RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3487
         (538 letters)



>gnl|CDD|216381 pfam01237, Oxysterol_BP, Oxysterol-binding protein. 
          Length = 335

 Score =  232 bits (594), Expect = 7e-72
 Identities = 102/276 (36%), Positives = 135/276 (48%), Gaps = 49/276 (17%)

Query: 113 ALVAAFSTSAYSTT-AVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVE 171
             VAAF+ S YS+T   RT KPFNPLLGET+E  R  D G++  SEQVSHHPPI+A + E
Sbjct: 38  LYVAAFAVSTYSSTRKRRTKKPFNPLLGETFELVRE-DGGFRFISEQVSHHPPISAYHAE 96

Query: 172 GKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVD 231
            K W  W   A  SKF GK I+V P G  +L   K+ +HYTW +  + +HN+I G  +V+
Sbjct: 97  SKGWTLWGSSAPKSKFWGKSIEVKPEGHAHLTLKKTGEHYTWTKPTTHIHNIIFGKPYVE 156

Query: 232 QHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSI 291
            +GE  + N TTG    + F    +FS          + N               ++   
Sbjct: 157 LYGEMYIKNSTTGYKAVIEFKKKGWFSG---------RKN---------------EVEGK 192

Query: 292 LKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRA-------PQY 344
           + +  GK L TI              +  E      V         +++A        + 
Sbjct: 193 VYDKKGKVLYTI------------SGKWNESLYIKKVKSSTGEKKLLWKANPLPPNSEKV 240

Query: 345 YCFTKFACQLNEL----EEGVAPTDSRLRPDQRLLE 376
           Y FTKFA  LNEL    +E + PTDSRLRPDQR LE
Sbjct: 241 YGFTKFAIPLNELTPELKEELPPTDSRLRPDQRALE 276



 Score =  100 bits (252), Expect = 2e-23
 Identities = 54/143 (37%), Positives = 67/143 (46%), Gaps = 34/143 (23%)

Query: 306 PLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVF-RAPQYYCF-TKFACQ---------- 353
           P+ F+EPLS+LQRL ED EY  +LD+AA  DD   R      +   FA            
Sbjct: 1   PVFFNEPLSLLQRLAEDLEYPDLLDKAAKEDDPLERM----LYVAAFAVSTYSSTRKRRT 56

Query: 354 -------LNELEEGVAPTDSRLRPDQ--RLL--EVSHHPPIAAQYVEGKAWKAWQDLAVH 402
                  L E  E V       R D   R +  +VSHHPPI+A + E K W  W   A  
Sbjct: 57  KKPFNPLLGETFELV-------REDGGFRFISEQVSHHPPISAYHAESKGWTLWGSSAPK 109

Query: 403 SKFRGKYIQVTPAGRFNLVFTKS 425
           SKF GK I+V P G  +L   K+
Sbjct: 110 SKFWGKSIEVKPEGHAHLTLKKT 132


>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and
           OSBP-related protein 4 Pleckstrin homology (PH) domain. 
           Human OSBP is proposed to function is sterol-dependent
           regulation of ERK dephosphorylation and sphingomyelin
           synthesis as well as modulation of insulin signaling and
           hepatic lipogenesis. It contains a N-terminal PH domain,
           a FFAT motif (two phenylalanines in an acidic tract),
           and a C-terminal OSBP-related domain. OSBPs and Osh1p PH
           domains specifically localize to the Golgi apparatus in
           a PtdIns4P-dependent manner. ORP4 is proposed to
           function in Vimentin-dependent sterol transport and/or
           signaling. Human ORP4 has 2 forms, a long (ORP4L) and a
           short (ORP4S). ORP4L contains a N-terminal PH domain, a
           FFAT motif (two phenylalanines in an acidic tract), and
           a C-terminal OSBP-related domain. ORP4S is truncated and
           contains only an OSBP-related domain. Oxysterol binding
           proteins are a multigene family that is conserved in
           yeast, flies, worms, mammals and plants. They all
           contain a C-terminal oxysterol binding domain, and most
           contain an N-terminal PH domain. OSBP PH domains bind to
           membrane phosphoinositides and thus likely play an
           important role in intracellular targeting. They are
           members of the oxysterol binding protein (OSBP) family
           which includes OSBP, OSBP-related proteins (ORP),
           Goodpasture antigen binding protein (GPBP), and Four
           phosphate adaptor protein 1 (FAPP1). They have a wide
           range of purported functions including sterol transport,
           cell cycle control, pollen development and vessicle
           transport from Golgi recognize both PI lipids and ARF
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 99

