  Similarity=0.480  Sum_probs=15.9

Q ss_pred             hCCCCccccccchhhccCHHHHHHHHHhhc
Q psy3485         208 HTKEKPFACEMCNYRAASKIAIYAHMRTTH  237 (304)
Q Consensus       208 H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H  237 (304)
                      +..+.|-+|++|+..+....+|++|+.+.|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHh
Confidence            344566666666666666666666666565


No 46 
>KOG2231|consensus
Probab=96.84  E-value=0.0032  Score=59.77  Aligned_cols=89  Identities=18%  Similarity=0.336  Sum_probs=57.4

Q ss_pred             cccChHHHHHHHHh-hCCCCc----cccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCC------ccCCChHH
Q psy3485         194 YCRYGSSMAIHLRT-HTKEKP----FACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCN------FTSPTQWA  262 (304)
Q Consensus       194 ~f~~~~~l~~H~~~-H~~~~~----~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~------k~F~~~~~  262 (304)
                      ...++..|+.|+.. -.+++.    -.|..|...|.....|.+|++..|          |.|..|.      .-|..-..
T Consensus       158 k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----------~~chfC~~~~~~neyy~~~~d  227 (669)
T KOG2231|consen  158 KLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----------EFCHFCDYKTGQNEYYNDYDD  227 (669)
T ss_pred             ehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce----------eheeecCcccccchhcccchH
Confidence            34456677777664 223333    358888888888888888888666          6777774      34777778


Q ss_pred             HHHHHHhhcCCCCCCcccC--CCccc-ccchhHHHHHHh
Q psy3485         263 INRHTKYTHMNTSGPTIQP--ECIKI-LWSFLSYFIWIS  298 (304)
Q Consensus       263 L~~H~r~h~~~~~~~~~C~--~C~k~-F~~~~~l~~h~~  298 (304)
                      |..|.|.+|-      .|+  .|--. |..--.+.++++
T Consensus       228 Le~HfR~~Hf------lCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  228 LEEHFRKGHF------LCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             HHHHhhhcCc------cccccccccceeeehhHHHHHHH
Confidence            8888877664      366  45433 333335555555


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.73  E-value=0.00041  Score=37.11  Aligned_cols=22  Identities=18%  Similarity=0.442  Sum_probs=13.0

Q ss_pred             cccccCCccCCChHHHHHHHHh
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666666543


No 48 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.62  E-value=0.00026  Score=65.05  Aligned_cols=117  Identities=19%  Similarity=0.259  Sum_probs=71.6

Q ss_pred             CcccCCCcccccChHHHHHHHH--hhCCC--Cccccc--cchhhccCHHHHHHHHHhhcCCC------------------
Q psy3485         185 NFMCFACPYYCRYGSSMAIHLR--THTKE--KPFACE--MCNYRAASKIAIYAHMRTTHIMP------------------  240 (304)
Q Consensus       185 ~~~C~~C~k~f~~~~~l~~H~~--~H~~~--~~~~C~--~C~k~F~~~~~L~~H~~~~H~~~------------------  240 (304)
                      ++.|..|...|+....|..|.+  .|.++  +++.|.  .|++.|.....+..|.. .|...                  
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHIL-LHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcc-cccCCCccccccccCcccccccc
Confidence            4566666666666666666666  56666  666666  56666666666666666 33100                  


Q ss_pred             ------------CCCCCCcccccc--CCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhHHHHHHhhccc
Q psy3485         241 ------------DTSEERRYHCAF--CNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLSYFIWISVDVN  302 (304)
Q Consensus       241 ------------~~~~~~~~~C~~--C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~l~~h~~~~~~  302 (304)
                                  .....+.+.|..  |-..+.....+..|...|-......+.+..|.+.|.....+..|++.|..
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  443 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTN  443 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCccccccccccccc
Confidence                        001223344432  66666666666667666666554457778888888888888888887765


No 49 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.56  E-value=0.0016  Score=33.62  Aligned_cols=24  Identities=8%  Similarity=-0.133  Sum_probs=19.7

Q ss_pred             cccCCCcccccchhHHHHHHhhccc
Q psy3485         278 TIQPECIKILWSFLSYFIWISVDVN  302 (304)
Q Consensus       278 ~~C~~C~k~F~~~~~l~~h~~~~~~  302 (304)
                      |+|+.|+.... ++.|..|+++|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            78999999998 9999999999764


No 50 
>KOG2482|consensus
Probab=96.47  E-value=0.01  Score=51.11  Aligned_cols=23  Identities=22%  Similarity=0.519  Sum_probs=19.0

Q ss_pred             CcccCCCcccccChHHHHHHHHh
Q psy3485         185 NFMCFACPYYCRYGSSMAIHLRT  207 (304)
Q Consensus       185 ~~~C~~C~k~f~~~~~l~~H~~~  207 (304)
                      .++|-.|-+.|..+..|+.|||.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            37888888888888888888875


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.45  E-value=0.0011  Score=35.38  Aligned_cols=23  Identities=13%  Similarity=-0.087  Sum_probs=20.7

Q ss_pred             CcccCCCcccccchhHHHHHHhh
Q psy3485         277 PTIQPECIKILWSFLSYFIWISV  299 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~~  299 (304)
                      .|.|..|++.|.+...|..|++.
T Consensus         1 q~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    1 QFYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             -CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCCcccCCCCcCCHHHHHHHHcc
Confidence            38899999999999999999874


No 52 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.02  E-value=0.026  Score=48.79  Aligned_cols=74  Identities=27%  Similarity=0.551  Sum_probs=51.7

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCccccccchh-------hccCHHHHHHHHHhhcCCCCCCCCCcccccc--CC---
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNY-------RAASKIAIYAHMRTTHIMPDTSEERRYHCAF--CN---  254 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k-------~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~--C~---  254 (304)
                      .|..|...|..-..|..|+|.-+    -+|-+|++       .|.+-..|..|-+..|          |.|..  |-   
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H----E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----------y~ct~qtc~~~k  287 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH----EACHICDMVGPIRYQYFKSYEDLEAHFRNAH----------YCCTFQTCRVGK  287 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh----hhhhhhhccCccchhhhhCHHHHHHHhhcCc----------eEEEEEEEecCc
Confidence            68888888888888888877632    24555554       3777777888887555          66754  32   


Q ss_pred             -ccCCChHHHHHHHHhhcCCC
Q psy3485         255 -FTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       255 -k~F~~~~~L~~H~r~h~~~~  274 (304)
                       ..|+....|..|....|++.
T Consensus       288 ~~vf~~~~el~~h~~~~h~~~  308 (493)
T COG5236         288 CYVFPYHTELLEHLTRFHKVN  308 (493)
T ss_pred             EEEeccHHHHHHHHHHHhhcc
Confidence             24788888888887777765


No 53 
>KOG1146|consensus
Probab=96.01  E-value=0.0029  Score=63.63  Aligned_cols=111  Identities=16%  Similarity=0.180  Sum_probs=81.1

Q ss_pred             cCCCcccccChHHHHHHHHh-hCCCCccccccchhhccCHHHHHHHHHhhcCCC-------------------CCCCCCc
Q psy3485         188 CFACPYYCRYGSSMAIHLRT-HTKEKPFACEMCNYRAASKIAIYAHMRTTHIMP-------------------DTSEERR  247 (304)
Q Consensus       188 C~~C~k~f~~~~~l~~H~~~-H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~-------------------~~~~~~~  247 (304)
                      |.-|+..+.++..+..|+.. |+-.+.|+|+.|+..|+....|-.|||..|...                   -..+.++
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            34455666666667777654 666688888888888888888888888756422                   1134588


Q ss_pred             cccccCCccCCChHHHHHHHHh--hcCC--------------------------------------C-CCCcccCCCccc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKY--THMN--------------------------------------T-SGPTIQPECIKI  286 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~--h~~~--------------------------------------~-~~~~~C~~C~k~  286 (304)
                      |.|..|..+|..+.+|..|+..  |-.+                                      + .+.+.|..|+..
T Consensus       519 ~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~ye  598 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYE  598 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcch
Confidence            9999999999999999999853  1111                                      0 135899999998


Q ss_pred             ccchhHHHHHHh
Q psy3485         287 LWSFLSYFIWIS  298 (304)
Q Consensus       287 F~~~~~l~~h~~  298 (304)
                      -+-..+|.+|+.
T Consensus       599 tniarnlrihmt  610 (1406)
T KOG1146|consen  599 TNIARNLRIHMT  610 (1406)
T ss_pred             hhhhhccccccc
Confidence            888888888874


No 54 
>KOG2231|consensus
Probab=95.68  E-value=0.028  Score=53.61  Aligned_cols=105  Identities=15%  Similarity=0.205  Sum_probs=73.6

Q ss_pred             ccCCCcccccChHHHHHHHHh-hCCCCcccccc----------chhhccCHHHHHHHHHhhcCCCCCCCCCc-cccccCC
Q psy3485         187 MCFACPYYCRYGSSMAIHLRT-HTKEKPFACEM----------CNYRAASKIAIYAHMRTTHIMPDTSEERR-YHCAFCN  254 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~-H~~~~~~~C~~----------C~k~F~~~~~L~~H~~~~H~~~~~~~~~~-~~C~~C~  254 (304)
                      .|..| -.|.+...|..|++. |..   +.|..          +.|.| +...|+.|+. .- .+.....+- -.|..|.
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Y-t~~el~~h~~-~g-d~d~~s~rGhp~C~~C~  189 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLY-TRAELNLHLM-FG-DPDDESCRGHPLCKFCH  189 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehe-hHHHHHHHHh-cC-CCccccccCCccchhhh
Confidence            67888 888899999999965 643   33333          33444 4566778877 32 111122233 5899999


Q ss_pred             ccCCChHHHHHHHHhhcCCCCCCccc---CCCcccccchhHHHHHHhhcc
Q psy3485         255 FTSPTQWAINRHTKYTHMNTSGPTIQ---PECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       255 k~F~~~~~L~~H~r~h~~~~~~~~~C---~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      ..|-....|.+|++.+|..   -+.|   +.++.-|..-..|-+|.+-++
T Consensus       190 ~~fld~~el~rH~~~~h~~---chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  190 ERFLDDDELYRHLRFDHEF---CHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hhhccHHHHHHhhccceeh---eeecCcccccchhcccchHHHHHhhhcC
Confidence            9999999999999998876   4555   334566888889999998654


No 55 
>PF01352 KRAB:  KRAB box;  InterPro: IPR001909 The Krueppel-associated box (KRAB) is a domain of around 75 amino acids that is found in the N-terminal part of about one third of eukaryotic Krueppel-type C2H2 zinc finger proteins (ZFPs) []. It is enriched in charged amino acids and can be divided into subregions A and B, which are predicted to fold into two amphipathic alpha-helices. The KRAB A and B boxes can be separated by variable spacer segments and many KRAB proteins contain only the A box []. The functions currently known for members of the KRAB-containing protein family include transcriptional repression of RNA polymerase I, II, and III promoters, binding and splicing of RNA, and control of nucleolus function. The KRAB domain functions as a transcriptional repressor when tethered to the template DNA by a DNA-binding domain. A sequence of 45 amino acids in the KRAB A subdomain has been shown to be necessary and sufficient for transcriptional repression. The B box does not repress by itself but does potentiate the repression exerted by the KRAB A subdomain [, ]. Gene silencing requires the binding of the KRAB domain to the RING-B box-coiled coil (RBCC) domain of the KAP-1/TIF1-beta corepressor. As KAP-1 binds to the heterochromatin proteins HP1, it has been proposed that the KRAB-ZFP-bound target gene could be silenced following recruitment to heterochromatin [, ]. KRAB-ZFPs probably constitute the single largest class of transcription factors within the human genome []. Although the function of KRAB-ZFPs is largely unknown, they appear to play important roles during cell differentiation and development. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B.; GO: 0003676 nucleic acid binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1V65_A.
Probab=95.66  E-value=0.0063  Score=35.98  Aligned_cols=38  Identities=11%  Similarity=0.176  Sum_probs=25.0

Q ss_pred             ccCCchHHHHHHHHHHHhhhhhhhhhhhhhhhhhcccc
Q psy3485          21 KKVNYPIIVARKMWTKLKKNHQNRNQKKMKSKTAKYWT   58 (304)
Q Consensus        21 ~~~~~p~~iC~~C~~~l~~f~~~~~~~~~~~~~~~~~~   58 (304)
                      .+.|++..|.++.|..|+..+++++.++++++..+..+
T Consensus         2 tf~Dvav~fs~eEW~~L~~~Qk~ly~dvm~Eny~~l~s   39 (41)
T PF01352_consen    2 TFEDVAVYFSQEEWELLDPAQKNLYRDVMLENYRNLVS   39 (41)
T ss_dssp             -----TT---HHHHHTS-HHHHHHHHHHHHHTTTS---
T ss_pred             eEEEEEEEcChhhcccccceecccchhHHHHhhcccEe
Confidence            46789999999999999999999999999998887654


No 56 
>KOG1146|consensus
Probab=95.65  E-value=0.0041  Score=62.58  Aligned_cols=80  Identities=15%  Similarity=0.120  Sum_probs=68.0

Q ss_pred             ccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCC--------------------
Q psy3485         215 ACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNT--------------------  274 (304)
Q Consensus       215 ~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~--------------------  274 (304)
                      .|.-|+..|..+..+..|+...|     ...+.|+|+.|+-.|+....|-.|||..|-+-                    
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~-----S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~  512 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLH-----SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVY  512 (1406)
T ss_pred             cccchhhhhhhhcccccceeeee-----cccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccc
Confidence            35567778888888999999888     77899999999999999999999999833221                    


Q ss_pred             ---CCCcccCCCcccccchhHHHHHHhh
Q psy3485         275 ---SGPTIQPECIKILWSFLSYFIWISV  299 (304)
Q Consensus       275 ---~~~~~C~~C~k~F~~~~~l~~h~~~  299 (304)
                         ..+|.|..|..+|..+.+|.+|++-
T Consensus       513 ~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  513 RCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cCCCCcccceeeeeeeecchHHHHHHHH
Confidence               1479999999999999999999874


No 57 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.58  E-value=0.01  Score=30.93  Aligned_cols=20  Identities=10%  Similarity=-0.114  Sum_probs=11.4

Q ss_pred             cccCCCcccccchhHHHHHHh
Q psy3485         278 TIQPECIKILWSFLSYFIWIS  298 (304)
Q Consensus       278 ~~C~~C~k~F~~~~~l~~h~~  298 (304)
                      ..|+.||+.| ..++|-.|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566666666 4555555554


No 58 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.55  E-value=0.0095  Score=33.80  Aligned_cols=22  Identities=9%  Similarity=-0.111  Sum_probs=15.2

Q ss_pred             CcccCCCcccccchhHHHHHHh
Q psy3485         277 PTIQPECIKILWSFLSYFIWIS  298 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~  298 (304)
                      +|.|++|++.|.+..++..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5667777777777777766664


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.33  E-value=0.013  Score=33.27  Aligned_cols=23  Identities=26%  Similarity=0.559  Sum_probs=19.4

Q ss_pred             ccccccCCccCCChHHHHHHHHh
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      +|.|.+|++.|.+..++..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999988888888754


No 60 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.14  E-value=0.019  Score=29.92  Aligned_cols=19  Identities=21%  Similarity=0.487  Sum_probs=11.6

Q ss_pred             ccccCCccCCChHHHHHHHH
Q psy3485         249 HCAFCNFTSPTQWAINRHTK  268 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~r  268 (304)
                      .|+.||++| ....|.+|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            566666666 5556666654


No 61 
>KOG2785|consensus
Probab=94.79  E-value=0.1  Score=45.95  Aligned_cols=116  Identities=15%  Similarity=0.055  Sum_probs=75.2

Q ss_pred             CCCCCcccCCCcccccChHHHHHHHHh--hCCC--C-------------ccc-------------cccchhhccCHHHHH
Q psy3485         181 PMRRNFMCFACPYYCRYGSSMAIHLRT--HTKE--K-------------PFA-------------CEMCNYRAASKIAIY  230 (304)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~l~~H~~~--H~~~--~-------------~~~-------------C~~C~k~F~~~~~L~  230 (304)
                      .+.-++.|.+|+++|....+...|+..  |...  +             ...             +..+-..+.......
T Consensus        64 ~~~~~~~c~~c~k~~~s~~a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~  143 (390)
T KOG2785|consen   64 EAESVVYCEACNKSFASPKAHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSE  143 (390)
T ss_pred             hcccceehHHhhccccChhhHHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccch
Confidence            345678999999999999999999764  4211  0             011             222222222211111


Q ss_pred             HHHHhhcCCC--------CCCCCCccccccCCccCCChHHHHHHHHhhcCCC---------------------CCCcccC
Q psy3485         231 AHMRTTHIMP--------DTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNT---------------------SGPTIQP  281 (304)
Q Consensus       231 ~H~~~~H~~~--------~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~---------------------~~~~~C~  281 (304)
                      .+.. - +.+        .....-|-.|-.|++.|.+--.-..||..+||-.                     ..-|.|=
T Consensus       144 e~~~-d-d~~Edi~~d~~~e~e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL  221 (390)
T KOG2785|consen  144 EEEE-D-DEEEDIEEDGDDEDELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICL  221 (390)
T ss_pred             hhcc-C-cchhhhhhccchhcccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEE
Confidence            1111 0 000        0012345789999999999999999999999864                     1248899


Q ss_pred             CCc---ccccchhHHHHHHh
Q psy3485         282 ECI---KILWSFLSYFIWIS  298 (304)
Q Consensus       282 ~C~---k~F~~~~~l~~h~~  298 (304)
                      .|+   +.|++--+...|+.
T Consensus       222 ~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  222 FCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             EeccccCcccccHHHHHHHh
Confidence            999   99999999999986


No 62 
>KOG2785|consensus
Probab=94.54  E-value=0.08  Score=46.65  Aligned_cols=57  Identities=26%  Similarity=0.457  Sum_probs=46.4

Q ss_pred             ccccccchhhccCHHHHHHHHHhhcC--CCCC---------------CCCCccccccCC---ccCCChHHHHHHHHh
Q psy3485         213 PFACEMCNYRAASKIAIYAHMRTTHI--MPDT---------------SEERRYHCAFCN---FTSPTQWAINRHTKY  269 (304)
Q Consensus       213 ~~~C~~C~k~F~~~~~L~~H~~~~H~--~~~~---------------~~~~~~~C~~C~---k~F~~~~~L~~H~r~  269 (304)
                      |-.|-.|++.|.+.-.-..||-..|+  +|+.               .-..-|.|-.|+   +.|.+-.+.+.||+.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            46799999999999999999998886  2211               012558999999   999999999999975


No 63 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.34  E-value=0.059  Score=39.25  Aligned_cols=84  Identities=13%  Similarity=0.175  Sum_probs=51.2

Q ss_pred             CccccccchhhccCHHHHHHHHHhhcCCCCC-C-------CCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCC
Q psy3485         212 KPFACEMCNYRAASKIAIYAHMRTTHIMPDT-S-------EERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPEC  283 (304)
Q Consensus       212 ~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~-~-------~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C  283 (304)
                      -|..|++||-+......|.+.-  +|+.|-+ -       ..+.-.|--|++.|........  ..-...  ..|.|+.|
T Consensus        14 LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~--~~y~C~~C   87 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSY--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDS--HRYVCAVC   87 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhh--hccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccc--cceeCCCC
Confidence            4566777776666666665542  4543311 0       1111248889999876532110  001122  36999999


Q ss_pred             cccccchhHHHHHHhhcc
Q psy3485         284 IKILWSFLSYFIWISVDV  301 (304)
Q Consensus       284 ~k~F~~~~~l~~h~~~~~  301 (304)
                      .+.|=---..++|-.+|+
T Consensus        88 ~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        88 KNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CCccccccchhhhhhccC
Confidence            999999999999988886


No 64 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.22  E-value=0.038  Score=40.28  Aligned_cols=32  Identities=19%  Similarity=0.314  Sum_probs=24.8

Q ss_pred             CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccch
Q psy3485         246 RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSF  290 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~  290 (304)
                      .+..|+.||+.|.--            ++ .|..|+.||..|.-.
T Consensus         8 tKR~Cp~CG~kFYDL------------nk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDL------------NK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CcccCCCCcchhccC------------CC-CCccCCCCCCccCcc
Confidence            456899999998754            33 489999999999654


No 65 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.03  E-value=0.049  Score=47.19  Aligned_cols=122  Identities=16%  Similarity=0.198  Sum_probs=79.1

Q ss_pred             cccCC------CchHH-HHHHHHHHhhhhccccccCCCCCCcccCCCcc---cc------cChHHHHHHHHhhCCCCcc-
Q psy3485         152 FFCIH------CNGCV-LYADLLDHCKLCLRRKRKNPMRRNFMCFACPY---YC------RYGSSMAIHLRTHTKEKPF-  214 (304)
Q Consensus       152 ~~C~~------C~~~f-l~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k---~f------~~~~~l~~H~~~H~~~~~~-  214 (304)
                      |.|+.      |+-.| |..|+...         +|    .+-|.+|-+   .|      -++..|..|...-..+.-| 
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~---------H~----~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFK  218 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQ---------HG----FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFK  218 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhh---------cC----cEEhHhhhcCcccCccceeeeecccccccccCCccccCcC
Confidence            88864      55544 88888742         22    367777753   33      3455677776553333234 