 Score =  197 bits (503), Expect = 9e-62
 Identities = 78/93 (83%), Positives = 86/93 (92%), Gaps = 1/93 (1%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFI 77
            KGWL KWTNYLKGYQ+RWFVLSNGLLSYYRNQAEM+HTCRGTI+L GA+I TEDSC F+
Sbjct: 1   FKGWLLKWTNYLKGYQRRWFVLSNGLLSYYRNQAEMAHTCRGTINLAGALIHTEDSCNFV 60

Query: 78  ISNG-VQTFHIKASNEVERQRWVTALELAKSKA 109
           ISNG  QTFH+KAS+EVERQRWVTALELAK+KA
Sbjct: 61  ISNGGTQTFHLKASSEVERQRWVTALELAKAKA 93


>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin
           homology (PH) domain.  The GPBP (also called Collagen
           type IV alpha-3-binding protein/hCERT; START
           domain-containing protein 11/StARD11; StAR-related lipid
           transfer protein 11) is a kinase that phosphorylates an
           N-terminal region of the alpha 3 chain of type IV
           collagen, which is commonly known as the goodpasture
           antigen. Its splice variant the ceramide transporter
           (CERT) mediates the cytosolic transport of ceramide.
           There have been additional splice variants identified,
           but all of them function as ceramide transport proteins.
           GPBP and CERT both contain an N-terminal PH domain,
           followed by a serine rich domain, and a C-terminal START
           domain. However, GPBP has an additional serine rich
           domain just upstream of its START domain. They are
           members of the oxysterol binding protein (OSBP) family
           which includes OSBP, OSBP-related proteins (ORP),
           Goodpasture antigen binding protein (GPBP), and Four
           phosphate adaptor protein 1 (FAPP1). They have a wide
           range of purported functions including sterol transport,
           cell cycle control, pollen development and vessicle
           transport from Golgi recognize both PI lipids and ARF
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score =  115 bits (290), Expect = 6e-31
 Identities = 43/92 (46%), Positives = 63/92 (68%), Gaps = 2/92 (2%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTE--DSCT 75
           ++G L KWTNY+ G+Q R+FVL +G LSYY+++ E  + CRG+ISLR A+I+    D C 
Sbjct: 1   LRGVLSKWTNYIHGWQDRYFVLKDGTLSYYKSEDETQYGCRGSISLRKAVIKPHEFDECR 60

Query: 76  FIISNGVQTFHIKASNEVERQRWVTALELAKS 107
           F +S     ++++A +  ERQRWV ALE  K+
Sbjct: 61  FDVSVNDSVWYLRAESPEERQRWVDALEAHKA 92


>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein
           homologs 1 and 2 Pleckstrin homology (PH) domain.  Yeast
           Osh1p is proposed to function in postsynthetic sterol
           regulation, piecemeal microautophagy of the nucleus, and
           cell polarity establishment. Yeast Osh2p is proposed to
           function in sterol metabolism and cell polarity
           establishment. Both Osh1p and Osh2p contain 3 N-terminal
           ankyrin repeats, a PH domain, a FFAT motif (two
           phenylalanines in an acidic tract), and a C-terminal
           OSBP-related domain. OSBP andOsh1p PH domains
           specifically localize to the Golgi apparatus in a
           PtdIns4P-dependent manner. Oxysterol binding proteins
           are a multigene family that is conserved in yeast,
           flies, worms, mammals and plants. In general OSBPs and
           ORPs have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score =  106 bits (266), Expect = 1e-27
 Identities = 41/100 (41%), Positives = 64/100 (64%), Gaps = 5/100 (5%)