Q ss_pred             ---ccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCc----cCCChHHHHHHHHhhcCCCCCCcccCC--C--
Q psy3485         215 ---ACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNF----TSPTQWAINRHTKYTHMNTSGPTIQPE--C--  283 (304)
Q Consensus       215 ---~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k----~F~~~~~L~~H~r~h~~~~~~~~~C~~--C--  283 (304)
                         .|..|...|..-..|.+|+|..|       |+-|.|+.-+.    -|+.-.+|.+|.+.-      -|.|++  |  
T Consensus       219 GHP~C~FC~~~FYdDDEL~~HcR~~H-------E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~------hy~ct~qtc~~  285 (493)
T COG5236         219 GHPLCIFCKIYFYDDDELRRHCRLRH-------EACHICDMVGPIRYQYFKSYEDLEAHFRNA------HYCCTFQTCRV  285 (493)
T ss_pred             CCchhhhccceecChHHHHHHHHhhh-------hhhhhhhccCccchhhhhCHHHHHHHhhcC------ceEEEEEEEec
Confidence               59999999999999999999777       44344433332    278888888886532      366765  4  


Q ss_pred             cc--cccchhHHHHHHhh
Q psy3485         284 IK--ILWSFLSYFIWISV  299 (304)
Q Consensus       284 ~k--~F~~~~~l~~h~~~  299 (304)
                      ||  .|...--|+.||.-
T Consensus       286 ~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         286 GKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             CcEEEeccHHHHHHHHHH
Confidence            33  37788888888853


No 66 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.81  E-value=0.012  Score=53.84  Aligned_cols=70  Identities=20%  Similarity=0.361  Sum_probs=54.4

Q ss_pred             CccccccchhhccCHHHHHHHHHh-hcCCCCCCCC--Cccccc--cCCccCCChHHHHHHHHhhcCCCCCCcccCC--Cc
Q psy3485         212 KPFACEMCNYRAASKIAIYAHMRT-THIMPDTSEE--RRYHCA--FCNFTSPTQWAINRHTKYTHMNTSGPTIQPE--CI  284 (304)
Q Consensus       212 ~~~~C~~C~k~F~~~~~L~~H~~~-~H~~~~~~~~--~~~~C~--~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~--C~  284 (304)
                      .++.|..|...|.....|..|.+. .|     +++  +++.|+  .|++.|.+...+..|..+|++..  ++.|..  |.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h-----~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~  360 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNH-----SGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS--PAKEKLLNSS  360 (467)
T ss_pred             cCCCCccccCCcccccccccccccccc-----ccccCCceeeeccCCCccccccccccCCcccccCCC--ccccccccCc
Confidence            468888888888888888888884 56     777  888888  78888888888888888888885  666655  44


Q ss_pred             cccc
Q psy3485         285 KILW  288 (304)
Q Consensus       285 k~F~  288 (304)
                      +.+.
T Consensus       361 ~~~~  364 (467)
T COG5048         361 SKFS  364 (467)
T ss_pred             cccc
Confidence            4443


No 67 
>smart00868 zf-AD Zinc-finger associated domain (zf-AD). The zf-AD domain, also known as ZAD, forms an atypical treble-cleft-like zinc co-ordinating fold. The zf-AD domain is thought to be involved in mediating dimer formation, but does not bind to DNA.
Probab=93.27  E-value=0.13  Score=34.01  Aligned_cols=22  Identities=14%  Similarity=0.096  Sum_probs=19.3

Q ss_pred             cCCchHHHHHHHHHHHhhhhhh
Q psy3485          22 KVNYPIIVARKMWTKLKKNHQN   43 (304)
Q Consensus        22 ~~~~p~~iC~~C~~~l~~f~~~   43 (304)
                      .+++|..||..||..|+.|+..
T Consensus        38 ~~~~p~~iC~~C~~~l~~~~~f   59 (73)
T smart00868       38 DDDLPKKICGDCLEKLESFYKF   59 (73)
T ss_pred             CCCCcHHHHHHHHHHHHHHHHH
Confidence            4559999999999999999955


No 68 
>KOG4173|consensus
Probab=93.16  E-value=0.048  Score=43.72  Aligned_cols=51  Identities=20%  Similarity=0.374  Sum_probs=28.4

Q ss_pred             ccCCCcccccChHHHHHHHHh-h---------CCCCcccccc--chhhccCHHHHHHHHHhhc
Q psy3485         187 MCFACPYYCRYGSSMAIHLRT-H---------TKEKPFACEM--CNYRAASKIAIYAHMRTTH  237 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~-H---------~~~~~~~C~~--C~k~F~~~~~L~~H~~~~H  237 (304)
                      .|..|.+.|.+.-.|-.|+-. |         .|..-|.|-+  |+..|.+...-+.||-+.|
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            566666666666666666443 3         2334455543  5555555555555555555


No 69 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.22  E-value=0.067  Score=33.23  Aligned_cols=31  Identities=19%  Similarity=0.243  Sum_probs=22.6

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCC
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMN  273 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~  273 (304)
                      .||--+.|+.||+-|..+.++.+|...-|+=
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            5677777888888888888888777655543


No 70 
>PF07776 zf-AD:  Zinc-finger associated domain (zf-AD)  ;  InterPro: IPR012934 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The zf-AD domain, also known as ZAD, forms an atypical treble-cleft-like zinc co-ordinating fold. The zf-AD domain is thought to be involved in mediating dimer formation, but does not bind to DNA [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus; PDB: 1PZW_A.
Probab=92.10  E-value=0.056  Score=36.19  Aligned_cols=23  Identities=17%  Similarity=0.335  Sum_probs=19.3

Q ss_pred             ccCCchHHHHHHHHHHHhhhhhh
Q psy3485          21 KKVNYPIIVARKMWTKLKKNHQN   43 (304)
Q Consensus        21 ~~~~~p~~iC~~C~~~l~~f~~~   43 (304)
                      ..+++|..||..||..|+.|+..
T Consensus        39 ~~~~lp~~IC~~C~~~l~~~~~F   61 (75)
T PF07776_consen   39 PDDDLPQQICSSCWEKLQQFYRF   61 (75)
T ss_dssp             SS-SS-SEEEHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHH
Confidence            77889999999999999999955


No 71 
>KOG4173|consensus
Probab=91.83  E-value=0.15  Score=40.92  Aligned_cols=84  Identities=20%  Similarity=0.280  Sum_probs=55.1

Q ss_pred             CCcccCC--CcccccChHHHHHHHHh-hCCCCccccccchhhccCHHHHHHHHHhhcCC----CCCCCCCcccccc--CC
Q psy3485         184 RNFMCFA--CPYYCRYGSSMAIHLRT-HTKEKPFACEMCNYRAASKIAIYAHMRTTHIM----PDTSEERRYHCAF--CN  254 (304)
Q Consensus       184 ~~~~C~~--C~k~f~~~~~l~~H~~~-H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~----~~~~~~~~~~C~~--C~  254 (304)
                      +.|.|.+  |...|.....+..|..+ |+    -.|..|.+.|.+...|-.|+..-|..    .-..|.--|.|-.  |+
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt  153 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCT  153 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhh
Confidence            4466665  66777777777777655 54    35888888888888888887765520    0002344578844  88


Q ss_pred             ccCCChHHHHHHHHhhc
Q psy3485         255 FTSPTQWAINRHTKYTH  271 (304)
Q Consensus       255 k~F~~~~~L~~H~r~h~  271 (304)
                      -.|.+...-++|+..-|
T Consensus       154 ~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  154 EKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhhhHHHHhc
Confidence            88888888888875433


No 72 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.39  E-value=0.14  Score=32.39  Aligned_cols=9  Identities=33%  Similarity=0.740  Sum_probs=4.3

Q ss_pred             CcccCCCcc
Q psy3485         185 NFMCFACPY  193 (304)
Q Consensus       185 ~~~C~~C~k  193 (304)
                      .|.|+.||.
T Consensus        27 ~F~CPnCGe   35 (61)
T COG2888          27 KFPCPNCGE   35 (61)
T ss_pred             EeeCCCCCc
Confidence            345555553


No 73 
>KOG2186|consensus
Probab=91.14  E-value=0.12  Score=42.84  Aligned_cols=25  Identities=24%  Similarity=0.328  Sum_probs=12.5

Q ss_pred             CCcccCCCcccccChHHHHHHHHhhC
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLRTHT  209 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~~H~  209 (304)
                      ..|.|.-|++.|.. ..+..|...-+
T Consensus        28 ~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen   28 AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             CeeEEeeccccccc-chhhhhhhhcc
Confidence            34555555555555 44555544443


No 74 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.08  E-value=0.12  Score=28.91  Aligned_cols=24  Identities=25%  Similarity=0.823  Sum_probs=14.1

Q ss_pred             cccCCCcccccChHHHHHHHHhhCCCCccccccchh
Q psy3485         186 FMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNY  221 (304)
Q Consensus       186 ~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k  221 (304)
                      |+|.+||..+....            .++.|++||.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            56666666554432            5566666663


No 75 
>KOG2893|consensus
Probab=90.95  E-value=0.055  Score=44.39  Aligned_cols=49  Identities=18%  Similarity=0.415  Sum_probs=31.2

Q ss_pred             CCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhc
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTH  237 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H  237 (304)
                      ++ .|=.|++.|....-|.+|++.-+    |+|.+|.|..-+--.|..|-..+|
T Consensus        10 kp-wcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   10 KP-WCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             Cc-eeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceeehhhhh
Confidence            44 35567777777777777766522    777777766555555655633355


No 76 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.64  E-value=0.2  Score=37.14  Aligned_cols=33  Identities=12%  Similarity=0.012  Sum_probs=24.1

Q ss_pred             CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchh
Q psy3485         246 RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFL  291 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~  291 (304)
                      .+..|+.||+.|.--            ++ .|..|+.||..|.-..
T Consensus         8 tKr~Cp~cg~kFYDL------------nk-~p~vcP~cg~~~~~~~   40 (129)
T TIGR02300         8 TKRICPNTGSKFYDL------------NR-RPAVSPYTGEQFPPEE   40 (129)
T ss_pred             ccccCCCcCcccccc------------CC-CCccCCCcCCccCcch
Confidence            356899999888643            22 4889999999885553


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.37  E-value=0.63  Score=34.05  Aligned_cols=26  Identities=19%  Similarity=0.606  Sum_probs=23.8

Q ss_pred             cccc----ccCCccCCChHHHHHHHHhhcC
Q psy3485         247 RYHC----AFCNFTSPTQWAINRHTKYTHM  272 (304)
Q Consensus       247 ~~~C----~~C~k~F~~~~~L~~H~r~h~~  272 (304)
                      -|.|    ..|+..+.+...+++|++.+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999999886


No 78 
>KOG2186|consensus
Probab=89.32  E-value=0.17  Score=42.04  Aligned_cols=47  Identities=17%  Similarity=0.357  Sum_probs=29.1

Q ss_pred             CcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHH
Q psy3485         185 NFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMR  234 (304)
Q Consensus       185 ~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~  234 (304)
                      .|.|..||-+..-.. +.+|+.+-+| ..|.|-.|++.|-. .....|.+
T Consensus         3 ~FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            366777776655443 5556666555 55677777777766 55566665


No 79 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=89.29  E-value=0.073  Score=44.17  Aligned_cols=45  Identities=11%  Similarity=0.153  Sum_probs=26.4

Q ss_pred             CccccccCCccCCChHHHHHHHHh----------hcCCCC---CCcccCCCcccccch
Q psy3485         246 RRYHCAFCNFTSPTQWAINRHTKY----------THMNTS---GPTIQPECIKILWSF  290 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~~~L~~H~r~----------h~~~~~---~~~~C~~C~k~F~~~  290 (304)
                      +.+.|++|++.|.++.-+....|.          ..+..+   ....||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            456777777777776555544433          112210   125899999987654


No 80 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.94  E-value=0.99  Score=33.01  Aligned_cols=25  Identities=16%  Similarity=-0.041  Sum_probs=22.1

Q ss_pred             ccc----CCCcccccchhHHHHHHhhccc
Q psy3485         278 TIQ----PECIKILWSFLSYFIWISVDVN  302 (304)
Q Consensus       278 ~~C----~~C~k~F~~~~~l~~h~~~~~~  302 (304)
                      |.|    ..|+..+.+..+|..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999988764


No 81 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.23  E-value=0.32  Score=27.97  Aligned_cols=32  Identities=16%  Similarity=0.337  Sum_probs=14.2

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCccccccchhhc
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRA  223 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F  223 (304)
                      .|+.|+..|.-...     +.-.+.+..+|..|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            45555555544432     122233345555555444


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=88.01  E-value=0.3  Score=28.17  Aligned_cols=12  Identities=25%  Similarity=0.362  Sum_probs=5.8

Q ss_pred             ccCCCcccccCh
Q psy3485         187 MCFACPYYCRYG  198 (304)
Q Consensus       187 ~C~~C~k~f~~~  198 (304)
                      .|+.|+..|.-.
T Consensus         4 ~CP~C~~~~~v~   15 (38)
T TIGR02098         4 QCPNCKTSFRVV   15 (38)
T ss_pred             ECCCCCCEEEeC
Confidence            455555554444


No 83 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=87.96  E-value=0.35  Score=27.61  Aligned_cols=12  Identities=17%  Similarity=0.365  Sum_probs=5.5

Q ss_pred             ccCCCcccccCh
Q psy3485         187 MCFACPYYCRYG  198 (304)
Q Consensus       187 ~C~~C~k~f~~~  198 (304)
                      .|+.|+..|.-.
T Consensus         4 ~Cp~C~~~y~i~   15 (36)
T PF13717_consen    4 TCPNCQAKYEID   15 (36)
T ss_pred             ECCCCCCEEeCC
Confidence            344444444443


No 84 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.80  E-value=0.42  Score=26.92  Aligned_cols=26  Identities=19%  Similarity=0.511  Sum_probs=17.3

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      .|.|..||..+..             .. .|..|++||..
T Consensus         2 ~~~C~~CG~i~~g-------------~~-~p~~CP~Cg~~   27 (34)
T cd00729           2 VWVCPVCGYIHEG-------------EE-APEKCPICGAP   27 (34)
T ss_pred             eEECCCCCCEeEC-------------Cc-CCCcCcCCCCc
Confidence            4788888865332             22 37788888863


No 85 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=87.52  E-value=0.42  Score=25.09  Aligned_cols=11  Identities=18%  Similarity=0.169  Sum_probs=7.6

Q ss_pred             cccCCCccccc
Q psy3485         278 TIQPECIKILW  288 (304)
Q Consensus       278 ~~C~~C~k~F~  288 (304)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            45777777774


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.20  E-value=0.34  Score=35.34  Aligned_cols=15  Identities=20%  Similarity=0.640  Sum_probs=7.6

Q ss_pred             CccccccchhhccCH
Q psy3485         212 KPFACEMCNYRAASK  226 (304)
Q Consensus       212 ~~~~C~~C~k~F~~~  226 (304)
                      .|..|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            445555555555443


No 87 
>KOG2893|consensus
Probab=86.72  E-value=0.16  Score=41.78  Aligned_cols=41  Identities=20%  Similarity=0.470  Sum_probs=24.8

Q ss_pred             cccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHH
Q psy3485         216 CEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRH  266 (304)
Q Consensus       216 C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H  266 (304)
                      |=+|.+.|....-|..|++..|          |+|.+|.|...+--.|.-|
T Consensus        13 cwycnrefddekiliqhqkakh----------fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAKH----------FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhhcc----------ceeeeehhhhccCCCceee
Confidence            5556666666666666666555          6666666665555555555


No 88 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=86.67  E-value=0.49  Score=30.06  Aligned_cols=8  Identities=38%  Similarity=1.123  Sum_probs=4.0

Q ss_pred             ccccccCC
Q psy3485         247 RYHCAFCN  254 (304)
Q Consensus       247 ~~~C~~C~  254 (304)
                      +|.|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            45555554


No 89 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=86.65  E-value=0.4  Score=28.78  Aligned_cols=27  Identities=19%  Similarity=0.240  Sum_probs=18.8

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      .|.|..||..|...           ..  .+.+|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~--~~irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SK--DVVRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CC--CceECCCCCce
Confidence            37888888887744           22  27888888864


No 90 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=84.99  E-value=0.67  Score=28.60  Aligned_cols=21  Identities=19%  Similarity=0.528  Sum_probs=13.5

Q ss_pred             cccccCCccCCCh-----HHHHHHHH
Q psy3485         248 YHCAFCNFTSPTQ-----WAINRHTK  268 (304)
Q Consensus       248 ~~C~~C~k~F~~~-----~~L~~H~r  268 (304)
                      -.|.+|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4677777766554     46666666


No 91 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.77  E-value=0.85  Score=27.27  Aligned_cols=12  Identities=17%  Similarity=0.526  Sum_probs=4.3

Q ss_pred             cccccCCccCCC
Q psy3485         248 YHCAFCNFTSPT  259 (304)
Q Consensus       248 ~~C~~C~k~F~~  259 (304)
                      ..|.+|++.+..
T Consensus        17 a~C~~C~~~~~~   28 (45)
T PF02892_consen   17 AKCKYCGKVIKY   28 (45)
T ss_dssp             EEETTTTEE---
T ss_pred             EEeCCCCeEEee
Confidence            344444444443


No 92 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.50  E-value=0.62  Score=29.03  Aligned_cols=28  Identities=18%  Similarity=0.360  Sum_probs=13.6

Q ss_pred             CCCccccccchhhccCHHHHHHHHHhhc
Q psy3485         210 KEKPFACEMCNYRAASKIAIYAHMRTTH  237 (304)
Q Consensus       210 ~~~~~~C~~C~k~F~~~~~L~~H~~~~H  237 (304)
                      |+--++|+.||..|.......+|....|
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            4444455555555555555555544333


No 93 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.18  E-value=0.52  Score=37.08  Aligned_cols=37  Identities=16%  Similarity=0.283  Sum_probs=29.2

Q ss_pred             cccCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhh
Q psy3485         177 KRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYR  222 (304)
Q Consensus       177 ~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~  222 (304)
                      +....+...|.|+.|+.+|+...++.         ..|.|+.||..
T Consensus       101 l~~e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       101 LEFETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             HhhccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            34455667899999999999988875         25999999966


No 94 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.16  E-value=0.8  Score=27.39  Aligned_cols=27  Identities=19%  Similarity=0.422  Sum_probs=12.0

Q ss_pred             CCccccccchhhccCH----HHHHHHHHhhc
Q psy3485         211 EKPFACEMCNYRAASK----IAIYAHMRTTH  237 (304)
Q Consensus       211 ~~~~~C~~C~k~F~~~----~~L~~H~~~~H  237 (304)
                      ....+|..|++.+...    +.|.+|++..|
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            3445566666665543    55666664343


No 95 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=83.73  E-value=0.14  Score=42.51  Aligned_cols=13  Identities=15%  Similarity=0.777  Sum_probs=10.6

Q ss_pred             cccccCCccCCCh
Q psy3485         248 YHCAFCNFTSPTQ  260 (304)
Q Consensus       248 ~~C~~C~k~F~~~  260 (304)
                      .+|+.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5899999987754


No 96 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=83.30  E-value=1.4  Score=34.59  Aligned_cols=34  Identities=15%  Similarity=0.180  Sum_probs=25.6

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      ++..-|.|+.|+..|+.--++.         .  .|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~--~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------L--NFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------c--CCcCCCCCCEe
Confidence            4556688888888888888775         1  58888888764


No 97 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=82.86  E-value=1.4  Score=31.69  Aligned_cols=28  Identities=14%  Similarity=-0.132  Sum_probs=20.9

Q ss_pred             cccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      -.|+.||+.|.--            ++ +|..|++||++|.
T Consensus        10 ridPetg~KFYDL------------Nr-dPiVsPytG~s~P   37 (129)
T COG4530          10 RIDPETGKKFYDL------------NR-DPIVSPYTGKSYP   37 (129)
T ss_pred             ccCccccchhhcc------------CC-CccccCcccccch
Confidence            4688888888643            22 5899999999983


No 98 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=82.73  E-value=0.72  Score=23.66  Aligned_cols=8  Identities=38%  Similarity=0.874  Sum_probs=3.7

Q ss_pred             CcccCCCc
Q psy3485         185 NFMCFACP  192 (304)
Q Consensus       185 ~~~C~~C~  192 (304)
                      .|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            44444444


No 99 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=82.62  E-value=1.1  Score=32.68  Aligned_cols=23  Identities=26%  Similarity=0.466  Sum_probs=13.7

Q ss_pred             CCccccccCCccCCChHHHHHHH
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHT  267 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~  267 (304)
                      ...|.|+.|..-|=-.=+.-.|.
T Consensus        79 ~~~y~C~~C~~~FC~dCD~fiHe  101 (112)
T TIGR00622        79 SHRYVCAVCKNVFCVDCDVFVHE  101 (112)
T ss_pred             ccceeCCCCCCccccccchhhhh
Confidence            34677777777666555554443


No 100
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.35  E-value=0.66  Score=37.26  Aligned_cols=34  Identities=18%  Similarity=0.347  Sum_probs=24.0

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      ....-|.|+.|++.|+.--++.         .  .|.|+.||-..
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA~~---------~--~F~Cp~Cg~~L  146 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEAME---------Y--GFRCPQCGEML  146 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHHhh---------c--CCcCCCCCCCC
Confidence            3445678888888888777663         2  58888888764


No 101
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=82.19  E-value=0.66  Score=28.38  Aligned_cols=30  Identities=20%  Similarity=0.256  Sum_probs=18.2

Q ss_pred             CCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      ..-|.|..||+.|..          -...  +...|++||..
T Consensus         4 ~~~Y~C~~Cg~~~~~----------~~~~--~~irCp~Cg~r   33 (49)
T COG1996           4 MMEYKCARCGREVEL----------DQET--RGIRCPYCGSR   33 (49)
T ss_pred             eEEEEhhhcCCeeeh----------hhcc--CceeCCCCCcE
Confidence            345888888888711          1111  36788888753


No 102
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.83  E-value=0.74  Score=36.99  Aligned_cols=36  Identities=19%  Similarity=0.442  Sum_probs=27.5

Q ss_pred             cCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhc
Q psy3485         179 KNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRA  223 (304)
Q Consensus       179 ~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F  223 (304)
                      .-.....|.|+.|+..|+...++.         ..|.|+.||...
T Consensus       111 ~e~~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        111 EEENNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             hccCCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            334456799999999999888763         359999999653


No 103
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=81.81  E-value=1.1  Score=27.59  Aligned_cols=25  Identities=12%  Similarity=-0.136  Sum_probs=20.8

Q ss_pred             CcccCCCcccccch-----hHHHHHHh-hcc
Q psy3485         277 PTIQPECIKILWSF-----LSYFIWIS-VDV  301 (304)
Q Consensus       277 ~~~C~~C~k~F~~~-----~~l~~h~~-~~~  301 (304)
                      .-.|.+|++.++..     ++|..|+. +|-
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            46899999999665     79999999 664


No 104
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=81.73  E-value=0.75  Score=35.73  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=8.3

Q ss_pred             CccccccCCccCCCh
Q psy3485         246 RRYHCAFCNFTSPTQ  260 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~  260 (304)
                      .-|.|+.|+..|..-
T Consensus        98 ~~Y~Cp~C~~~y~~~  112 (147)
T smart00531       98 AYYKCPNCQSKYTFL  112 (147)
T ss_pred             cEEECcCCCCEeeHH
Confidence            345666666665543


No 105
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=81.36  E-value=0.81  Score=34.65  Aligned_cols=27  Identities=26%  Similarity=0.246  Sum_probs=17.3

Q ss_pred             CCccccccCCccCCChHHHHHHHHhhcCCC
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~  274 (304)
                      ..-..|-+|||.|+.-   ++|.++|||-.
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-S-
T ss_pred             cCeeEEccCCcccchH---HHHHHHccCCC
Confidence            3447899999999874   99999998876


No 106
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.30  E-value=0.4  Score=28.05  Aligned_cols=30  Identities=27%  Similarity=0.354  Sum_probs=17.2

Q ss_pred             cccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      |.|..||+.|.-....       ...  ..-.|+.||..
T Consensus         6 y~C~~Cg~~fe~~~~~-------~~~--~~~~CP~Cg~~   35 (41)
T smart00834        6 YRCEDCGHTFEVLQKI-------SDD--PLATCPECGGD   35 (41)
T ss_pred             EEcCCCCCEEEEEEec-------CCC--CCCCCCCCCCc
Confidence            6777777776544222       112  25667777763


No 107
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=79.14  E-value=1.2  Score=35.10  Aligned_cols=8  Identities=38%  Similarity=0.837  Sum_probs=5.1

Q ss_pred             CcccCCCc
Q psy3485         277 PTIQPECI  284 (304)
Q Consensus       277 ~~~C~~C~  284 (304)
                      |-+||+||
T Consensus       149 P~~CPiCg  156 (166)
T COG1592         149 PEVCPICG  156 (166)
T ss_pred             CCcCCCCC
Confidence            66666666


No 108
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=78.96  E-value=1.2  Score=33.17  Aligned_cols=29  Identities=7%  Similarity=0.014  Sum_probs=15.5

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCH
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASK  226 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~  226 (304)
                      .|+.||++|+..           +..|..|+.||..|...
T Consensus        11 ~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        11 ICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            555666665543           23455566666555444


No 109
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=78.83  E-value=1.2  Score=30.80  Aligned_cols=31  Identities=16%  Similarity=0.187  Sum_probs=19.8

Q ss_pred             CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         246 RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      .+|.|+.|++.        .+.|.-+|    .+.|..||..|.
T Consensus        34 ~~~~Cp~C~~~--------~VkR~a~G----IW~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRIATG----IWKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCc--------ceeeeccC----eEEcCCCCCeec
Confidence            45788888864        22334444    578888888874


No 110
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=78.77  E-value=1.2  Score=34.60  Aligned_cols=39  Identities=13%  Similarity=0.353  Sum_probs=24.0

Q ss_pred             CCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhc
Q psy3485         181 PMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRA  223 (304)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F  223 (304)
                      .....|.|+.|+..|+...++..-   +. +..|.|+.||...
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~~---d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQLL---DM-DGTFTCPRCGEEL  133 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHhc---CC-CCcEECCCCCCEE
Confidence            345568888888888765443321   11 3348888888654


No 111
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=78.61  E-value=0.83  Score=24.88  Aligned_cols=26  Identities=19%  Similarity=0.385  Sum_probs=12.0

Q ss_pred             ccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         249 HCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      +|+.|+-.+..           +...  .|.|+.|+..+
T Consensus         4 ~Cp~C~se~~y-----------~D~~--~~vCp~C~~ew   29 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGE--LLVCPECGHEW   29 (30)
T ss_dssp             --TTT-----E-----------E-SS--SEEETTTTEEE
T ss_pred             CCCCCCCccee-----------ccCC--EEeCCcccccC
Confidence            57778777666           3332  68888887643


No 112
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.10  E-value=2.1  Score=22.41  Aligned_cols=18  Identities=28%  Similarity=0.492  Sum_probs=9.9

Q ss_pred             ccccCCccCCChHHHHHHH
Q psy3485         249 HCAFCNFTSPTQWAINRHT  267 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~  267 (304)
                      .|++|++.+ ....++.|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            456666665 445555554


No 113
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=78.10  E-value=0.36  Score=37.65  Aligned_cols=12  Identities=25%  Similarity=0.412  Sum_probs=6.3

Q ss_pred             cccccCCccCCC
Q psy3485         248 YHCAFCNFTSPT  259 (304)
Q Consensus       248 ~~C~~C~k~F~~  259 (304)
                      ++|+.||++|.+
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            455555555544


No 114
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=78.02  E-value=1.5  Score=26.00  Aligned_cols=21  Identities=24%  Similarity=0.768  Sum_probs=19.0

Q ss_pred             cccccchhhccCHHHHHHHHH
Q psy3485         214 FACEMCNYRAASKIAIYAHMR  234 (304)
Q Consensus       214 ~~C~~C~k~F~~~~~L~~H~~  234 (304)
                      |+|-+|.-+..-++.|..||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            789999988888999999998


No 115
>KOG2482|consensus
Probab=77.32  E-value=4.3  Score=35.55  Aligned_cols=23  Identities=17%  Similarity=0.494  Sum_probs=18.6

Q ss_pred             ccccccCCccCCChHHHHHHHHh
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      .+.|-.|.|.|+.+..|+.|||.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            57888888888888888888864


No 116
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=76.58  E-value=1.5  Score=34.57  Aligned_cols=12  Identities=33%  Similarity=0.866  Sum_probs=5.6

Q ss_pred             CCCCccccccch
Q psy3485         209 TKEKPFACEMCN  220 (304)
Q Consensus       209 ~~~~~~~C~~C~  220 (304)
                      -|+.|-.|++||
T Consensus       145 ~ge~P~~CPiCg  156 (166)
T COG1592         145 EGEAPEVCPICG  156 (166)
T ss_pred             cCCCCCcCCCCC
Confidence            334444555554


No 117
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=76.58  E-value=0.61  Score=28.97  Aligned_cols=13  Identities=23%  Similarity=0.639  Sum_probs=8.4

Q ss_pred             cccccCCccCCCh
Q psy3485         248 YHCAFCNFTSPTQ  260 (304)
Q Consensus       248 ~~C~~C~k~F~~~  260 (304)
                      |.|..||..|.-.
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            6677777766643


No 118
>KOG2071|consensus
Probab=76.36  E-value=2  Score=40.43  Aligned_cols=27  Identities=15%  Similarity=0.249  Sum_probs=20.7

Q ss_pred             CCCcccCCCcccccChHHHHHHHHhhC
Q psy3485         183 RRNFMCFACPYYCRYGSSMAIHLRTHT  209 (304)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~l~~H~~~H~  209 (304)
                      ..+.+|..||++|........||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456788888888888877777777663


No 119
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=76.08  E-value=1.8  Score=23.93  Aligned_cols=26  Identities=27%  Similarity=0.462  Sum_probs=14.6

Q ss_pred             cccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      |.|..||..+.-.          .+   .+.+|+.||..
T Consensus         1 Y~C~~Cg~~~~~~----------~~---~~irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVELK----------PG---DPIRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-BS----------TS---STSSBSSSS-S
T ss_pred             CCCCcCCCeeEcC----------CC---CcEECCcCCCe
Confidence            5677777776522          12   26778887753


No 120
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=75.89  E-value=0.72  Score=30.89  Aligned_cols=15  Identities=20%  Similarity=0.496  Sum_probs=7.7

Q ss_pred             CCccccc--cchhhccC
Q psy3485         211 EKPFACE--MCNYRAAS  225 (304)
Q Consensus       211 ~~~~~C~--~C~k~F~~  225 (304)
                      ++.+.|.  .||.+|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            3445555  55555554


No 121
>KOG2907|consensus
Probab=75.06  E-value=0.54  Score=34.02  Aligned_cols=29  Identities=14%  Similarity=0.376  Sum_probs=18.2

Q ss_pred             hhhhccccccCCCCCCcccCCCcccccCh
Q psy3485         170 CKLCLRRKRKNPMRRNFMCFACPYYCRYG  198 (304)
Q Consensus       170 C~~C~~~~~~h~~~~~~~C~~C~k~f~~~  198 (304)
                      |..||-.+..-...-.+.|..|...|..+
T Consensus        10 C~~CG~ll~~~~~~~~~~C~~Ck~~~~v~   38 (116)
T KOG2907|consen   10 CSDCGSLLEEPSAQSTVLCIRCKIEYPVS   38 (116)
T ss_pred             hhhhhhhcccccccCceEeccccccCCHH
Confidence            55555555555555566688888776543


No 122
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=75.06  E-value=1.7  Score=37.36  Aligned_cols=84  Identities=17%  Similarity=0.311  Sum_probs=52.9

Q ss_pred             CccccccchhhccCHHHHHHHHHhhcCCC------CCCCC--CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCC
Q psy3485         212 KPFACEMCNYRAASKIAIYAHMRTTHIMP------DTSEE--RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPEC  283 (304)
Q Consensus       212 ~~~~C~~C~k~F~~~~~L~~H~~~~H~~~------~~~~~--~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C  283 (304)
                      -|..|+.|.-.......|.+-.  +|++|      .++++  |--.|-.|.-.|...   ..|.---.... ..|.|+.|
T Consensus       321 LPi~CP~Csl~LilsthLarSy--hhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~---~~~~~~~~~ss-~rY~Ce~C  394 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSY--HHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKP---PVSPFDESTSS-GRYQCELC  394 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHH--HhhccCcccccccCCCCCCCccceeccCCCCCC---CCCcccccccc-cceechhh
Confidence            3567888887766666655433  45544      22333  334588888888765   22221111111 36999999


Q ss_pred             cccccchhHHHHHHhhcc
Q psy3485         284 IKILWSFLSYFIWISVDV  301 (304)
Q Consensus       284 ~k~F~~~~~l~~h~~~~~  301 (304)
                      -..|-+--..++|-..|.
T Consensus       395 K~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         395 KSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             hhhhhhhhHHHHHHHHhh
Confidence            999999999999988874


No 123
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.85  E-value=1  Score=26.71  Aligned_cols=29  Identities=28%  Similarity=0.532  Sum_probs=16.1

Q ss_pred             cccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIK  285 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k  285 (304)
                      |.|..||..|.....+       +..  .+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~-------~~~--~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSI-------SED--DPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEc-------CCC--CCCcCCCCCC
Confidence            6677777666554221       112  2566777776


No 124
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=74.30  E-value=1.7  Score=42.77  Aligned_cols=27  Identities=22%  Similarity=0.539  Sum_probs=20.8

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      ...+...|.+||               |+...  |..|+.||-.
T Consensus       458 ~~~~~L~CH~Cg---------------~~~~~--p~~Cp~Cgs~  484 (730)
T COG1198         458 KATGQLRCHYCG---------------YQEPI--PQSCPECGSE  484 (730)
T ss_pred             cCCCeeEeCCCC---------------CCCCC--CCCCCCCCCC
Confidence            445578999999               44444  9999999976


No 125
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=73.90  E-value=0.47  Score=31.78  Aligned_cols=12  Identities=8%  Similarity=0.183  Sum_probs=5.7

Q ss_pred             cccC--CCcccccc
Q psy3485         278 TIQP--ECIKILWS  289 (304)
Q Consensus       278 ~~C~--~C~k~F~~  289 (304)
                      +.|.  .||.+|.+
T Consensus        28 ~qC~N~eCg~tF~t   41 (72)
T PRK09678         28 HQCQNVNCSATFIT   41 (72)
T ss_pred             eecCCCCCCCEEEE
Confidence            4454  45555543


No 126
>KOG2272|consensus
Probab=73.14  E-value=2.7  Score=35.13  Aligned_cols=62  Identities=21%  Similarity=0.361  Sum_probs=31.7

Q ss_pred             cccCCCcccccChHHHHH-H---HHhhCCCCccccccchhhccC-----HHHHHHHHHhhcCCCCCCCCCccccccCCcc
Q psy3485         186 FMCFACPYYCRYGSSMAI-H---LRTHTKEKPFACEMCNYRAAS-----KIAIYAHMRTTHIMPDTSEERRYHCAFCNFT  256 (304)
Q Consensus       186 ~~C~~C~k~f~~~~~l~~-H---~~~H~~~~~~~C~~C~k~F~~-----~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~  256 (304)
                      |.|..|++...+.+.-.. -   ++.|   ..+.|++||-.=+.     -.+|..||-+-|          |.|..|.|-
T Consensus       164 FkCt~C~keL~sdaRevk~eLyClrCh---D~mgipiCgaC~rpIeervi~amgKhWHveH----------FvCa~CekP  230 (332)
T KOG2272|consen  164 FKCTTCGKELTSDAREVKGELYCLRCH---DKMGIPICGACRRPIEERVIFAMGKHWHVEH----------FVCAKCEKP  230 (332)
T ss_pred             eecccccccccchhhhhccceeccccc---cccCCcccccccCchHHHHHHHhccccchhh----------eeehhcCCc
Confidence            677778877665532111 0   0111   12455555532211     244666666444          777777777


Q ss_pred             CCCh
Q psy3485         257 SPTQ  260 (304)
Q Consensus       257 F~~~  260 (304)
                      |---
T Consensus       231 FlGH  234 (332)
T KOG2272|consen  231 FLGH  234 (332)
T ss_pred             ccch
Confidence            6543


No 127
>KOG4167|consensus
Probab=71.15  E-value=1.2  Score=42.87  Aligned_cols=28  Identities=18%  Similarity=0.156  Sum_probs=23.3

Q ss_pred             CccccccCCccCCChHHHHHHHHhhcCC
Q psy3485         246 RRYHCAFCNFTSPTQWAINRHTKYTHMN  273 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~~~L~~H~r~h~~~  273 (304)
                      ..|.|..|+|.|-...+++.||++|...
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            4688999999998888899999888654


No 128
>PHA00626 hypothetical protein
Probab=70.20  E-value=2.4  Score=26.59  Aligned_cols=14  Identities=21%  Similarity=0.748  Sum_probs=7.7

Q ss_pred             CccccccchhhccC
Q psy3485         212 KPFACEMCNYRAAS  225 (304)
Q Consensus       212 ~~~~C~~C~k~F~~  225 (304)
                      ..|.|..||..|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            34666666655554


No 129
>PF14353 CpXC:  CpXC protein
Probab=69.55  E-value=0.37  Score=36.45  Aligned_cols=14  Identities=14%  Similarity=0.071  Sum_probs=7.6

Q ss_pred             CcccCCCcccccch
Q psy3485         277 PTIQPECIKILWSF  290 (304)
Q Consensus       277 ~~~C~~C~k~F~~~  290 (304)
                      .|.|+.||+.|.-.
T Consensus        38 ~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   38 SFTCPSCGHKFRLE   51 (128)
T ss_pred             EEECCCCCCceecC
Confidence            35666666655433


No 130
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=69.34  E-value=1.1  Score=37.65  Aligned_cols=24  Identities=13%  Similarity=-0.013  Sum_probs=14.5

Q ss_pred             CCcccCCCcccccchhHHHHHHhh
Q psy3485         276 GPTIQPECIKILWSFLSYFIWISV  299 (304)
Q Consensus       276 ~~~~C~~C~k~F~~~~~l~~h~~~  299 (304)
                      +++.||-||........|-...|.
T Consensus       208 k~~PCPKCg~et~eTkdLSmStR~  231 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSMSTRS  231 (314)
T ss_pred             CCCCCCCCCCcccccccceeeeec
Confidence            367777777766655555444443


No 131
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=66.92  E-value=3.7  Score=33.94  Aligned_cols=26  Identities=15%  Similarity=0.375  Sum_probs=16.1

Q ss_pred             CccccccchhhccCHHHHHHHHHhhc
Q psy3485         212 KPFACEMCNYRAASKIAIYAHMRTTH  237 (304)
Q Consensus       212 ~~~~C~~C~k~F~~~~~L~~H~~~~H  237 (304)
                      ..|.|..|+|.|.......+|+...|
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcC
Confidence            34777777777777777777777666


No 132
>KOG1280|consensus
Probab=66.66  E-value=4.2  Score=35.68  Aligned_cols=72  Identities=13%  Similarity=0.225  Sum_probs=42.6

Q ss_pred             cccCCCCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCC
Q psy3485         177 KRKNPMRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCN  254 (304)
Q Consensus       177 ~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~  254 (304)
                      ..+|.-+.|.+|..=...|.....  .-.-.|-...-|.|++|++.=.+...|..|....|.++.    --..|++|+
T Consensus        45 t~~H~~dHPmqcil~~~dfeL~f~--Ge~i~~y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~----~~~icp~c~  116 (381)
T KOG1280|consen   45 TPIHDEDHPMQCILSRVDFELYFG--GEPISHYDPQSFTCPYCGIMGFTERQFGTHVLSQHPEAS----TSVICPLCA  116 (381)
T ss_pred             CcccCCCCceeEEeeccceeeEec--CccccccccccccCCcccccccchhHHHHHhhhcCcccC----cceeeeccc
Confidence            567777777777433333322110  001124455578999999888888888888887884321    124566665


No 133
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=66.53  E-value=2.8  Score=27.66  Aligned_cols=28  Identities=11%  Similarity=0.290  Sum_probs=13.0

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      .-.|..|++.|..            ..  +.|.|..||..|=
T Consensus         9 ~~~C~~C~~~F~~------------~~--rrhhCr~CG~~vC   36 (69)
T PF01363_consen    9 ASNCMICGKKFSL------------FR--RRHHCRNCGRVVC   36 (69)
T ss_dssp             -SB-TTT--B-BS------------SS---EEE-TTT--EEE
T ss_pred             CCcCcCcCCcCCC------------ce--eeEccCCCCCEEC
Confidence            3478889988853            12  4788888888773


No 134
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=66.21  E-value=3.3  Score=24.92  Aligned_cols=13  Identities=15%  Similarity=0.488  Sum_probs=7.2

Q ss_pred             CcccCCCcccccC
Q psy3485         185 NFMCFACPYYCRY  197 (304)
Q Consensus       185 ~~~C~~C~k~f~~  197 (304)
                      .|.|+.||..|..
T Consensus         3 ~y~C~~CG~~~~~   15 (46)
T PRK00398          3 EYKCARCGREVEL   15 (46)
T ss_pred             EEECCCCCCEEEE
Confidence            3556666665544


No 135
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=65.84  E-value=1.4  Score=42.47  Aligned_cols=56  Identities=18%  Similarity=0.361  Sum_probs=29.7

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCcc-ccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCc
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPF-ACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNF  255 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~-~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k  255 (304)
                      .|..||=+|+--.+|-.= |.+|.-+.| -|+.|.+.|....+-+     .|       ..|..|+.||=
T Consensus       125 ~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRR-----fH-------AQp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRR-----FH-------AQPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccc-----cc-------cccccCcccCC
Confidence            566677766654333221 224444445 3777777666655422     33       22566777764


No 136
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=64.44  E-value=5.4  Score=23.71  Aligned_cols=33  Identities=30%  Similarity=0.642  Sum_probs=24.7