Query: 17  EMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQT--EDSC 74
            MKG+L KWTNY KGY+ RWFVL +G+LSYYR+Q +    CRG+I+++ A + +   +  
Sbjct: 3   TMKGYLKKWTNYAKGYKTRWFVLEDGVLSYYRHQDDEGSACRGSINMKNARLVSDPSEKL 62

Query: 75  TFIISNGVQT---FHIKASNEVERQRWVTALELAKSKARQ 111
            F +S+       +++KA++ VE  RW+ AL+ A   A+ 
Sbjct: 63  RFEVSSKTSGSPKWYLKANHPVEAARWIQALQKAIEWAKD 102


>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein 9
           Pleckstrin homology (PH) domain.  Human ORP9 is proposed
           to function in regulation of Akt phosphorylation. ORP9
           has 2 forms, a long (ORP9L) and a short (ORP9S). ORP9L
           contains an N-terminal PH domain, a FFAT motif (two
           phenylalanines in an acidic tract), and a C-terminal
           OSBP-related domain. ORP1S is truncated and contains a
           FFAT motif and an OSBP-related domain. Oxysterol binding
           proteins are a multigene family that is conserved in
           yeast, flies, worms, mammals and plants. In general
           OSBPs and ORPs have been found to be involved in the
           transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 102

 Score = 97.5 bits (243), Expect = 2e-24
 Identities = 45/105 (42%), Positives = 63/105 (60%), Gaps = 8/105 (7%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSN--GLLSYYRNQAEMSHTC-RGTISLRGAI--IQTED 72
           M+G L KWTN +KG+Q RWFVL +  GLLSYY ++ +M     RG + L+GA+  I  ED
Sbjct: 1   MEGPLSKWTNVMKGWQYRWFVLDDNAGLLSYYTSKEKMMRGSRRGCVRLKGAVIGIDDED 60

Query: 73  SCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAA 117
             TF I+   +TFH +A +  ER+RW+ ALE       +H+    
Sbjct: 61  DSTFTITVDQKTFHFQARDAEERERWIRALEDTI---LRHSQQYQ 102


>gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2
           Pleckstrin homology (PH) domain.  Human FAPP1 (also
           called PLEKHA3/Pleckstrin homology domain-containing,
           family A member 3) regulates secretory transport from
           the trans-Golgi network to the plasma membrane. It is
           recruited through binding of PH domain to
           phosphatidylinositol 4-phosphate (PtdIns(4)P) and a
           small GTPase ADP-ribosylation factor 1 (ARF1). These two
           binding sites have little overlap the FAPP1 PH domain to
           associate with both ligands simultaneously and
           independently. FAPP1 has a N-terminal PH domain followed
           by a short proline-rich region. FAPP1 is a member of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), and Goodpasture
           antigen binding protein (GPBP). They have a wide range
           of purported functions including sterol transport, cell
           cycle control, pollen development and vessicle transport
           from Golgi recognize both PI lipids and ARF proteins.
           FAPP2 (also called PLEKHA8/Pleckstrin homology
           domain-containing, family A member 8), a member of the
           Glycolipid lipid transfer protein(GLTP) family has an
           N-terminal PH domain that targets the TGN and C-terminal
           GLTP domain. FAPP2 functions to traffic glucosylceramide
           (GlcCer) which is made in the Golgi. It's interaction
           with vesicle-associated membrane protein-associated
           protein (VAP) could be a means of regulation. Some
           FAPP2s share the FFAT-like motifs found in GLTP. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score = 96.3 bits (240), Expect = 4e-24
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 3/94 (3%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTE--DSCT 75
           M+G L+KWTNYL G+Q RWFVL +G+LSYY++Q E+   C+G+I +    I     D+  
Sbjct: 1   MEGVLYKWTNYLSGWQPRWFVLDDGVLSYYKSQEEVDQGCKGSIKMSVCEIIVHPTDNTR 60