Q ss_pred             cCCCCCCCC-CccccccCCccCCChHHHHHHHHh
Q psy3485         237 HIMPDTSEE-RRYHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       237 H~~~~~~~~-~~~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      |.+|++.|. -.|+|-.|+.+-.-++.|-+||+.
T Consensus         9 hyiprp~gkp~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen    9 HYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             CcCCCCCCCCccceeecCCcccchHHHHHHHHHH
Confidence            444444432 347999999999999999999975


No 137
>KOG4124|consensus
Probab=63.81  E-value=1.3  Score=38.73  Aligned_cols=28  Identities=21%  Similarity=0.521  Sum_probs=23.4

Q ss_pred             CCcccccc--chhhccCHHHHHHHHHhhcC
Q psy3485         211 EKPFACEM--CNYRAASKIAIYAHMRTTHI  238 (304)
Q Consensus       211 ~~~~~C~~--C~k~F~~~~~L~~H~~~~H~  238 (304)
                      .++|+|.+  |++.+++...|+.|....|-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~  376 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHC  376 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcC
Confidence            36789976  99999999999999886664


No 138
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=63.72  E-value=3  Score=28.79  Aligned_cols=15  Identities=13%  Similarity=0.215  Sum_probs=8.4

Q ss_pred             CCCCcccCCCccccc
Q psy3485         182 MRRNFMCFACPYYCR  196 (304)
Q Consensus       182 ~~~~~~C~~C~k~f~  196 (304)
                      +..-+.|.-||..|.
T Consensus        50 a~GIW~C~kCg~~fA   64 (89)
T COG1997          50 ATGIWKCRKCGAKFA   64 (89)
T ss_pred             ccCeEEcCCCCCeec
Confidence            334566666666654


No 139
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=62.75  E-value=3.4  Score=31.00  Aligned_cols=24  Identities=17%  Similarity=0.007  Sum_probs=20.5

Q ss_pred             cccccCCccCCChHHHHHHHHhhcCCC
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~~~~  274 (304)
                      ..|-++||.|++   |++|.++|++-.
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmT  100 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLT  100 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCC
Confidence            589999999975   799999999876


No 140
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=62.75  E-value=3.8  Score=25.19  Aligned_cols=13  Identities=31%  Similarity=0.697  Sum_probs=7.8

Q ss_pred             CcccCCCcccccC
Q psy3485         185 NFMCFACPYYCRY  197 (304)
Q Consensus       185 ~~~C~~C~k~f~~  197 (304)
                      .+.|+.||..+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            5667777655543


No 141
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=61.89  E-value=2.9  Score=26.25  Aligned_cols=30  Identities=20%  Similarity=0.253  Sum_probs=17.1

Q ss_pred             cccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      |.|+.||..+.-...       .-|+   ...|+.||..|
T Consensus         3 ~~CP~CG~~iev~~~-------~~Ge---iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENP-------ELGE---LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCC-------ccCC---EEeCCCCCCEE
Confidence            567777776533211       1133   46777777765


No 142
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=61.82  E-value=3.8  Score=33.89  Aligned_cols=32  Identities=16%  Similarity=0.365  Sum_probs=24.9

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCC
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~  274 (304)
                      .++..|.|..|+|.|+-..-.++|+..-|.++
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            35678999999999999999999998877764


No 143
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=61.33  E-value=1.5  Score=23.42  Aligned_cols=19  Identities=21%  Similarity=0.277  Sum_probs=6.9

Q ss_pred             ccccCCccCCChHHHHHHHH
Q psy3485         249 HCAFCNFTSPTQWAINRHTK  268 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~r  268 (304)
                      .|--|++.| .....+.|..
T Consensus         2 sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    2 SCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EETTTTEEE-EGGGTTT---
T ss_pred             eeecCCCCc-CcCCcCCCCc
Confidence            344444444 3334444433


No 144
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=60.71  E-value=7.8  Score=30.05  Aligned_cols=44  Identities=16%  Similarity=0.070  Sum_probs=20.4

Q ss_pred             CCCCccccccCCccC------CChHHHHHHHH-hhcCCC---------CCCcccCCCccc
Q psy3485         243 SEERRYHCAFCNFTS------PTQWAINRHTK-YTHMNT---------SGPTIQPECIKI  286 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F------~~~~~L~~H~r-~h~~~~---------~~~~~C~~C~k~  286 (304)
                      ...--..|..|+|+|      ++.+.+..|+. +.|.+.         -...+|-.||-.
T Consensus        10 ~p~~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~~   69 (152)
T PF09416_consen   10 DPSCVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGSR   69 (152)
T ss_dssp             -CCCEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT---
T ss_pred             CcccEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCCC
Confidence            445567888888887      35566777753 333321         024788888754


No 145
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=60.25  E-value=18  Score=30.31  Aligned_cols=20  Identities=30%  Similarity=0.346  Sum_probs=14.0

Q ss_pred             CCCCCccccCCCchHHHHHH
Q psy3485         146 FSPDDQFFCIHCNGCVLYAD  165 (304)
Q Consensus       146 ~~~~~~~~C~~C~~~fl~~H  165 (304)
                      ......|.|..|...+.++.
T Consensus       107 p~~drqFaC~~Cd~~WwRrv  126 (278)
T PF15135_consen  107 PSVDRQFACSSCDHMWWRRV  126 (278)
T ss_pred             cccceeeeccccchHHHhcc
Confidence            34456699999988775544


No 146
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=59.42  E-value=4.6  Score=38.26  Aligned_cols=27  Identities=22%  Similarity=0.678  Sum_probs=16.1

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      .......|..||..               ...  |..|+.||..
T Consensus       236 ~~~~~l~Ch~Cg~~---------------~~~--~~~Cp~C~s~  262 (505)
T TIGR00595       236 KKEGKLRCHYCGYQ---------------EPI--PKTCPQCGSE  262 (505)
T ss_pred             cCCCeEEcCCCcCc---------------CCC--CCCCCCCCCC
Confidence            44456677777732               232  6677777653


No 147
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=58.60  E-value=1.1  Score=39.01  Aligned_cols=14  Identities=21%  Similarity=0.358  Sum_probs=5.8

Q ss_pred             CCCCcccCCCcccc
Q psy3485         182 MRRNFMCFACPYYC  195 (304)
Q Consensus       182 ~~~~~~C~~C~k~f  195 (304)
                      |.|...|..|+-.+
T Consensus       194 G~R~L~Cs~C~t~W  207 (290)
T PF04216_consen  194 GKRYLHCSLCGTEW  207 (290)
T ss_dssp             -EEEEEETTT--EE
T ss_pred             ccEEEEcCCCCCee
Confidence            34555565555443


No 148
>KOG2593|consensus
Probab=58.56  E-value=8.3  Score=35.06  Aligned_cols=18  Identities=11%  Similarity=0.248  Sum_probs=8.9

Q ss_pred             CCCcccCCCcccccChHH
Q psy3485         183 RRNFMCFACPYYCRYGSS  200 (304)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~  200 (304)
                      ..-|.|+.|.+.|+.-.+
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             cccccCCccccchhhhHH
Confidence            344555555555554433


No 149
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=58.37  E-value=7.4  Score=24.37  Aligned_cols=26  Identities=15%  Similarity=0.229  Sum_probs=15.3

Q ss_pred             ccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         249 HCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      .|..|++.|..            ..  +.+.|..||+.|-
T Consensus         4 ~C~~C~~~F~~------------~~--rk~~Cr~Cg~~~C   29 (57)
T cd00065           4 SCMGCGKPFTL------------TR--RRHHCRNCGRIFC   29 (57)
T ss_pred             cCcccCccccC------------Cc--cccccCcCcCCcC
Confidence            46667776664            11  3566666666663


No 150
>PRK04023 DNA polymerase II large subunit; Validated
Probab=57.95  E-value=8  Score=39.12  Aligned_cols=10  Identities=20%  Similarity=0.321  Sum_probs=5.5

Q ss_pred             CcccCCCccc
Q psy3485         185 NFMCFACPYY  194 (304)
Q Consensus       185 ~~~C~~C~k~  194 (304)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            3455556555


No 151
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=57.38  E-value=4.4  Score=31.22  Aligned_cols=32  Identities=19%  Similarity=0.284  Sum_probs=15.1

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIK  285 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k  285 (304)
                      +|.|. |+..|-+.   ++|-+.-.|+   .|.|..|+-
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~---~YrC~~C~g  148 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE---VYRCGKCGG  148 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc---eEEeccCCc
Confidence            45555 55554444   3443333333   355555543


No 152
>KOG4167|consensus
Probab=57.30  E-value=3.3  Score=39.96  Aligned_cols=24  Identities=33%  Similarity=0.486  Sum_probs=22.2

Q ss_pred             ccccccchhhccCHHHHHHHHHhhc
Q psy3485         213 PFACEMCNYRAASKIAIYAHMRTTH  237 (304)
Q Consensus       213 ~~~C~~C~k~F~~~~~L~~H~~~~H  237 (304)
                      -|.|..|+|.|-.-..++.||+ .|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK-~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMK-TH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHH-HH
Confidence            4999999999999999999999 66


No 153
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=56.40  E-value=6.4  Score=38.85  Aligned_cols=34  Identities=18%  Similarity=0.486  Sum_probs=16.9

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCc
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACP  192 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~  192 (304)
                      ..|..||..+       -|+.|+..+..|...+...|..||
T Consensus       436 l~C~~Cg~v~-------~Cp~Cd~~lt~H~~~~~L~CH~Cg  469 (730)
T COG1198         436 LLCRDCGYIA-------ECPNCDSPLTLHKATGQLRCHYCG  469 (730)
T ss_pred             eecccCCCcc-------cCCCCCcceEEecCCCeeEeCCCC
Confidence            3466666542       244444444444444455555554


No 154
>KOG3408|consensus
Probab=55.17  E-value=9.2  Score=28.22  Aligned_cols=27  Identities=19%  Similarity=0.210  Sum_probs=20.3

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHh
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      .|...|.|-.|.+-|.+...|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            455568888888888888888888764


No 155
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=55.05  E-value=5.3  Score=25.35  Aligned_cols=41  Identities=22%  Similarity=0.489  Sum_probs=21.7

Q ss_pred             CCcccCC--CcccccChHHHHHHHHhhCCCCcccccc----chhhccC
Q psy3485         184 RNFMCFA--CPYYCRYGSSMAIHLRTHTKEKPFACEM----CNYRAAS  225 (304)
Q Consensus       184 ~~~~C~~--C~k~f~~~~~l~~H~~~H~~~~~~~C~~----C~k~F~~  225 (304)
                      .+..|+.  |...+. +..|..|+..--..++..|..    |+..+..
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            4556766  334344 445777777655566777777    7766543


No 156
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=54.37  E-value=3.5  Score=25.53  Aligned_cols=25  Identities=16%  Similarity=0.146  Sum_probs=15.2

Q ss_pred             CcccCCCcccccchhHHHHHHhhcc
Q psy3485         277 PTIQPECIKILWSFLSYFIWISVDV  301 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~~~~  301 (304)
                      .|.|+.|++.|=---.+++|-++|+
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             eEECCCCCCccccCcChhhhccccC
Confidence            6888888888888888888877775


No 158
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=54.20  E-value=8.6  Score=24.08  Aligned_cols=18  Identities=11%  Similarity=0.283  Sum_probs=12.9

Q ss_pred             cccccCCccCCChHHHHH
Q psy3485         248 YHCAFCNFTSPTQWAINR  265 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~  265 (304)
                      +.|+.||..|..+...+.
T Consensus        29 W~C~~Cgh~w~~~v~~R~   46 (55)
T PF14311_consen   29 WKCPKCGHEWKASVNDRT   46 (55)
T ss_pred             EECCCCCCeeEccHhhhc
Confidence            688888888777755554


No 159
>PRK14873 primosome assembly protein PriA; Provisional
Probab=53.51  E-value=3.5  Score=40.38  Aligned_cols=47  Identities=19%  Similarity=0.315  Sum_probs=27.3

Q ss_pred             ccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         215 ACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       215 ~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      .|..||..+.-..- ...+. .|     .......|..||..               . .  +..|+.||..
T Consensus       385 ~C~~Cg~~~~C~~C-~~~L~-~h-----~~~~~l~Ch~CG~~---------------~-~--p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRTPARCRHC-TGPLG-LP-----SAGGTPRCRWCGRA---------------A-P--DWRCPRCGSD  431 (665)
T ss_pred             EhhhCcCeeECCCC-CCcee-Ee-----cCCCeeECCCCcCC---------------C-c--CccCCCCcCC
Confidence            56666655443210 01222 44     44457889999932               2 2  7899999875


No 160
>PRK04023 DNA polymerase II large subunit; Validated
Probab=53.15  E-value=13  Score=37.72  Aligned_cols=9  Identities=22%  Similarity=0.235  Sum_probs=5.6

Q ss_pred             cccCCCccc
Q psy3485         186 FMCFACPYY  194 (304)
Q Consensus       186 ~~C~~C~k~  194 (304)
                      +.|+.||..
T Consensus       639 frCP~CG~~  647 (1121)
T PRK04023        639 RRCPFCGTH  647 (1121)
T ss_pred             ccCCCCCCC
Confidence            566666655


No 161
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=52.87  E-value=6.9  Score=25.72  Aligned_cols=16  Identities=25%  Similarity=0.484  Sum_probs=8.8

Q ss_pred             CCCCcccCCCcccccC
Q psy3485         182 MRRNFMCFACPYYCRY  197 (304)
Q Consensus       182 ~~~~~~C~~C~k~f~~  197 (304)
                      ..+.|.|+.||..+..
T Consensus        43 ~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMDR   58 (69)
T ss_pred             ccceEEcCCCCCEECc
Confidence            3455666666665443


No 162
>KOG1280|consensus
Probab=52.74  E-value=14  Score=32.54  Aligned_cols=42  Identities=21%  Similarity=0.501  Sum_probs=33.8

Q ss_pred             CCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcc
Q psy3485         244 EERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIK  285 (304)
Q Consensus       244 ~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k  285 (304)
                      ...-|.|++|+++=.+-..|..|...-|.+......|++|+-
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            345799999999999999999999888887644457777763


No 163
>PF14369 zf-RING_3:  zinc-finger
Probab=52.07  E-value=9.5  Score=21.54  Aligned_cols=10  Identities=20%  Similarity=0.202  Sum_probs=5.9

Q ss_pred             ccCCCccccc
Q psy3485         187 MCFACPYYCR  196 (304)
Q Consensus       187 ~C~~C~k~f~  196 (304)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            3666666553


No 164
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=52.05  E-value=8.8  Score=29.11  Aligned_cols=23  Identities=17%  Similarity=0.063  Sum_probs=15.2

Q ss_pred             CcccCCCcccccchhHHHHHHhhccc
Q psy3485         277 PTIQPECIKILWSFLSYFIWISVDVN  302 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~~~~~  302 (304)
                      -..|=+|||.|.+-   .+|++.|+|
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-
T ss_pred             eeEEccCCcccchH---HHHHHHccC
Confidence            47999999999875   789888854


No 165
>KOG0978|consensus
Probab=51.70  E-value=5.4  Score=38.77  Aligned_cols=49  Identities=18%  Similarity=0.295  Sum_probs=30.5

Q ss_pred             cccCCCchHH----HHHHHHHHhhhhccccccCCCCCCcccCCCcccccChHHHHH
Q psy3485         152 FFCIHCNGCV----LYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYGSSMAI  203 (304)
Q Consensus       152 ~~C~~C~~~f----l~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~~~l~~  203 (304)
                      .+|+.|...|    +..=+...|..|-+++..+   |.-.||.||..|....-+..
T Consensus       644 LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~et---RqRKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  644 LKCSVCNTRWKDAVITKCGHVFCEECVQTRYET---RQRKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             eeCCCccCchhhHHHHhcchHHHHHHHHHHHHH---hcCCCCCCCCCCCccccccc
Confidence            6899999777    2222222377776654333   34489999999986654433


No 166
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=51.55  E-value=7.9  Score=29.18  Aligned_cols=27  Identities=22%  Similarity=0.453  Sum_probs=17.5

Q ss_pred             HHhhhhccccccCCCCCCcccCCCccccc
Q psy3485         168 DHCKLCLRRKRKNPMRRNFMCFACPYYCR  196 (304)
Q Consensus       168 ~hC~~C~~~~~~h~~~~~~~C~~C~k~f~  196 (304)
                      .||+.|+-.+-.++|  ..-|++|+..+.
T Consensus        29 ~hCp~Cg~PLF~KdG--~v~CPvC~~~~~   55 (131)
T COG1645          29 KHCPKCGTPLFRKDG--EVFCPVCGYREV   55 (131)
T ss_pred             hhCcccCCcceeeCC--eEECCCCCceEE
Confidence            347777766555555  367888886554


No 167
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=50.27  E-value=6.3  Score=34.06  Aligned_cols=77  Identities=16%  Similarity=0.280  Sum_probs=43.3

Q ss_pred             CCcccCCCcccccChHHHHHHHHhh----------CCC--CccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccc
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLRTH----------TKE--KPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCA  251 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~~H----------~~~--~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~  251 (304)
                      -|..|+.|.........|.+-..--          ++.  +.--|-.|.-.|....        .|+-...+....|.|+
T Consensus       321 LPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~--------~~~~~~~~ss~rY~Ce  392 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPP--------VSPFDESTSSGRYQCE  392 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCC--------CCcccccccccceech
Confidence            4667777776655444444322110          111  2223788887776532        2322222455678999


Q ss_pred             cCCccCCChHHHHHHHH
Q psy3485         252 FCNFTSPTQWAINRHTK  268 (304)
Q Consensus       252 ~C~k~F~~~~~L~~H~r  268 (304)
                      .|...|-.--+.--|..
T Consensus       393 ~CK~~FC~dCdvfiHe~  409 (421)
T COG5151         393 LCKSTFCSDCDVFIHET  409 (421)
T ss_pred             hhhhhhhhhhHHHHHHH
Confidence            99888877766655543


No 168
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.38  E-value=7.9  Score=25.96  Aligned_cols=18  Identities=17%  Similarity=0.547  Sum_probs=14.7

Q ss_pred             cccCCCchHH-HHHHHHHH
Q psy3485         152 FFCIHCNGCV-LYADLLDH  169 (304)
Q Consensus       152 ~~C~~C~~~f-l~~H~~~h  169 (304)
                      |.|..||..| +-++|...
T Consensus        13 Y~c~~cg~~~dvvq~~~dd   31 (82)
T COG2331          13 YECTECGNRFDVVQAMTDD   31 (82)
T ss_pred             EeecccchHHHHHHhcccC
Confidence            8999999999 77777643


No 169
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=48.88  E-value=8.7  Score=29.34  Aligned_cols=23  Identities=22%  Similarity=0.485  Sum_probs=12.3

Q ss_pred             ccCCCchHHHHHHHHHHhhhhccc
Q psy3485         153 FCIHCNGCVLYADLLDHCKLCLRR  176 (304)
Q Consensus       153 ~C~~C~~~fl~~H~~~hC~~C~~~  176 (304)
                      -|+.||+.|... ....|+.|.+.
T Consensus         5 nC~~CgklF~~~-~~~iCp~C~~~   27 (137)
T TIGR03826         5 NCPKCGRLFVKT-GRDVCPSCYEE   27 (137)
T ss_pred             cccccchhhhhc-CCccCHHHhHH
Confidence            377777777442 33335555543


No 170
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=48.65  E-value=18  Score=21.22  Aligned_cols=25  Identities=20%  Similarity=0.394  Sum_probs=16.6

Q ss_pred             CcccCCCcccccCh--HHHHHHHHhhC
Q psy3485         185 NFMCFACPYYCRYG--SSMAIHLRTHT  209 (304)
Q Consensus       185 ~~~C~~C~k~f~~~--~~l~~H~~~H~  209 (304)
                      ...|+.||..|..-  ..-..|.+-|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            35788888887643  55566766663


No 171
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=48.50  E-value=7.4  Score=30.12  Aligned_cols=10  Identities=20%  Similarity=0.597  Sum_probs=5.6

Q ss_pred             ccccccCCcc
Q psy3485         247 RYHCAFCNFT  256 (304)
Q Consensus       247 ~~~C~~C~k~  256 (304)
                      .|.|..||..
T Consensus       112 ~l~C~~Cg~~  121 (146)
T PF07295_consen  112 TLVCENCGHE  121 (146)
T ss_pred             eEecccCCCE
Confidence            3666666644


No 172
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=48.19  E-value=3.3  Score=36.85  Aligned_cols=65  Identities=17%  Similarity=0.312  Sum_probs=24.2

Q ss_pred             ccccccchhhccCHHHH---HHHHHhhcCCCCCCCC-CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         213 PFACEMCNYRAASKIAI---YAHMRTTHIMPDTSEE-RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       213 ~~~C~~C~k~F~~~~~L---~~H~~~~H~~~~~~~~-~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      -+.|.+|.+.+-.....   ..|....|     ... |-|.|..|++...            +.+.-+...|+.||..=.
T Consensus       252 av~C~~C~yt~~~~~~~C~~~~H~l~~~-----~a~KRFFkC~~C~~Rt~------------sl~r~P~~~C~~Cg~~~w  314 (344)
T PF09332_consen  252 AVTCKQCKYTAFKPSDRCKEEGHPLKWH-----DAVKRFFKCKDCGNRTI------------SLERLPKKHCSNCGSSKW  314 (344)
T ss_dssp             EEEETTT--EESS--HHHHHTT--EEEE-----EEE-EEEE-T-TS-EEE------------ESSSS--S--TTT-S---
T ss_pred             EEEcCCCCCcccCcchhHHhcCCceEEe-----eeeeeeEECCCCCCeee------------ecccCCCCCCCcCCcCce
Confidence            36777787665444332   34544444     343 4468888886532            222223467888886544


Q ss_pred             chhHHH
Q psy3485         289 SFLSYF  294 (304)
Q Consensus       289 ~~~~l~  294 (304)
                      .+.+|+
T Consensus       315 er~~M~  320 (344)
T PF09332_consen  315 ERTGML  320 (344)
T ss_dssp             EEE---
T ss_pred             eehhhh
Confidence            444443


No 173
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=47.69  E-value=9  Score=22.21  Aligned_cols=13  Identities=8%  Similarity=0.084  Sum_probs=9.4

Q ss_pred             CcccCCCcccccc
Q psy3485         277 PTIQPECIKILWS  289 (304)
Q Consensus       277 ~~~C~~C~k~F~~  289 (304)
                      +|.|..|++.|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            6778888877743


No 174
>KOG4124|consensus
Probab=47.62  E-value=2.3  Score=37.26  Aligned_cols=52  Identities=21%  Similarity=0.480  Sum_probs=36.4

Q ss_pred             CCCcccCC--CcccccChHHHHHHHHh-hC------------------CCCccccccchhhccCHHHHHHHHH
Q psy3485         183 RRNFMCFA--CPYYCRYGSSMAIHLRT-HT------------------KEKPFACEMCNYRAASKIAIYAHMR  234 (304)
Q Consensus       183 ~~~~~C~~--C~k~f~~~~~l~~H~~~-H~------------------~~~~~~C~~C~k~F~~~~~L~~H~~  234 (304)
                      .+++.|.+  |.+.+.....|..|... |.                  ..|+|+|++|.+.++....|..|..
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceee
Confidence            46789965  99999999888888654 52                  2356677777777666655555544


No 175
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=47.58  E-value=11  Score=20.69  Aligned_cols=26  Identities=19%  Similarity=0.316  Sum_probs=15.0

Q ss_pred             hhhhccccccCCCCCCcccCCCcccc
Q psy3485         170 CKLCLRRKRKNPMRRNFMCFACPYYC  195 (304)
Q Consensus       170 C~~C~~~~~~h~~~~~~~C~~C~k~f  195 (304)
                      |..|+-.+....+...-+|+.|+..+
T Consensus         6 C~~CG~~t~~~~~g~~r~C~~Cg~~~   31 (32)
T PF09297_consen    6 CGRCGAPTKPAPGGWARRCPSCGHEH   31 (32)
T ss_dssp             -TTT--BEEE-SSSS-EEESSSS-EE
T ss_pred             cCcCCccccCCCCcCEeECCCCcCEe
Confidence            66777777777777778888888643


No 176
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=46.61  E-value=6.4  Score=24.61  Aligned_cols=20  Identities=15%  Similarity=-0.037  Sum_probs=8.5

Q ss_pred             ccCCCcccccc--hhHHHHHHh
Q psy3485         279 IQPECIKILWS--FLSYFIWIS  298 (304)
Q Consensus       279 ~C~~C~k~F~~--~~~l~~h~~  298 (304)
                      .||+|+..|..  +..|+.+++
T Consensus        22 ~CPlC~r~l~~e~~~~li~~~~   43 (54)
T PF04423_consen   22 CCPLCGRPLDEEHRQELIKKYK   43 (54)
T ss_dssp             E-TTT--EE-HHHHHHHHHHHH
T ss_pred             cCCCCCCCCCHHHHHHHHHHHH
Confidence            67777777743  344444444


No 177
>KOG2593|consensus
Probab=46.39  E-value=20  Score=32.74  Aligned_cols=20  Identities=25%  Similarity=0.408  Sum_probs=9.9

Q ss_pred             CCCCccccccchhhccCHHH
Q psy3485         209 TKEKPFACEMCNYRAASKIA  228 (304)
Q Consensus       209 ~~~~~~~C~~C~k~F~~~~~  228 (304)
                      +...-|.|+.|.+.|+..-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             cccccccCCccccchhhhHH
Confidence            34444555555555554443


No 178
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=46.36  E-value=4.7  Score=24.30  Aligned_cols=9  Identities=22%  Similarity=0.154  Sum_probs=5.9

Q ss_pred             CcccCCCcc
Q psy3485         277 PTIQPECIK  285 (304)
Q Consensus       277 ~~~C~~C~k  285 (304)
                      .|+|..|++
T Consensus        37 ~~~C~~C~~   45 (46)
T PF12760_consen   37 RYRCKACRK   45 (46)
T ss_pred             eEECCCCCC
Confidence            577777664


No 179
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=46.29  E-value=7.3  Score=32.84  Aligned_cols=25  Identities=12%  Similarity=0.363  Sum_probs=13.1

Q ss_pred             CCccccccCCccCCChHHHHHHHHh
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      .+++.|+.||..-.-...|..=.|+
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~  231 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRS  231 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeec
Confidence            3566666666555444444433333


No 180
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=45.85  E-value=1.8  Score=25.28  Aligned_cols=10  Identities=30%  Similarity=0.763  Sum_probs=5.1

Q ss_pred             cccccCCccC
Q psy3485         248 YHCAFCNFTS  257 (304)
Q Consensus       248 ~~C~~C~k~F  257 (304)
                      |.|..||..|
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5555555444


No 181
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=45.80  E-value=15  Score=21.14  Aligned_cols=12  Identities=33%  Similarity=0.880  Sum_probs=4.6

Q ss_pred             ccccccCCccCC
Q psy3485         247 RYHCAFCNFTSP  258 (304)
Q Consensus       247 ~~~C~~C~k~F~  258 (304)
                      .|-|+.|++.|.
T Consensus         3 ryyCdyC~~~~~   14 (38)
T PF06220_consen    3 RYYCDYCKKYLT   14 (38)
T ss_dssp             S-B-TTT--B-S
T ss_pred             Ceecccccceec
Confidence            467777777773


No 182
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=45.79  E-value=6.3  Score=29.62  Aligned_cols=25  Identities=20%  Similarity=0.477  Sum_probs=16.8

Q ss_pred             ccccCCCchHH--HHHHHHHHhhhhcc
Q psy3485         151 QFFCIHCNGCV--LYADLLDHCKLCLR  175 (304)
Q Consensus       151 ~~~C~~C~~~f--l~~H~~~hC~~C~~  175 (304)
                      ++.|..||+.|  -...++.-|+.||-
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~GCP~CGg   27 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILSGCPECGG   27 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHccCcccCC
Confidence            36799999999  44456655666553


No 183
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=45.54  E-value=9.3  Score=28.14  Aligned_cols=12  Identities=17%  Similarity=0.227  Sum_probs=7.4

Q ss_pred             cccccCCccCCC
Q psy3485         248 YHCAFCNFTSPT  259 (304)
Q Consensus       248 ~~C~~C~k~F~~  259 (304)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            566666665544


No 184
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=45.37  E-value=11  Score=33.11  Aligned_cols=77  Identities=17%  Similarity=0.305  Sum_probs=45.1

Q ss_pred             CCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHH
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAI  263 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L  263 (304)
                      ..-.|++||..=.  .++ .+.....|.|...|..|+-.        +|+.            .-.|+.||..    ..|
T Consensus       186 ~~~~CPvCGs~P~--~s~-v~~~~~~G~RyL~CslC~te--------W~~~------------R~~C~~Cg~~----~~l  238 (309)
T PRK03564        186 QRQFCPVCGSMPV--SSV-VQIGTTQGLRYLHCNLCESE--------WHVV------------RVKCSNCEQS----GKL  238 (309)
T ss_pred             CCCCCCCCCCcch--hhe-eeccCCCCceEEEcCCCCCc--------cccc------------CccCCCCCCC----Cce
Confidence            4468999997522  111 13344567888999999933        2333            4579999963    122


Q ss_pred             HHHHHhhcCC--CCCCcccCCCcccccc
Q psy3485         264 NRHTKYTHMN--TSGPTIQPECIKILWS  289 (304)
Q Consensus       264 ~~H~r~h~~~--~~~~~~C~~C~k~F~~  289 (304)
                      ..+  +..++  ..+-..|..|+--++.
T Consensus       239 ~y~--~~~~~~~~~r~e~C~~C~~YlK~  264 (309)
T PRK03564        239 HYW--SLDSEQAAVKAESCGDCGTYLKI  264 (309)
T ss_pred             eee--eecCCCcceEeeeccccccccee
Confidence            211  11221  1145799999876654


No 185
>PRK14873 primosome assembly protein PriA; Provisional
Probab=45.22  E-value=12  Score=36.86  Aligned_cols=35  Identities=17%  Similarity=0.375  Sum_probs=20.2

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCcc
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPY  193 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k  193 (304)
                      ..|..||..+       .|+.|+-.+..|.......|..||.
T Consensus       384 l~C~~Cg~~~-------~C~~C~~~L~~h~~~~~l~Ch~CG~  418 (665)
T PRK14873        384 LACARCRTPA-------RCRHCTGPLGLPSAGGTPRCRWCGR  418 (665)
T ss_pred             eEhhhCcCee-------ECCCCCCceeEecCCCeeECCCCcC
Confidence            4677777652       3555555555555555556666663


No 186
>KOG3408|consensus
Probab=45.21  E-value=13  Score=27.51  Aligned_cols=28  Identities=25%  Similarity=0.567  Sum_probs=23.7

Q ss_pred             CCCCCCcccCCCcccccChHHHHHHHHh
Q psy3485         180 NPMRRNFMCFACPYYCRYGSSMAIHLRT  207 (304)
Q Consensus       180 h~~~~~~~C~~C~k~f~~~~~l~~H~~~  207 (304)
                      -.|-..|-|-.|.+-|.+..+|..|.++
T Consensus        52 lPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   52 LPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            3456779999999999999999999875


No 187
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=44.66  E-value=12  Score=38.97  Aligned_cols=36  Identities=17%  Similarity=0.373  Sum_probs=22.7

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCccccc
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCR  196 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~  196 (304)
                      +.|+.||..-..    .-|+.|+..+.     .+|.|+.||....
T Consensus       668 rkCPkCG~~t~~----~fCP~CGs~te-----~vy~CPsCGaev~  703 (1337)
T PRK14714        668 RRCPSCGTETYE----NRCPDCGTHTE-----PVYVCPDCGAEVP  703 (1337)
T ss_pred             EECCCCCCcccc----ccCcccCCcCC-----CceeCccCCCccC
Confidence            789999974211    14777776653     2467777777644


No 188
>KOG0782|consensus
Probab=44.40  E-value=4.3  Score=38.09  Aligned_cols=35  Identities=23%  Similarity=0.367  Sum_probs=22.0

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCC-CccccccchhhccCHH
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKE-KPFACEMCNYRAASKI  227 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~-~~~~C~~C~k~F~~~~  227 (304)
                      +|.+|||.|.++..      -|..+ -...|..|...|-.+.
T Consensus       255 kC~~CgKgFQQKf~------FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  255 KCNTCGKGFQQKFF------FHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchhhhhhhhhee------eccccEEEEEehHHHHHhhcch
Confidence            67788888776632      23322 2367788887777665


No 189
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=44.25  E-value=2.1  Score=30.34  Aligned_cols=37  Identities=14%  Similarity=0.430  Sum_probs=18.4

Q ss_pred             CCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccc
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKIL  287 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F  287 (304)
                      .+.|.|+.||..-.+.-.++     -+.+. -...|..||.+|
T Consensus        20 ~k~FtCp~Cghe~vs~ctvk-----k~~~~-g~~~Cg~CGls~   56 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVK-----KTVNI-GTAVCGNCGLSF   56 (104)
T ss_pred             CceEecCccCCeeeeEEEEE-----ecCce-eEEEcccCcceE
Confidence            35577777776544332211     01111 135677777776


No 190
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=44.04  E-value=6.1  Score=27.68  Aligned_cols=15  Identities=13%  Similarity=0.233  Sum_probs=8.9

Q ss_pred             CCCCcccCCCccccc
Q psy3485         182 MRRNFMCFACPYYCR  196 (304)
Q Consensus       182 ~~~~~~C~~C~k~f~  196 (304)
                      +...+.|.-|++.|.
T Consensus        51 a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         51 AVGIWRCKGCKKTVA   65 (90)
T ss_pred             eeEEEEcCCCCCEEe
Confidence            334566666666664


No 191
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=43.48  E-value=3.3  Score=28.96  Aligned_cols=27  Identities=19%  Similarity=0.395  Sum_probs=13.0

Q ss_pred             hhhhccccccCCCCCCcccCCCccccc
Q psy3485         170 CKLCLRRKRKNPMRRNFMCFACPYYCR  196 (304)
Q Consensus       170 C~~C~~~~~~h~~~~~~~C~~C~k~f~  196 (304)
                      |+.|++......+..-|.|.-|++.|.
T Consensus        38 Cp~Cgk~~vkR~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   38 CPFCGKTSVKRVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             ESSSSSSEEEEEETTEEEETTTTEEEE
T ss_pred             CCCCCCceeEEeeeEEeecCCCCCEEe
Confidence            333333333333334466666766664


No 192
>KOG4727|consensus
Probab=43.16  E-value=12  Score=29.40  Aligned_cols=22  Identities=9%  Similarity=0.092  Sum_probs=18.2

Q ss_pred             CcccCCCcccccchhHHHHHHh
Q psy3485         277 PTIQPECIKILWSFLSYFIWIS  298 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~  298 (304)
                      -|.|.+|.-.|...-+++.||-
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            3888888888888888888873


No 193
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.13  E-value=7.7  Score=29.61  Aligned_cols=10  Identities=20%  Similarity=0.524  Sum_probs=4.6

Q ss_pred             cccCCCchHH
Q psy3485         152 FFCIHCNGCV  161 (304)
Q Consensus       152 ~~C~~C~~~f  161 (304)
                      +.|..||..|
T Consensus        71 ~~C~~CG~~~   80 (135)
T PRK03824         71 LKCRNCGNEW   80 (135)
T ss_pred             EECCCCCCEE
Confidence            4444444444


No 194
>PF12907 zf-met2:  Zinc-binding
Probab=43.00  E-value=24  Score=20.61  Aligned_cols=7  Identities=29%  Similarity=0.894  Sum_probs=3.3

Q ss_pred             ccCCCcc
Q psy3485         187 MCFACPY  193 (304)
Q Consensus       187 ~C~~C~k  193 (304)
                      +|.+|..
T Consensus         3 ~C~iC~q    9 (40)
T PF12907_consen    3 ICKICRQ    9 (40)
T ss_pred             CcHHhhH
Confidence            4444443


No 195
>KOG0717|consensus
Probab=42.92  E-value=14  Score=34.05  Aligned_cols=22  Identities=18%  Similarity=0.422  Sum_probs=19.3

Q ss_pred             cccccCCccCCChHHHHHHHHh
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      +-|.+|+|+|++...|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999754


No 196
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=42.44  E-value=12  Score=18.93  Aligned_cols=6  Identities=33%  Similarity=0.855  Sum_probs=2.9

Q ss_pred             cCCCcc
Q psy3485         188 CFACPY  193 (304)
Q Consensus       188 C~~C~k  193 (304)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444544


No 197
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=42.12  E-value=6.8  Score=29.47  Aligned_cols=18  Identities=17%  Similarity=0.342  Sum_probs=13.3

Q ss_pred             CccccCCCchHHHHHHHH
Q psy3485         150 DQFFCIHCNGCVLYADLL  167 (304)
Q Consensus       150 ~~~~C~~C~~~fl~~H~~  167 (304)
                      +-|.|.+|..+...+|..
T Consensus        79 ~lYeCnIC~etS~ee~FL   96 (140)
T PF05290_consen   79 KLYECNICKETSAEERFL   96 (140)
T ss_pred             CceeccCcccccchhhcC
Confidence            349999999887665554


No 198
>KOG2636|consensus
Probab=41.90  E-value=16  Score=33.32  Aligned_cols=27  Identities=26%  Similarity=0.609  Sum_probs=19.7

Q ss_pred             hCCCCccccccch-hhccCHHHHHHHHH
Q psy3485         208 HTKEKPFACEMCN-YRAASKIAIYAHMR  234 (304)
Q Consensus       208 H~~~~~~~C~~C~-k~F~~~~~L~~H~~  234 (304)
                      |-=...|.|.+|| ++|..+.++.+|-.
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            4445568888888 88888888888843


No 199
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=41.76  E-value=11  Score=29.05  Aligned_cols=19  Identities=16%  Similarity=0.184  Sum_probs=14.1

Q ss_pred             CCcccCCCcccccChHHHH
Q psy3485         184 RNFMCFACPYYCRYGSSMA  202 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~  202 (304)
                      +.=.|..||+.|++.....
T Consensus        27 RRReC~~C~~RFTTyErve   45 (147)
T TIGR00244        27 RRRECLECHERFTTFERAE   45 (147)
T ss_pred             ecccCCccCCccceeeecc
Confidence            4568999999998875443


No 200
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=41.71  E-value=4.3  Score=39.32  Aligned_cols=57  Identities=19%  Similarity=0.371  Sum_probs=42.0

Q ss_pred             ccccchhhccCHHHHHHHHHhhcCCCCCCCCCcc-ccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         215 ACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRY-HCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       215 ~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~-~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      .|..||=.|+--..|-.-..  +     |.-+.| -|+.|.+.|....+     |.+|-+   |..|+.||=.
T Consensus       125 ~CT~CGPRfTIi~alPYDR~--n-----TsM~~F~lC~~C~~EY~dP~n-----RRfHAQ---p~aCp~CGP~  182 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRE--N-----TSMADFPLCPFCDKEYKDPLN-----RRFHAQ---PIACPKCGPH  182 (750)
T ss_pred             ccCCCCcceeeeccCCCCcc--c-----CccccCcCCHHHHHHhcCccc-----cccccc---cccCcccCCC
Confidence            59999999998766644333  3     555666 79999999888755     334454   8999999964


No 201
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=40.83  E-value=8.5  Score=22.78  Aligned_cols=11  Identities=27%  Similarity=0.338  Sum_probs=6.8

Q ss_pred             CcccCCCcccc
Q psy3485         277 PTIQPECIKIL  287 (304)
Q Consensus       277 ~~~C~~C~k~F  287 (304)
                      ++.|+.|++.|
T Consensus        13 ~~~C~~C~~~F   23 (43)
T PF01428_consen   13 PFKCKHCGKSF   23 (43)
T ss_dssp             HEE-TTTS-EE
T ss_pred             CeECCCCCccc
Confidence            67777777777


No 202
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=40.59  E-value=11  Score=20.93  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=6.2

Q ss_pred             CCcccCCCcccc
Q psy3485         184 RNFMCFACPYYC  195 (304)
Q Consensus       184 ~~~~C~~C~k~f  195 (304)
                      -.+.|..|+.+|
T Consensus        20 ~~~~C~~Cg~~~   31 (33)
T PF08792_consen   20 DYEVCIFCGSSF   31 (33)
T ss_pred             CeEEcccCCcEe
Confidence            344555555554


No 203
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=40.52  E-value=14  Score=32.44  Aligned_cols=77  Identities=18%  Similarity=0.260  Sum_probs=42.4

Q ss_pred             CcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHH
Q psy3485         185 NFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAIN  264 (304)
Q Consensus       185 ~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~  264 (304)
                      .-.|++||..=.  .++...-....|.|...|..|+-.        +|+.            .-.|+.||.+-    .|.
T Consensus       184 ~~~CPvCGs~P~--~s~~~~~~~~~G~RyL~CslC~te--------W~~~------------R~~C~~Cg~~~----~l~  237 (305)
T TIGR01562       184 RTLCPACGSPPV--ASMVRQGGKETGLRYLSCSLCATE--------WHYV------------RVKCSHCEESK----HLA  237 (305)
T ss_pred             CCcCCCCCChhh--hhhhcccCCCCCceEEEcCCCCCc--------cccc------------CccCCCCCCCC----cee
Confidence            348999997521  111111112567788899999933        2333            45799999741    122


Q ss_pred             HHHHhhcC--CC--CCCcccCCCcccccc
Q psy3485         265 RHTKYTHM--NT--SGPTIQPECIKILWS  289 (304)
Q Consensus       265 ~H~r~h~~--~~--~~~~~C~~C~k~F~~  289 (304)
                      ..  +..+  +.  .+-..|..|+--++.
T Consensus       238 y~--~~e~~~~~~~~r~e~C~~C~~YlK~  264 (305)
T TIGR01562       238 YL--SLEHDAEKAVLKAETCDSCQGYLKI  264 (305)
T ss_pred             eE--eecCCCCCcceEEeeccccccchhh
Confidence            11  1111  11  135689999865544


No 204
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=40.08  E-value=7.2  Score=27.35  Aligned_cols=15  Identities=13%  Similarity=0.217  Sum_probs=9.1

Q ss_pred             CCCCcccCCCccccc
Q psy3485         182 MRRNFMCFACPYYCR  196 (304)
Q Consensus       182 ~~~~~~C~~C~k~f~  196 (304)
                      +...+.|.-|++.|.
T Consensus        50 a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        50 STGIWTCRKCGAKFA   64 (91)
T ss_pred             eeEEEEcCCCCCEEe
Confidence            344566666666664


No 205
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=39.52  E-value=14  Score=26.67  Aligned_cols=28  Identities=21%  Similarity=0.335  Sum_probs=17.8

Q ss_pred             ccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccc
Q psy3485         249 HCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWS  289 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~  289 (304)
                      .|+.|+..|.+.          -+.   .|.|+.|+..++.
T Consensus         4 ~CP~C~seytY~----------dg~---~~iCpeC~~EW~~   31 (109)
T TIGR00686         4 PCPKCNSEYTYH----------DGT---QLICPSCLYEWNE   31 (109)
T ss_pred             cCCcCCCcceEe----------cCC---eeECccccccccc
Confidence            477777766543          233   6788888777653


No 206
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=39.03  E-value=8.4  Score=29.94  Aligned_cols=32  Identities=22%  Similarity=0.292  Sum_probs=17.7

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      .|.|..|+..+      .+|.+.  ..  ..|.|..|+-.|.
T Consensus       123 ~~~C~~C~~~~------~r~~~~--~~--~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREY------KRHRRS--KR--KRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEe------eeeccc--ch--hhEECCCCCCEEE
Confidence            46777777665      233333  11  1477777776553


No 207
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=38.60  E-value=18  Score=19.81  Aligned_cols=24  Identities=17%  Similarity=0.246  Sum_probs=15.0

Q ss_pred             hhhhccccccCCCCCCcccCCCcc
Q psy3485         170 CKLCLRRKRKNPMRRNFMCFACPY  193 (304)
Q Consensus       170 C~~C~~~~~~h~~~~~~~C~~C~k  193 (304)
                      |..|+..+..-.+...++|..|..
T Consensus         4 C~~C~t~L~yP~gA~~vrCs~C~~   27 (31)
T TIGR01053         4 CGGCRTLLMYPRGASSVRCALCQT   27 (31)
T ss_pred             cCCCCcEeecCCCCCeEECCCCCe
Confidence            444555566666677777777754


No 208
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.43  E-value=18  Score=34.27  Aligned_cols=36  Identities=19%  Similarity=0.446  Sum_probs=22.6

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCccc
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYY  194 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~  194 (304)
                      ..|..||..       .-|+.|+-.+..|.......|..||..
T Consensus       214 ~~C~~Cg~~-------~~C~~C~~~l~~h~~~~~l~Ch~Cg~~  249 (505)
T TIGR00595       214 LLCRSCGYI-------LCCPNCDVSLTYHKKEGKLRCHYCGYQ  249 (505)
T ss_pred             eEhhhCcCc-------cCCCCCCCceEEecCCCeEEcCCCcCc
Confidence            467777765       236666666666666666667666643


No 209
>KOG0717|consensus
Probab=38.12  E-value=18  Score=33.38  Aligned_cols=22  Identities=14%  Similarity=0.368  Sum_probs=20.3

Q ss_pred             cccCCCcccccChHHHHHHHHh
Q psy3485         186 FMCFACPYYCRYGSSMAIHLRT  207 (304)
Q Consensus       186 ~~C~~C~k~f~~~~~l~~H~~~  207 (304)
                      +-|.+|+|+|.+..+|..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999765


No 210
>PTZ00448 hypothetical protein; Provisional
Probab=37.91  E-value=23  Score=31.76  Aligned_cols=23  Identities=22%  Similarity=0.349  Sum_probs=20.7

Q ss_pred             ccccccCCccCCChHHHHHHHHh
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      .|.|..|+-.|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999999999999986


No 211
>KOG0402|consensus
Probab=37.57  E-value=17  Score=24.84  Aligned_cols=27  Identities=19%  Similarity=0.461  Sum_probs=13.8

Q ss_pred             hhhhccccccCCCCCCcccCCCccccc
Q psy3485         170 CKLCLRRKRKNPMRRNFMCFACPYYCR  196 (304)
Q Consensus       170 C~~C~~~~~~h~~~~~~~C~~C~k~f~  196 (304)
                      |+.|++.........-|.|.-|.+.|.
T Consensus        39 CsfCGK~~vKR~AvGiW~C~~C~kv~a   65 (92)
T KOG0402|consen   39 CSFCGKKTVKRKAVGIWKCGSCKKVVA   65 (92)
T ss_pred             hhhcchhhhhhhceeEEecCCccceec
Confidence            333333333333445577777776664


No 212
>PRK05580 primosome assembly protein PriA; Validated
Probab=37.46  E-value=17  Score=35.95  Aligned_cols=27  Identities=30%  Similarity=0.666  Sum_probs=18.1

Q ss_pred             CCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccc
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKI  286 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~  286 (304)
                      ...+...|..||..               ...  +..|+.||..
T Consensus       404 ~~~~~l~Ch~Cg~~---------------~~~--~~~Cp~Cg~~  430 (679)
T PRK05580        404 RFQRRLRCHHCGYQ---------------EPI--PKACPECGST  430 (679)
T ss_pred             CCCCeEECCCCcCC---------------CCC--CCCCCCCcCC
Confidence            44556788888833               333  6788888765


No 213
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=37.41  E-value=13  Score=20.94  Aligned_cols=14  Identities=21%  Similarity=0.116  Sum_probs=6.9

Q ss_pred             cccCCCcccccchh
Q psy3485         278 TIQPECIKILWSFL  291 (304)
Q Consensus       278 ~~C~~C~k~F~~~~  291 (304)
                      -.|..||+.|..++
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            46888888886654


No 214
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.33  E-value=10  Score=28.07  Aligned_cols=39  Identities=23%  Similarity=0.237  Sum_probs=16.8

Q ss_pred             ccCCCcccccChHHHHHHHHh-hCCCCccccccchhhccC
Q psy3485         187 MCFACPYYCRYGSSMAIHLRT-HTKEKPFACEMCNYRAAS  225 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~-H~~~~~~~C~~C~k~F~~  225 (304)
                      +|+.|+.+........-=+.. |.=+-|--|..||+.|.+
T Consensus        41 qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpw   80 (160)
T COG4306          41 QCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPW   80 (160)
T ss_pred             cCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCc
Confidence            566666554443211111111 222334446666666655


No 215
>PRK10220 hypothetical protein; Provisional
Probab=36.95  E-value=21  Score=25.92  Aligned_cols=29  Identities=28%  Similarity=0.398  Sum_probs=17.8

Q ss_pred             ccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccch
Q psy3485         249 HCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSF  290 (304)
Q Consensus       249 ~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~  290 (304)
                      .|+.|+..|.+.          -+.   .|.|+.|+..++..
T Consensus         5 ~CP~C~seytY~----------d~~---~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYE----------DNG---MYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEc----------CCC---eEECCcccCcCCcc
Confidence            477777666532          222   57788777777543


No 216
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=36.65  E-value=21  Score=28.50  Aligned_cols=19  Identities=11%  Similarity=0.410  Sum_probs=10.3

Q ss_pred             CCCCCcccCCCcccccChH
Q psy3485         181 PMRRNFMCFACPYYCRYGS  199 (304)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~  199 (304)
                      .....|.|+.|...|+.-.
T Consensus       109 ~~~~~y~C~~~~~r~sfde  127 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDE  127 (176)
T ss_pred             ccCCceeCCCCCCcccHHH
Confidence            3344566666665555443


No 217
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=36.16  E-value=7.6  Score=23.74  Aligned_cols=16  Identities=25%  Similarity=0.511  Sum_probs=9.0

Q ss_pred             cccCCCchHHHHHHHH
Q psy3485         152 FFCIHCNGCVLYADLL  167 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~  167 (304)
                      |.|+.|..+|....++
T Consensus         8 y~CDLCn~~~p~~~LR   23 (57)
T PF14445_consen    8 YSCDLCNSSHPISELR   23 (57)
T ss_pred             HhHHhhcccCcHHHHH
Confidence            6666666666444433


No 218
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=35.86  E-value=11  Score=27.11  Aligned_cols=36  Identities=11%  Similarity=0.067  Sum_probs=19.4

Q ss_pred             CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccch
Q psy3485         246 RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSF  290 (304)
Q Consensus       246 ~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~  290 (304)
                      ..|.|+.||. ..-...+.+      +.  .-..|+.||..|...
T Consensus        20 t~f~CP~Cge-~~v~v~~~k------~~--~h~~C~~CG~y~~~~   55 (99)
T PRK14892         20 KIFECPRCGK-VSISVKIKK------NI--AIITCGNCGLYTEFE   55 (99)
T ss_pred             cEeECCCCCC-eEeeeecCC------Cc--ceEECCCCCCccCEE
Confidence            4578888882 222111211      22  245788888877543


No 219
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=35.59  E-value=20  Score=22.01  Aligned_cols=12  Identities=17%  Similarity=0.335  Sum_probs=5.3

Q ss_pred             CcccCCCccccc
Q psy3485         185 NFMCFACPYYCR  196 (304)
Q Consensus       185 ~~~C~~C~k~f~  196 (304)
                      .+.|..||..|.
T Consensus         4 ~l~C~dCg~~Fv   15 (49)
T PF13451_consen    4 TLTCKDCGAEFV   15 (49)
T ss_pred             eEEcccCCCeEE
Confidence            344444444444


No 220
>KOG2071|consensus
Probab=35.58  E-value=23  Score=33.72  Aligned_cols=31  Identities=10%  Similarity=0.180  Sum_probs=24.0

Q ss_pred             CCCccccccCCccCCChHHHHHHHHhhcCCC
Q psy3485         244 EERRYHCAFCNFTSPTQWAINRHTKYTHMNT  274 (304)
Q Consensus       244 ~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~  274 (304)
                      ...+-.|..||++|........||-.|-..+
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~dwh  445 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDDWH  445 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhhhh
Confidence            3456889999999998888888887776543


No 221
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=35.50  E-value=19  Score=32.88  Aligned_cols=14  Identities=14%  Similarity=0.527  Sum_probs=8.2

Q ss_pred             ccccccCCccCCCh
Q psy3485         247 RYHCAFCNFTSPTQ  260 (304)
Q Consensus       247 ~~~C~~C~k~F~~~  260 (304)
                      -|.|+.||..+.+.
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56666666655544


No 222
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=35.37  E-value=7.3  Score=28.70  Aligned_cols=15  Identities=20%  Similarity=0.487  Sum_probs=8.8

Q ss_pred             CCcccCCCcccccCh
Q psy3485         184 RNFMCFACPYYCRYG  198 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~  198 (304)
                      ..+.|.-||..+...
T Consensus        21 ~~l~C~kCgye~~~~   35 (113)
T COG1594          21 GKLVCRKCGYEEEAS   35 (113)
T ss_pred             cEEECCCCCcchhcc
Confidence            356666666655444


No 223
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=35.10  E-value=13  Score=21.70  Aligned_cols=11  Identities=18%  Similarity=0.621  Sum_probs=5.6

Q ss_pred             ccccccCCccC
Q psy3485         247 RYHCAFCNFTS  257 (304)
Q Consensus       247 ~~~C~~C~k~F  257 (304)
                      +-.|++||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            34555555544


No 224
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=34.89  E-value=9.1  Score=26.81  Aligned_cols=16  Identities=13%  Similarity=0.094  Sum_probs=9.4

Q ss_pred             CCCCCcccCCCccccc
Q psy3485         181 PMRRNFMCFACPYYCR  196 (304)
Q Consensus       181 ~~~~~~~C~~C~k~f~  196 (304)
                      .+-..+.|.-|++.|.
T Consensus        50 ~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         50 VGTGIWECRKCGAKFA   65 (90)
T ss_pred             EEEEEEEcCCCCCEEe
Confidence            3344566666666664


No 225
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=34.51  E-value=15  Score=27.20  Aligned_cols=15  Identities=13%  Similarity=0.129  Sum_probs=7.7

Q ss_pred             CCCcccCCCcccccC
Q psy3485         183 RRNFMCFACPYYCRY  197 (304)
Q Consensus       183 ~~~~~C~~C~k~f~~  197 (304)
                      .-.+.|..|+..|..
T Consensus        68 p~~~~C~~Cg~~~~~   82 (115)
T TIGR00100        68 PVECECEDCSEEVSP   82 (115)
T ss_pred             CcEEEcccCCCEEec
Confidence            334555555555544


No 226
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=34.44  E-value=18  Score=27.94  Aligned_cols=32  Identities=28%  Similarity=0.621  Sum_probs=17.4

Q ss_pred             ccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccC
Q psy3485         213 PFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTS  257 (304)
Q Consensus       213 ~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F  257 (304)
                      .|.|..|+..+.      +|.| +      .....|.|..|+-.|
T Consensus       112 ~y~C~~C~~~~~------~~rr-~------~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR-S------NNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcc-c------cCcceEEcCCCCCEE
Confidence            467776776553      2333 2      222457777776554


No 227
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=34.00  E-value=20  Score=19.96  Aligned_cols=16  Identities=25%  Similarity=0.401  Sum_probs=8.9

Q ss_pred             cccCCCchHH----HHHHHH
Q psy3485         152 FFCIHCNGCV----LYADLL  167 (304)
Q Consensus       152 ~~C~~C~~~f----l~~H~~  167 (304)
                      |.|+.|++.+    +..|+.
T Consensus         5 ~~C~nC~R~v~a~RfA~HLe   24 (33)
T PF08209_consen    5 VECPNCGRPVAASRFAPHLE   24 (33)
T ss_dssp             EE-TTTSSEEEGGGHHHHHH
T ss_pred             EECCCCcCCcchhhhHHHHH
Confidence            5666666655    555554


No 228
>KOG2461|consensus
Probab=33.60  E-value=13  Score=33.89  Aligned_cols=87  Identities=6%  Similarity=-0.217  Sum_probs=57.9

Q ss_pred             CcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhh
Q psy3485         191 CPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYT  270 (304)
Q Consensus       191 C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h  270 (304)
                      ++..+.....+..|...+++..+.-+.++.+.+.....+..|.. .|     ..+.++.+..+...+.+...+..+..+|
T Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~  382 (396)
T KOG2461|consen  309 ARLSLPKQLVLDQSEVPATVSVWTGETIPVRTPAGQLIYTQSHS-ME-----VAEPTDMAPNQIWKIYHTGVLGFLIITT  382 (396)
T ss_pred             cCcccccccccccccccccccccCcCcccccccccccchhhhhh-cc-----cCCCCcccccccccceeccccceeeeec
Confidence            44555556666667777777777777777777777777777777 66     5666666665555555555566666666


Q ss_pred             cCCCCCCcccCCCcc
Q psy3485         271 HMNTSGPTIQPECIK  285 (304)
Q Consensus       271 ~~~~~~~~~C~~C~k  285 (304)
                      +...  .+.+..|++
T Consensus       383 ~~~~--~~~~~~~~~  395 (396)
T KOG2461|consen  383 DESE--CNNMSFVCK  395 (396)
T ss_pred             cccc--cccccccCC
Confidence            6665  677766654


No 229
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=33.16  E-value=21  Score=21.97  Aligned_cols=9  Identities=33%  Similarity=1.143  Sum_probs=4.1

Q ss_pred             ccccccchh
Q psy3485         213 PFACEMCNY  221 (304)
Q Consensus       213 ~~~C~~C~k  221 (304)
                      .+.|..||.
T Consensus        37 r~~C~~Cgy   45 (50)
T PRK00432         37 RWHCGKCGY   45 (50)
T ss_pred             cEECCCcCC
Confidence            344444443


No 230
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=32.89  E-value=5.6  Score=26.58  Aligned_cols=14  Identities=29%  Similarity=0.660  Sum_probs=4.7

Q ss_pred             ccccccCCccCCCh
Q psy3485         247 RYHCAFCNFTSPTQ  260 (304)
Q Consensus       247 ~~~C~~C~k~F~~~  260 (304)
                      ...|..|++.+...
T Consensus        41 ~v~Cg~C~~~~~~~   54 (71)
T PF05495_consen   41 RVICGKCRTEQPID   54 (71)
T ss_dssp             EEEETTT--EEES-
T ss_pred             CeECCCCCCccChh
Confidence            34444444444333


No 231
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=32.86  E-value=21  Score=20.79  Aligned_cols=21  Identities=14%  Similarity=0.142  Sum_probs=13.9

Q ss_pred             CcccCCCcccccchhHHHHHH
Q psy3485         277 PTIQPECIKILWSFLSYFIWI  297 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~  297 (304)
                      -+.|+.|+=.|-....|-..+
T Consensus        19 id~C~~C~G~W~d~~el~~~~   39 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEKLL   39 (41)
T ss_pred             EEECCCCCeEEccHHHHHHHH
Confidence            567777777776666665544


No 232
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=32.85  E-value=36  Score=26.81  Aligned_cols=11  Identities=45%  Similarity=0.924  Sum_probs=5.2

Q ss_pred             cccCCCccccc
Q psy3485         278 TIQPECIKILW  288 (304)
Q Consensus       278 ~~C~~C~k~F~  288 (304)
                      +.|+.||+-|.
T Consensus       131 ~~C~~CgkiYW  141 (165)
T COG1656         131 YRCPKCGKIYW  141 (165)
T ss_pred             eECCCCccccc
Confidence            44555544443


No 233
>COG4640 Predicted membrane protein [Function unknown]
Probab=32.73  E-value=27  Score=31.45  Aligned_cols=19  Identities=11%  Similarity=0.317  Sum_probs=12.0

Q ss_pred             ccccccCCccCCChHHHHH
Q psy3485         247 RYHCAFCNFTSPTQWAINR  265 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~  265 (304)
                      -++|+.||..|..+.++-+
T Consensus        15 ~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640          15 DVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             cccccccCCcCCchhhhhh
Confidence            3447777777776665544


No 234
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=32.43  E-value=17  Score=28.04  Aligned_cols=17  Identities=24%  Similarity=0.305  Sum_probs=12.4

Q ss_pred             CCCcccCCCcccccChH
Q psy3485         183 RRNFMCFACPYYCRYGS  199 (304)
Q Consensus       183 ~~~~~C~~C~k~f~~~~  199 (304)
                      .+.=.|..||..|++..
T Consensus        26 RRRReC~~C~~RFTTfE   42 (156)
T COG1327          26 RRRRECLECGERFTTFE   42 (156)
T ss_pred             hhhhcccccccccchhh
Confidence            34558888888888764


No 235
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=32.31  E-value=22  Score=29.90  Aligned_cols=18  Identities=17%  Similarity=0.218  Sum_probs=12.1

Q ss_pred             CCCCccccccchhhccCH
Q psy3485         209 TKEKPFACEMCNYRAASK  226 (304)
Q Consensus       209 ~~~~~~~C~~C~k~F~~~  226 (304)
                      +|-..|.|..|+..|+.-
T Consensus       151 wG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  151 WGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             cceeeeecccccccchhh
Confidence            444557788888777754


No 236
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=32.09  E-value=51  Score=20.75  Aligned_cols=29  Identities=17%  Similarity=0.434  Sum_probs=18.4

Q ss_pred             HHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHH
Q psy3485         228 AIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRH  266 (304)
Q Consensus       228 ~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H  266 (304)
                      .|...+|..|          +-|-.||..|.+...|.++
T Consensus        18 ~l~~YLR~~~----------~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   18 KLLSYLREEH----------NYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             HHHHHHHhhC----------ceeeeeCCccCCHHHHHhC
Confidence            4555556455          6677777777777666543


No 237
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=31.91  E-value=26  Score=20.63  Aligned_cols=17  Identities=12%  Similarity=0.229  Sum_probs=10.5

Q ss_pred             ccccchhhccCHHHHHH
Q psy3485         215 ACEMCNYRAASKIAIYA  231 (304)
Q Consensus       215 ~C~~C~k~F~~~~~L~~  231 (304)
                      .|.+||+.|+.+-...+
T Consensus        10 ~C~~C~rpf~WRKKW~~   26 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWAR   26 (42)
T ss_pred             cCcccCCcchHHHHHHH
Confidence            46777777766655443


No 238
>KOG0696|consensus
Probab=31.51  E-value=13  Score=33.96  Aligned_cols=47  Identities=19%  Similarity=0.335  Sum_probs=20.3

Q ss_pred             HHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCC
Q psy3485         202 AIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCN  254 (304)
Q Consensus       202 ~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~  254 (304)
                      ..|.|.|.= -.|.|+-=++.+.+-..-..|.-..|     +-..|--|.+||
T Consensus        82 vvHkrChef-VtF~CPGadkg~dtDdpr~kHkf~~~-----tYssPTFCDhCG  128 (683)
T KOG0696|consen   82 VVHKRCHEF-VTFSCPGADKGPDTDDPRSKHKFKIH-----TYSSPTFCDHCG  128 (683)
T ss_pred             hhhhhhcce-EEEECCCCCCCCCCCCcccccceeee-----ecCCCchhhhHH
Confidence            345454421 22444444444444444444433344     444444444444


No 239
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=31.50  E-value=16  Score=29.77  Aligned_cols=8  Identities=25%  Similarity=0.887  Sum_probs=0.0

Q ss_pred             CcccCCCc
Q psy3485         185 NFMCFACP  192 (304)
Q Consensus       185 ~~~C~~C~  192 (304)
                      .|.|.+||
T Consensus       101 ey~CEICG  108 (196)
T PF11931_consen  101 EYKCEICG  108 (196)
T ss_dssp             --------
T ss_pred             eeeeEeCC
Confidence            35555555


No 240
>PRK04351 hypothetical protein; Provisional
Probab=31.48  E-value=22  Score=27.63  Aligned_cols=32  Identities=16%  Similarity=0.201  Sum_probs=18.9

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCccccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILW  288 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~  288 (304)
                      .|.|..||..+.+.       |.|..   ..|.|..|+-.+.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~n~---~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRINT---KRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee-------eecCC---CcEEeCCCCcEee
Confidence            47777777666443       22222   2678888776654


No 241
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=31.43  E-value=38  Score=34.11  Aligned_cols=13  Identities=8%  Similarity=0.135  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHhh
Q psy3485          27 IIVARKMWTKLKK   39 (304)
Q Consensus        27 ~~iC~~C~~~l~~   39 (304)
                      ..++..=|..+..
T Consensus       606 R~~~~~vf~~~~~  618 (784)
T PF04931_consen  606 RKVSEQVFEAFCP  618 (784)
T ss_pred             HHHHHHHHHHHHh
Confidence            3444444554443


No 242
>PRK12496 hypothetical protein; Provisional
Probab=31.35  E-value=29  Score=27.43  Aligned_cols=10  Identities=20%  Similarity=0.301  Sum_probs=5.1

Q ss_pred             cccccCCccC
Q psy3485         248 YHCAFCNFTS  257 (304)
Q Consensus       248 ~~C~~C~k~F  257 (304)
                      |.|.-|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            4455555444


No 243
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=31.21  E-value=11  Score=23.06  Aligned_cols=16  Identities=19%  Similarity=0.382  Sum_probs=12.1

Q ss_pred             cccCCCch-HHHHHHHH
Q psy3485         152 FFCIHCNG-CVLYADLL  167 (304)
Q Consensus       152 ~~C~~C~~-~fl~~H~~  167 (304)
                      -.|+-||- +|+..|..
T Consensus        20 ~~CPrCG~gvfmA~H~d   36 (51)
T COG1998          20 RFCPRCGPGVFMADHKD   36 (51)
T ss_pred             ccCCCCCCcchhhhcCc
Confidence            46999996 77887764


No 244
>KOG2807|consensus
Probab=31.01  E-value=44  Score=29.34  Aligned_cols=73  Identities=19%  Similarity=0.316  Sum_probs=47.8

Q ss_pred             CccccccchhhccCHHHHHHHHHhhcCCCC------CCCC--CccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCC
Q psy3485         212 KPFACEMCNYRAASKIAIYAHMRTTHIMPD------TSEE--RRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPEC  283 (304)
Q Consensus       212 ~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~------~~~~--~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C  283 (304)
                      -|..|++|+-+......|.+-.+  |+.|-      +.++  +--.|-.|+-.             -.+.  ..|.|..|
T Consensus       289 LP~eCpiC~ltLVss~hLARSyh--hL~PL~~F~Eip~~~~~~~~~Cf~C~~~-------------~~~~--~~y~C~~C  351 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYH--HLFPLKPFVEIPETEYNGSRFCFACQGE-------------LLSS--GRYRCESC  351 (378)
T ss_pred             CCccCCccceeEecchHHHHHHH--hhcCCcchhhccccccCCCcceeeeccc-------------cCCC--CcEEchhc
Confidence            46788999988888888766544  55441      1122  11126666111             1112  26999999


Q ss_pred             cccccchhHHHHHHhhcc
Q psy3485         284 IKILWSFLSYFIWISVDV  301 (304)
Q Consensus       284 ~k~F~~~~~l~~h~~~~~  301 (304)
                      ...|=.--..++|-+.|.
T Consensus       352 k~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  352 KNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             cceeeccchHHHHhhhhc
Confidence            999999999999998885


No 245
>KOG0320|consensus
Probab=30.78  E-value=27  Score=27.84  Aligned_cols=53  Identities=13%  Similarity=0.238  Sum_probs=30.2

Q ss_pred             CCCCcccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHHHHHHHHHhhcCCCCCCCCCccccccCCccCCCh
Q psy3485         182 MRRNFMCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKIAIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQ  260 (304)
Q Consensus       182 ~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~  260 (304)
                      .+..|.|++|--.|..+.-              --..||..|-..-. +.-.+..           .+|+.|+|....+
T Consensus       128 ~~~~~~CPiCl~~~sek~~--------------vsTkCGHvFC~~Ci-k~alk~~-----------~~CP~C~kkIt~k  180 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVP--------------VSTKCGHVFCSQCI-KDALKNT-----------NKCPTCRKKITHK  180 (187)
T ss_pred             cccccCCCceecchhhccc--------------cccccchhHHHHHH-HHHHHhC-----------CCCCCcccccchh
Confidence            3445888888877766542              11347777765433 2333323           3688888754433


No 246
>PRK01343 zinc-binding protein; Provisional
Probab=30.68  E-value=28  Score=22.10  Aligned_cols=13  Identities=23%  Similarity=0.383  Sum_probs=8.6

Q ss_pred             CccccccCCccCC
Q psy3485         246 RRYHCAFCNFTSP  258 (304)
Q Consensus       246 ~~~~C~~C~k~F~  258 (304)
                      ....|++|+|.|.
T Consensus         8 p~~~CP~C~k~~~   20 (57)
T PRK01343          8 PTRPCPECGKPST   20 (57)
T ss_pred             CCCcCCCCCCcCc
Confidence            3456777777764


No 247
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=30.48  E-value=26  Score=25.18  Aligned_cols=26  Identities=23%  Similarity=0.179  Sum_probs=20.3

Q ss_pred             CCCCccccccCCccCCChHHHHHHHH
Q psy3485         243 SEERRYHCAFCNFTSPTQWAINRHTK  268 (304)
Q Consensus       243 ~~~~~~~C~~C~k~F~~~~~L~~H~r  268 (304)
                      .|-..|-|-.|.+-|.+...|..|.+
T Consensus        51 PGlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          51 PGLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCCceeeeehhHHHHHHHHHHHHHhc
Confidence            45556788888888888888888875


No 248
>KOG0782|consensus
Probab=30.16  E-value=17  Score=34.41  Aligned_cols=57  Identities=11%  Similarity=0.105  Sum_probs=35.6

Q ss_pred             HHHHHHHhhcCCCCCCCCCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchh--HHHHHH
Q psy3485         228 AIYAHMRTTHIMPDTSEERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFL--SYFIWI  297 (304)
Q Consensus       228 ~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~--~l~~h~  297 (304)
                      .|.+|-- +|     ....-=+|..|||.|..+-.      .|..+. --..|.-|-..|.++-  .|+.||
T Consensus       240 ~fvrHHW-VH-----rrRqeGkC~~CgKgFQQKf~------FhsKEi-vAisCSWCKqayH~KvtCFml~~i  298 (1004)
T KOG0782|consen  240 GFVRHHW-VH-----RRRQEGKCNTCGKGFQQKFF------FHSKEI-VAISCSWCKQAYHLKVTCFMLDKI  298 (1004)
T ss_pred             cchHHhH-hh-----Hhhhccccchhhhhhhhhee------eccccE-EEEEehHHHHHhhcchhhhhhhhh
Confidence            5555554 44     32223479999999877633      344443 3478999999997776  344444


No 249
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=29.99  E-value=27  Score=28.20  Aligned_cols=17  Identities=18%  Similarity=0.317  Sum_probs=11.4

Q ss_pred             CCCcccCCCcccccChH
Q psy3485         183 RRNFMCFACPYYCRYGS  199 (304)
Q Consensus       183 ~~~~~C~~C~k~f~~~~  199 (304)
                      .-||.|-+|-+.|....
T Consensus       194 ~IPF~C~iCKkdy~spv  210 (259)
T COG5152         194 KIPFLCGICKKDYESPV  210 (259)
T ss_pred             CCceeehhchhhccchh
Confidence            35677777777776653


No 250
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=29.85  E-value=28  Score=20.10  Aligned_cols=9  Identities=33%  Similarity=0.958  Sum_probs=3.8

Q ss_pred             cccccchhh
Q psy3485         214 FACEMCNYR  222 (304)
Q Consensus       214 ~~C~~C~k~  222 (304)
                      |.|..||+.
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            344444433


No 251
>KOG0957|consensus
Probab=29.77  E-value=32  Score=32.03  Aligned_cols=45  Identities=20%  Similarity=0.387  Sum_probs=31.4

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccc------------cccCCCCCCcccCCCcccccC
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRR------------KRKNPMRRNFMCFACPYYCRY  197 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~------------~~~h~~~~~~~C~~C~k~f~~  197 (304)
                      |.|-+|.++ ..+|++..|..|...            +......--|+|..|++.=++
T Consensus       545 ysCgiCkks-~dQHll~~CDtC~lhYHlGCL~PPLTR~Pkk~kn~gWqCsECdk~esS  601 (707)
T KOG0957|consen  545 YSCGICKKS-TDQHLLTQCDTCHLHYHLGCLSPPLTRLPKKNKNFGWQCSECDKNESS  601 (707)
T ss_pred             eeeeeeccc-hhhHHHhhcchhhceeeccccCCccccCcccccCcceeecccccccCc
Confidence            899999988 788988888888776            122222234788888765443


No 252
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=29.77  E-value=33  Score=31.94  Aligned_cols=32  Identities=22%  Similarity=0.335  Sum_probs=22.6

Q ss_pred             CCCCCCcccCCCcccccChHHHHHHHHh-hCCC
Q psy3485         180 NPMRRNFMCFACPYYCRYGSSMAIHLRT-HTKE  211 (304)
Q Consensus       180 h~~~~~~~C~~C~k~f~~~~~l~~H~~~-H~~~  211 (304)
                      +..=+-+.|+.|.+.|.....+..|+.. |.+.
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            3334567888888888888888888764 6543


No 253
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.61  E-value=21  Score=20.70  Aligned_cols=9  Identities=33%  Similarity=1.184  Sum_probs=3.7

Q ss_pred             Cccccccch
Q psy3485         212 KPFACEMCN  220 (304)
Q Consensus       212 ~~~~C~~C~  220 (304)
                      +.+.|..|+
T Consensus        23 ~~w~C~~C~   31 (40)
T PF04810_consen   23 KTWICNFCG   31 (40)
T ss_dssp             TEEEETTT-
T ss_pred             CEEECcCCC
Confidence            344444444


No 254
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=29.34  E-value=27  Score=19.84  Aligned_cols=10  Identities=20%  Similarity=0.577  Sum_probs=5.1

Q ss_pred             ccCCCccccc
Q psy3485         187 MCFACPYYCR  196 (304)
Q Consensus       187 ~C~~C~k~f~  196 (304)
                      .|+.||+.|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            4555555554


No 255
>KOG3214|consensus
Probab=29.00  E-value=16  Score=25.92  Aligned_cols=42  Identities=14%  Similarity=0.392  Sum_probs=21.1

Q ss_pred             CCccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccchhH
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWSFLS  292 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~~~~  292 (304)
                      +..|.|..|+..-.-.-.|.    .-+...  ...|.+|+.+|.+.-+
T Consensus        21 dt~FnClfcnHek~v~~~~D----k~~~iG--~~sC~iC~esFqt~it   62 (109)
T KOG3214|consen   21 DTQFNCLFCNHEKSVSCTLD----KKHNIG--KASCRICEESFQTTIT   62 (109)
T ss_pred             heeeccCccccccceeeeeh----hhcCcc--eeeeeehhhhhccchH
Confidence            34577777765432221111    112221  4677777777766544


No 256
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=28.55  E-value=29  Score=31.79  Aligned_cols=30  Identities=23%  Similarity=0.545  Sum_probs=17.3

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCccccccchhhccCHH
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPFACEMCNYRAASKI  227 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~k~F~~~~  227 (304)
                      .|+.||.+..+.           |..-|+|..||..+....
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCccc
Confidence            666777664333           223577777776665543


No 257
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=28.15  E-value=29  Score=19.70  Aligned_cols=13  Identities=31%  Similarity=0.475  Sum_probs=7.4

Q ss_pred             CcccCCCcccccc
Q psy3485         277 PTIQPECIKILWS  289 (304)
Q Consensus       277 ~~~C~~C~k~F~~  289 (304)
                      +-.|+-|+|+|--
T Consensus         2 ~~~CprC~kg~Hw   14 (36)
T PF14787_consen    2 PGLCPRCGKGFHW   14 (36)
T ss_dssp             --C-TTTSSSCS-
T ss_pred             CccCcccCCCcch
Confidence            4568999998843


No 258
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=28.08  E-value=22  Score=27.52  Aligned_cols=9  Identities=22%  Similarity=0.726  Sum_probs=6.5

Q ss_pred             cccCCCchH
Q psy3485         152 FFCIHCNGC  160 (304)
Q Consensus       152 ~~C~~C~~~  160 (304)
                      |.|..||..
T Consensus       113 l~C~~Cg~~  121 (146)
T PF07295_consen  113 LVCENCGHE  121 (146)
T ss_pred             EecccCCCE
Confidence            777777755


No 259
>PRK05580 primosome assembly protein PriA; Validated
Probab=27.92  E-value=34  Score=33.84  Aligned_cols=36  Identities=22%  Similarity=0.631  Sum_probs=20.1

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCccc
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYY  194 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~  194 (304)
                      ..|..||..       .-|+.|+-.+..|.......|..||..
T Consensus       382 ~~C~~Cg~~-------~~C~~C~~~l~~h~~~~~l~Ch~Cg~~  417 (679)
T PRK05580        382 LLCRDCGWV-------AECPHCDASLTLHRFQRRLRCHHCGYQ  417 (679)
T ss_pred             eEhhhCcCc-------cCCCCCCCceeEECCCCeEECCCCcCC
Confidence            457777755       225555555555555555566666543


No 260
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=27.89  E-value=22  Score=25.55  Aligned_cols=22  Identities=9%  Similarity=0.048  Sum_probs=20.6

Q ss_pred             CcccCCCcccccchhHHHHHHh
Q psy3485         277 PTIQPECIKILWSFLSYFIWIS  298 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~~  298 (304)
                      .|.|-.|.+-|-+...|+.|.+
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            5999999999999999999986


No 261
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=27.37  E-value=35  Score=24.39  Aligned_cols=14  Identities=14%  Similarity=0.252  Sum_probs=9.8

Q ss_pred             ccccccCCccCCCh
Q psy3485         247 RYHCAFCNFTSPTQ  260 (304)
Q Consensus       247 ~~~C~~C~k~F~~~  260 (304)
                      |+.|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            56777777777764


No 262
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=27.11  E-value=9.7  Score=37.70  Aligned_cols=39  Identities=18%  Similarity=0.308  Sum_probs=20.1

Q ss_pred             ccCCCcccccChHHHHHHHHhhCCCCcc-ccccchhhccCH
Q psy3485         187 MCFACPYYCRYGSSMAIHLRTHTKEKPF-ACEMCNYRAASK  226 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~~H~~~~~~-~C~~C~k~F~~~  226 (304)
                      .|..||=+|+-...|-.- |.++.-+.| -|+.|-+.|.+.
T Consensus        92 nCt~CGPr~~i~~~lpyd-r~~t~m~~f~~C~~C~~ey~~p  131 (711)
T TIGR00143        92 SCTHCGPRFTIIEALPYD-RENTSMADFPLCPDCAKEYKDP  131 (711)
T ss_pred             cccCCCCCeEEeecCCCC-CCCcCCCCCcCCHHHHHHhcCC
Confidence            566677666644433221 123333334 477777666654


No 263
>KOG2807|consensus
Probab=27.03  E-value=79  Score=27.87  Aligned_cols=22  Identities=14%  Similarity=0.159  Sum_probs=16.3

Q ss_pred             CCCcccCCCcccccChHHHHHH
Q psy3485         183 RRNFMCFACPYYCRYGSSMAIH  204 (304)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~l~~H  204 (304)
                      .-|..|++|+.+......|.+-
T Consensus       288 sLP~eCpiC~ltLVss~hLARS  309 (378)
T KOG2807|consen  288 SLPIECPICSLTLVSSPHLARS  309 (378)
T ss_pred             cCCccCCccceeEecchHHHHH
Confidence            3567888888888777776653


No 264
>PRK11827 hypothetical protein; Provisional
Probab=26.74  E-value=34  Score=22.04  Aligned_cols=28  Identities=14%  Similarity=0.326  Sum_probs=13.0

Q ss_pred             hhhhccccccCCCCCCcccCCCcccccC
Q psy3485         170 CKLCLRRKRKNPMRRNFMCFACPYYCRY  197 (304)
Q Consensus       170 C~~C~~~~~~h~~~~~~~C~~C~k~f~~  197 (304)
                      |+.|.-.+....+.....|..|+..|.-
T Consensus        11 CP~ckg~L~~~~~~~~Lic~~~~laYPI   38 (60)
T PRK11827         11 CPVCNGKLWYNQEKQELICKLDNLAFPL   38 (60)
T ss_pred             CCCCCCcCeEcCCCCeEECCccCeeccc
Confidence            3333333333333344556666666543


No 265
>COG1773 Rubredoxin [Energy production and conversion]
Probab=26.64  E-value=28  Score=21.96  Aligned_cols=11  Identities=9%  Similarity=-0.079  Sum_probs=7.1

Q ss_pred             CcccCCCcccc
Q psy3485         277 PTIQPECIKIL  287 (304)
Q Consensus       277 ~~~C~~C~k~F  287 (304)
                      .|+|..||..|
T Consensus         3 ~~~C~~CG~vY   13 (55)
T COG1773           3 RWRCSVCGYVY   13 (55)
T ss_pred             ceEecCCceEe
Confidence            46677776655


No 266
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=26.51  E-value=19  Score=22.74  Aligned_cols=9  Identities=22%  Similarity=0.501  Sum_probs=4.2

Q ss_pred             ccCCCcccc
Q psy3485         187 MCFACPYYC  195 (304)
Q Consensus       187 ~C~~C~k~f  195 (304)
                      +|-.|++.+
T Consensus         4 kC~lCdk~~   12 (56)
T PF09963_consen    4 KCILCDKKE   12 (56)
T ss_pred             EEEecCCEE
Confidence            444455444


No 267
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=26.42  E-value=26  Score=25.97  Aligned_cols=14  Identities=14%  Similarity=0.339  Sum_probs=6.5

Q ss_pred             CCcccCCCcccccC
Q psy3485         184 RNFMCFACPYYCRY  197 (304)
Q Consensus       184 ~~~~C~~C~k~f~~  197 (304)
                      -.+.|..||..|..
T Consensus        70 ~~~~C~~Cg~~~~~   83 (117)
T PRK00564         70 VELECKDCSHVFKP   83 (117)
T ss_pred             CEEEhhhCCCcccc
Confidence            33455555544433


No 268
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=26.37  E-value=29  Score=26.20  Aligned_cols=36  Identities=8%  Similarity=0.107  Sum_probs=20.7

Q ss_pred             ccccccCCccCCChHHHHHHHHhhcCCCCCCcccCCCcccccc
Q psy3485         247 RYHCAFCNFTSPTQWAINRHTKYTHMNTSGPTIQPECIKILWS  289 (304)
Q Consensus       247 ~~~C~~C~k~F~~~~~L~~H~r~h~~~~~~~~~C~~C~k~F~~  289 (304)
                      +-.|+.|+.....+     +-..-.+.  ..|+|+.|+++|..
T Consensus        30 ~~~cP~C~s~~~~k-----~g~~~~~~--qRyrC~~C~~tf~~   65 (129)
T COG3677          30 KVNCPRCKSSNVVK-----IGGIRRGH--QRYKCKSCGSTFTV   65 (129)
T ss_pred             cCcCCCCCccceee-----ECCccccc--cccccCCcCcceee
Confidence            35788888553111     11111122  37999999999954


No 269
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=26.27  E-value=20  Score=35.31  Aligned_cols=12  Identities=25%  Similarity=0.479  Sum_probs=7.9

Q ss_pred             ccccchhhccCH
Q psy3485         215 ACEMCNYRAASK  226 (304)
Q Consensus       215 ~C~~C~k~F~~~  226 (304)
                      .|..|++.|.+.
T Consensus       462 tC~~C~kkFfSl  473 (1374)
T PTZ00303        462 SCPSCGRAFISL  473 (1374)
T ss_pred             cccCcCCccccc
Confidence            477777777554


No 270
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=26.21  E-value=46  Score=21.00  Aligned_cols=10  Identities=40%  Similarity=0.743  Sum_probs=4.5

Q ss_pred             CcccCCCccc
Q psy3485         185 NFMCFACPYY  194 (304)
Q Consensus       185 ~~~C~~C~k~  194 (304)
                      .|.|+.||-.
T Consensus        14 ~~~Cp~cGip   23 (55)
T PF13824_consen   14 NFECPDCGIP   23 (55)
T ss_pred             CCcCCCCCCc
Confidence            3444444443


No 271
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=26.14  E-value=40  Score=20.31  Aligned_cols=20  Identities=10%  Similarity=0.230  Sum_probs=13.9

Q ss_pred             cCCCCCCcccCCCcccccCh
Q psy3485         179 KNPMRRNFMCFACPYYCRYG  198 (304)
Q Consensus       179 ~h~~~~~~~C~~C~k~f~~~  198 (304)
                      .........|+.|+..|...
T Consensus         8 ~~~~~~~i~C~~C~~~~H~~   27 (51)
T PF00628_consen    8 SDDDGDMIQCDSCNRWYHQE   27 (51)
T ss_dssp             SCTTSSEEEBSTTSCEEETT
T ss_pred             cCCCCCeEEcCCCChhhCcc
Confidence            34456678888888877654


No 272
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=25.44  E-value=69  Score=29.92  Aligned_cols=22  Identities=14%  Similarity=0.222  Sum_probs=12.3

Q ss_pred             cccccCCccCCChHHHHHHHHh
Q psy3485         248 YHCAFCNFTSPTQWAINRHTKY  269 (304)
Q Consensus       248 ~~C~~C~k~F~~~~~L~~H~r~  269 (304)
                      ..|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            4555555555555555555553


No 273
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=25.36  E-value=24  Score=22.23  Aligned_cols=10  Identities=20%  Similarity=0.305  Sum_probs=2.6

Q ss_pred             CcccCCCccc
Q psy3485         277 PTIQPECIKI  286 (304)
Q Consensus       277 ~~~C~~C~k~  286 (304)
                      .|.|++||.+
T Consensus        33 ~y~Cp~CgAt   42 (55)
T PF05741_consen   33 KYVCPICGAT   42 (55)
T ss_dssp             G---TTT---
T ss_pred             cCcCCCCcCc
Confidence            4667777654


No 274
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=25.35  E-value=11  Score=21.08  Aligned_cols=10  Identities=30%  Similarity=0.218  Sum_probs=5.6

Q ss_pred             cccCCCcccc
Q psy3485         278 TIQPECIKIL  287 (304)
Q Consensus       278 ~~C~~C~k~F  287 (304)
                      |.|..|++.+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5555555554


No 275
>PTZ00448 hypothetical protein; Provisional
Probab=25.23  E-value=49  Score=29.72  Aligned_cols=24  Identities=17%  Similarity=0.350  Sum_probs=21.2

Q ss_pred             CCcccCCCcccccChHHHHHHHHh
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLRT  207 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~~  207 (304)
                      ..|.|..|+..|.+....+.|+++
T Consensus       313 ~~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        313 NMLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CCccccccccccCCHHHHHHHhhh
Confidence            368899999999988999999987


No 276
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=25.21  E-value=24  Score=35.24  Aligned_cols=36  Identities=17%  Similarity=0.461  Sum_probs=0.0

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCccccc
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCR  196 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~  196 (304)
                      +.|+.||..-+    ...|+.|+-...     ..|.|+.|+....
T Consensus       656 r~Cp~Cg~~t~----~~~Cp~CG~~T~-----~~~~Cp~C~~~~~  691 (900)
T PF03833_consen  656 RRCPKCGKETF----YNRCPECGSHTE-----PVYVCPDCGIEVE  691 (900)
T ss_dssp             ---------------------------------------------
T ss_pred             ccCcccCCcch----hhcCcccCCccc-----cceeccccccccC
Confidence            67888885421    122555543322     2356666666543


No 277
>KOG1729|consensus
Probab=25.07  E-value=19  Score=31.24  Aligned_cols=8  Identities=25%  Similarity=0.658  Sum_probs=4.2

Q ss_pred             cccCCCch
Q psy3485         152 FFCIHCNG  159 (304)
Q Consensus       152 ~~C~~C~~  159 (304)
                      -.|..|++
T Consensus       169 ~~C~~C~~  176 (288)
T KOG1729|consen  169 TECMVCGC  176 (288)
T ss_pred             eecccCCC
Confidence            44555555


No 278
>KOG2636|consensus
Probab=25.04  E-value=47  Score=30.53  Aligned_cols=29  Identities=14%  Similarity=0.382  Sum_probs=24.3

Q ss_pred             ccCCCCCCcccCCCc-ccccChHHHHHHHH
Q psy3485         178 RKNPMRRNFMCFACP-YYCRYGSSMAIHLR  206 (304)
Q Consensus       178 ~~h~~~~~~~C~~C~-k~f~~~~~l~~H~~  206 (304)
                      +.|.=...|.|.+|| +++..+.++.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            345556779999999 99999999999966


No 279
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=24.84  E-value=25  Score=23.16  Aligned_cols=23  Identities=17%  Similarity=0.278  Sum_probs=11.3

Q ss_pred             hccccccCCCCCCcccCCCccccc
Q psy3485         173 CLRRKRKNPMRRNFMCFACPYYCR  196 (304)
Q Consensus       173 C~~~~~~h~~~~~~~C~~C~k~f~  196 (304)
                      |++.+-...+.+.-.| .||+...
T Consensus         8 Cgr~lya~e~~kTkkC-~CG~~l~   30 (68)
T PF09082_consen    8 CGRYLYAKEGAKTKKC-VCGKTLK   30 (68)
T ss_dssp             TS--EEEETT-SEEEE-TTTEEEE
T ss_pred             CCCEEEecCCcceeEe-cCCCeee
Confidence            4444555555566666 6666543


No 280
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=24.52  E-value=14  Score=25.90  Aligned_cols=29  Identities=31%  Similarity=0.699  Sum_probs=20.1

Q ss_pred             CccccCCCchHH----HHHHHHHHhhhhccccc
Q psy3485         150 DQFFCIHCNGCV----LYADLLDHCKLCLRRKR  178 (304)
Q Consensus       150 ~~~~C~~C~~~f----l~~H~~~hC~~C~~~~~  178 (304)
                      ..|.|..||...    -....+.||+.|...+.
T Consensus         3 ~~F~C~~CG~~V~p~~~g~~~RNHCP~CL~S~H   35 (92)
T PF12647_consen    3 ESFTCVHCGLTVSPLAAGSAHRNHCPSCLSSLH   35 (92)
T ss_pred             cccCccccCCCcccCCCCCCccCcCcccccccc
Confidence            358999999877    33445677888876643


No 281
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.27  E-value=39  Score=21.65  Aligned_cols=16  Identities=25%  Similarity=0.553  Sum_probs=8.6

Q ss_pred             CCCccccccCCccCCC
Q psy3485         244 EERRYHCAFCNFTSPT  259 (304)
Q Consensus       244 ~~~~~~C~~C~k~F~~  259 (304)
                      .-+.|-|+.|......
T Consensus        28 PIrtymC~eC~~Rva~   43 (68)
T COG4896          28 PIRTYMCPECEHRVAI   43 (68)
T ss_pred             CceeEechhhHhhhch
Confidence            3445666666554433


No 282
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=24.12  E-value=31  Score=19.68  Aligned_cols=11  Identities=18%  Similarity=0.102  Sum_probs=5.8

Q ss_pred             CcccCCCcccc
Q psy3485         277 PTIQPECIKIL  287 (304)
Q Consensus       277 ~~~C~~C~k~F  287 (304)
                      .|+|.+||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            58888888653


No 283
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=24.11  E-value=36  Score=21.20  Aligned_cols=11  Identities=18%  Similarity=0.127  Sum_probs=7.7

Q ss_pred             cccCCCccccc
Q psy3485         278 TIQPECIKILW  288 (304)
Q Consensus       278 ~~C~~C~k~F~  288 (304)
                      +.||+||..|.
T Consensus         1 i~CPyCge~~~   11 (52)
T PF14255_consen    1 IQCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCCeeE
Confidence            36888887763


No 284
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=24.07  E-value=49  Score=29.36  Aligned_cols=28  Identities=25%  Similarity=0.522  Sum_probs=19.4

Q ss_pred             hhCCCCccccccch-hhccCHHHHHHHHH
Q psy3485         207 THTKEKPFACEMCN-YRAASKIAIYAHMR  234 (304)
Q Consensus       207 ~H~~~~~~~C~~C~-k~F~~~~~L~~H~~  234 (304)
                      .|--.+.|.|++|| +++..+..+-+|--
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhhh
Confidence            35555668888888 77777777777743


No 285
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=23.48  E-value=30  Score=24.67  Aligned_cols=12  Identities=33%  Similarity=0.592  Sum_probs=6.2

Q ss_pred             Cccccccchhhc
Q psy3485         212 KPFACEMCNYRA  223 (304)
Q Consensus       212 ~~~~C~~C~k~F  223 (304)
                      ++++|..||..|
T Consensus        78 ~~~rC~eCG~~f   89 (97)
T cd00924          78 KPKRCPECGHVF   89 (97)
T ss_pred             CceeCCCCCcEE
Confidence            455555555444


No 286
>KOG1842|consensus
Probab=23.39  E-value=43  Score=30.73  Aligned_cols=11  Identities=27%  Similarity=0.326  Sum_probs=7.7

Q ss_pred             ccCCCcccccc
Q psy3485         279 IQPECIKILWS  289 (304)
Q Consensus       279 ~C~~C~k~F~~  289 (304)
                      .|+.||+.|+.
T Consensus        81 ~~s~~g~~~n~   91 (505)
T KOG1842|consen   81 HDSMCGKLLNE   91 (505)
T ss_pred             ccccccccccc
Confidence            57778887754


No 287
>PLN02294 cytochrome c oxidase subunit Vb
Probab=23.32  E-value=25  Score=27.82  Aligned_cols=12  Identities=17%  Similarity=0.230  Sum_probs=8.7

Q ss_pred             CcccCCCccccc
Q psy3485         277 PTIQPECIKILW  288 (304)
Q Consensus       277 ~~~C~~C~k~F~  288 (304)
                      ++.|+.||.-|.
T Consensus       141 p~RCpeCG~~fk  152 (174)
T PLN02294        141 SFECPVCTQYFE  152 (174)
T ss_pred             ceeCCCCCCEEE
Confidence            677777777764


No 288
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.32  E-value=33  Score=22.05  Aligned_cols=12  Identities=17%  Similarity=0.304  Sum_probs=7.2

Q ss_pred             CcccCCCccccc
Q psy3485         277 PTIQPECIKILW  288 (304)
Q Consensus       277 ~~~C~~C~k~F~  288 (304)
                      ...|++|+..|+
T Consensus        48 ev~CPYC~t~y~   59 (62)
T COG4391          48 EVVCPYCSTRYR   59 (62)
T ss_pred             cEecCccccEEE
Confidence            456666666554


No 289
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=23.28  E-value=10  Score=33.83  Aligned_cols=45  Identities=16%  Similarity=0.167  Sum_probs=24.3

Q ss_pred             CCccccccCCccCCChHHHH---HHH-HhhcCCCCCCcccCCCcccccch
Q psy3485         245 ERRYHCAFCNFTSPTQWAIN---RHT-KYTHMNTSGPTIQPECIKILWSF  290 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~---~H~-r~h~~~~~~~~~C~~C~k~F~~~  290 (304)
                      -+-|.|..|.++.-..+..=   .|- ..|...+ |-|+|..|++...+-
T Consensus       250 ~kav~C~~C~yt~~~~~~~C~~~~H~l~~~~a~K-RFFkC~~C~~Rt~sl  298 (344)
T PF09332_consen  250 CKAVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVK-RFFKCKDCGNRTISL  298 (344)
T ss_dssp             EEEEEETTT--EESS--HHHHHTT--EEEEEEE--EEEE-T-TS-EEEES
T ss_pred             EEEEEcCCCCCcccCcchhHHhcCCceEEeeeee-eeEECCCCCCeeeec
Confidence            35689999998877666653   443 3344444 779999999986653


No 290
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=23.27  E-value=29  Score=25.52  Aligned_cols=10  Identities=20%  Similarity=0.388  Sum_probs=5.0

Q ss_pred             cccCCCchHH
Q psy3485         152 FFCIHCNGCV  161 (304)
Q Consensus       152 ~~C~~C~~~f  161 (304)
                      +.|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PF01155_consen   71 ARCRDCGHEF   80 (113)
T ss_dssp             EEETTTS-EE
T ss_pred             EECCCCCCEE
Confidence            5555555554


No 291
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=22.94  E-value=37  Score=30.09  Aligned_cols=24  Identities=13%  Similarity=0.164  Sum_probs=21.3

Q ss_pred             CCccccccCCccCCChHHHHHHHH
Q psy3485         245 ERRYHCAFCNFTSPTQWAINRHTK  268 (304)
Q Consensus       245 ~~~~~C~~C~k~F~~~~~L~~H~r  268 (304)
                      ...+-|..|++.|.+.+.+..|..
T Consensus       236 ~~~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         236 FPKVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ccceeeHhhhhHhhhhHHHHHHHh
Confidence            356899999999999999999985


No 292
>COG3464 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.80  E-value=21  Score=32.77  Aligned_cols=10  Identities=30%  Similarity=0.793  Sum_probs=5.8

Q ss_pred             cccccchhhc
Q psy3485         214 FACEMCNYRA  223 (304)
Q Consensus       214 ~~C~~C~k~F  223 (304)
                      ..|+.||...
T Consensus        39 ~~CP~Cg~~~   48 (402)
T COG3464          39 HRCPECGQRT   48 (402)
T ss_pred             CCCCCCCCcc
Confidence            5566666544


No 293
>PRK11032 hypothetical protein; Provisional
Probab=22.41  E-value=30  Score=27.20  Aligned_cols=31  Identities=13%  Similarity=0.111  Sum_probs=17.5

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCcccccCh
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYG  198 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~  198 (304)
                      +.|..||..                +.......--.|+.||....++
T Consensus       125 LvC~~Cg~~----------------~~~~~p~~i~pCp~C~~~~F~R  155 (160)
T PRK11032        125 LVCEKCHHH----------------LAFYTPEVLPLCPKCGHDQFQR  155 (160)
T ss_pred             EEecCCCCE----------------EEecCCCcCCCCCCCCCCeeee
Confidence            777777765                2222223334788888654443


No 294
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=22.40  E-value=40  Score=18.87  Aligned_cols=11  Identities=27%  Similarity=0.869  Sum_probs=6.1

Q ss_pred             CCcccCCCccc
Q psy3485         184 RNFMCFACPYY  194 (304)
Q Consensus       184 ~~~~C~~C~k~  194 (304)
                      ..+.|+.||..
T Consensus        21 ~R~vC~~Cg~I   31 (34)
T PF14803_consen   21 ERLVCPACGFI   31 (34)
T ss_dssp             -EEEETTTTEE
T ss_pred             cceECCCCCCE
Confidence            44566666654


No 295
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=21.97  E-value=58  Score=28.46  Aligned_cols=11  Identities=27%  Similarity=0.199  Sum_probs=5.4

Q ss_pred             cccCCCccccc
Q psy3485         278 TIQPECIKILW  288 (304)
Q Consensus       278 ~~C~~C~k~F~  288 (304)
                      +.|+.||..|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            44555555444


No 296
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=21.96  E-value=54  Score=28.53  Aligned_cols=11  Identities=18%  Similarity=0.449  Sum_probs=5.2

Q ss_pred             cccccCCccCC
Q psy3485         248 YHCAFCNFTSP  258 (304)
Q Consensus       248 ~~C~~C~k~F~  258 (304)
                      +.|+.||.-|+
T Consensus        46 ~vc~~c~~h~r   56 (285)
T TIGR00515        46 EVCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCCcCc
Confidence            44555554443


No 297
>KOG1842|consensus
Probab=21.86  E-value=59  Score=29.89  Aligned_cols=28  Identities=29%  Similarity=0.430  Sum_probs=20.7

Q ss_pred             CCcccCCCcccccChHHHHHHHHh-hCCC
Q psy3485         184 RNFMCFACPYYCRYGSSMAIHLRT-HTKE  211 (304)
Q Consensus       184 ~~~~C~~C~k~f~~~~~l~~H~~~-H~~~  211 (304)
                      .-|.|++|.+.|.+..+|..|... |.++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            347888888888888888888765 6543


No 298
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=21.81  E-value=26  Score=25.78  Aligned_cols=9  Identities=22%  Similarity=0.814  Sum_probs=4.4

Q ss_pred             cccCCCchH
Q psy3485         152 FFCIHCNGC  160 (304)
Q Consensus       152 ~~C~~C~~~  160 (304)
                      +.|..||..
T Consensus        71 ~~C~~Cg~~   79 (114)
T PRK03681         71 CWCETCQQY   79 (114)
T ss_pred             EEcccCCCe
Confidence            455555543


No 299
>KOG2330|consensus
Probab=21.67  E-value=32  Score=31.38  Aligned_cols=55  Identities=13%  Similarity=0.204  Sum_probs=32.3

Q ss_pred             CCCCCCchh--hHHHHh-----hCcccccCCchHHHHHHH--------HHHHhhhhhhhhhhhhhhhhhc
Q psy3485           1 MKLTPKIPN--LQQIQK-----TNPKLKKVNYPIIVARKM--------WTKLKKNHQNRNQKKMKSKTAK   55 (304)
Q Consensus         1 ~~~~~~~~~--l~~~~~-----~~~~~~~~~~p~~iC~~C--------~~~l~~f~~~~~~~~~~~~~~~   55 (304)
                      |||++.+|+  |..||.     .|+.|+..+|..-|=..|        |.-+++|..-++.++.-.....
T Consensus       284 Lgmp~g~pPPWl~aMqryGpPpsYPdlkIpGLNapIPeg~s~Gyh~gGWGpVDe~g~PLygDVfG~~~p~  353 (500)
T KOG2330|consen  284 LGMPVGTPPPWLIAMQRYGPPPSYPDLKIPGLNAPIPEGCSFGYHAGGWGPVDEFGKPLYGDVFGLNIPE  353 (500)
T ss_pred             hCCCCCCCChHHHHhhhcCCCCCCCcccCCCCCCCCCcccccccccCCCccccccCCccchhcccccccc
Confidence            345544443  555554     355565555544444455        8889999887777665444443


No 300
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=21.28  E-value=18  Score=29.36  Aligned_cols=11  Identities=27%  Similarity=0.649  Sum_probs=6.4

Q ss_pred             cccccCCccCC
Q psy3485         248 YHCAFCNFTSP  258 (304)
Q Consensus       248 ~~C~~C~k~F~  258 (304)
                      +.|..||.+++
T Consensus        44 ~~C~~CgYR~~   54 (201)
T COG1779          44 GVCERCGYRST   54 (201)
T ss_pred             EEccccCCccc
Confidence            45666665544


No 301
>PRK05978 hypothetical protein; Provisional
Probab=21.23  E-value=26  Score=27.16  Aligned_cols=10  Identities=40%  Similarity=0.763  Sum_probs=5.3

Q ss_pred             ccccCCccCC
Q psy3485         249 HCAFCNFTSP  258 (304)
Q Consensus       249 ~C~~C~k~F~  258 (304)
                      .|+.||-.|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            3555555544


No 302
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=21.02  E-value=14  Score=21.84  Aligned_cols=11  Identities=18%  Similarity=-0.239  Sum_probs=4.5

Q ss_pred             cCCCcccccch
Q psy3485         280 QPECIKILWSF  290 (304)
Q Consensus       280 C~~C~k~F~~~  290 (304)
                      |.+||+.|...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            77888887665


No 303
>KOG0978|consensus
Probab=20.39  E-value=34  Score=33.50  Aligned_cols=21  Identities=14%  Similarity=0.050  Sum_probs=15.4

Q ss_pred             CcccCCCcccccchhHHHHHH
Q psy3485         277 PTIQPECIKILWSFLSYFIWI  297 (304)
Q Consensus       277 ~~~C~~C~k~F~~~~~l~~h~  297 (304)
                      .=+||.||..|....-+.+||
T Consensus       678 qRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             cCCCCCCCCCCCcccccccCC
Confidence            456888888888777666654


No 304
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.27  E-value=19  Score=27.98  Aligned_cols=40  Identities=18%  Similarity=0.177  Sum_probs=19.9

Q ss_pred             ccCCCcccccChHHHHHHHH-hhCCCCccccccchhhccCH
Q psy3485         187 MCFACPYYCRYGSSMAIHLR-THTKEKPFACEMCNYRAASK  226 (304)
Q Consensus       187 ~C~~C~k~f~~~~~l~~H~~-~H~~~~~~~C~~C~k~F~~~  226 (304)
                      .|+.|+.........-.=.- ..+-+.|.-|..||+.|.+.
T Consensus        41 ~Cp~C~~~IrG~y~v~gv~~~g~~~~~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   41 SCPNCSTPIRGDYHVEGVFGLGGHYEAPSYCHNCGKPYPWT   81 (158)
T ss_pred             HCcCCCCCCCCceecCCeeeeCCCCCCChhHHhCCCCCchH
Confidence            67777665544421100000 12334666677777777664


No 305
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=20.11  E-value=58  Score=23.05  Aligned_cols=36  Identities=17%  Similarity=0.122  Sum_probs=11.5

Q ss_pred             cccCCCchHHHHHHHHHHhhhhccccccCCCCCCcccCCCcccccCh
Q psy3485         152 FFCIHCNGCVLYADLLDHCKLCLRRKRKNPMRRNFMCFACPYYCRYG  198 (304)
Q Consensus       152 ~~C~~C~~~fl~~H~~~hC~~C~~~~~~h~~~~~~~C~~C~k~f~~~  198 (304)
                      --|..||.++-..+.           .+-.....|.|+.|.+-|.+.
T Consensus        15 ~~CalCG~tWg~~y~-----------Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   15 MGCALCGATWGDYYE-----------EVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             GS-SS---S---SS------------B-TT--BSSS--SSSS-TTS-
T ss_pred             ccccccCCcHHHHHH-----------hhcCCEEEEEcHHHHHHHHHH
Confidence            456666666632222           222334456667777777655


Done!