Query: 76  F-IISNGVQTFHIKASNEVERQRWVTALELAKSK 108
             +I  G Q F++KAS+  ERQRW+ AL  AK+ 
Sbjct: 61  MDLIIPGEQHFYLKASSAAERQRWLVALGSAKAC 94


>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP)
           related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin
           homology (PH) domain.  Human ORP10 is involvedt in
           intracellular transport or organelle positioning and is
           proposed to function as a regulator of cellular lipid
           metabolism. Human ORP11 localizes at the Golgi-late
           endosome interface and is thought to form a dimer with
           ORP9 functioning as an intracellular lipid sensor or
           transporter. Both ORP10 and ORP11 contain a N-terminal
           PH domain, a FFAT motif (two phenylalanines in an acidic
           tract), and a C-terminal OSBP-related domain. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 80.8 bits (200), Expect = 2e-18
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 7/91 (7%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSN--GLLSYYRNQAEMSHTCRGTISLRGAII--QTEDS 73
           ++G L K+TN +KG+Q RWFVL    G L Y+ ++   +   RG++ L GA+I    EDS
Sbjct: 1   LEGQLSKYTNVVKGWQNRWFVLDPEAGSLEYFVSEESKNQKPRGSLPLAGAVISPSDEDS 60

Query: 74  CTFII--SNGVQTFHIKASNEVERQRWVTAL 102
            TF +  +NG + + ++A++  ERQ WV  L
Sbjct: 61  HTFTVNAANG-EMYKLRAADAKERQEWVNRL 90


>gnl|CDD|215766 pfam00169, PH, PH domain.  PH stands for pleckstrin homology.
          Length = 101

 Score = 79.4 bits (196), Expect = 4e-18
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 17  EMKGWLFKWT-NYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDS-- 73
             +GWL K      K ++KR+FVL +G+L YY++  + S   +G+I L G  +       
Sbjct: 2   IKEGWLLKKGSGGRKSWKKRYFVLFDGVLLYYKDSKKSSSRPKGSIPLSGCQVTKVPDSE 61

Query: 74  -----CTF-IISNGVQTFHIKASNEVERQRWVTALELAKS 107
                  F I +   +TF ++A +E ER+ WV A+  A  
Sbjct: 62  DGKRKNCFEIRTGDRETFLLQAESEEERKEWVKAIRSAIR 101


>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain.  Domain commonly found
           in eukaryotic signalling proteins. The domain family
           possesses multiple functions including the abilities to
           bind inositol phosphates, and various proteins. PH
           domains have been found to possess inserted domains
           (such as in PLC gamma, syntrophins) and to be inserted
           within other domains. Mutations in Brutons tyrosine
           kinase (Btk) within its PH domain cause X-linked
           agammaglobulinaemia (XLA) in patients. Point mutations
           cluster into the positively charged end of the molecule
           around the predicted binding site for
           phosphatidylinositol lipids.
          Length = 102

 Score = 77.2 bits (190), Expect = 2e-17
 Identities = 31/100 (31%), Positives = 56/100 (56%), Gaps = 10/100 (10%)

Query: 18  MKGWLFKWT-NYLKGYQKRWFVLSNGLLSYYRN-QAEMSHTCRGTISLRGAIIQT----- 70
            +GWL+K +    K ++KR+FVL N  L YY++ + + S+  +G+I L G  ++      
Sbjct: 3   KEGWLYKKSGGGKKSWKKRYFVLFNSTLLYYKSKKDKKSYKPKGSIDLSGCTVREAPDPD 62

Query: 71  --EDSCTF-IISNGVQTFHIKASNEVERQRWVTALELAKS 107
             +    F I ++  +T  ++A +E ER++WV AL  A +
Sbjct: 63  SSKKPHCFEIKTSDRKTLLLQAESEEEREKWVEALRKAIA 102


>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain.  PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 92

 Score = 69.3 bits (169), Expect = 1e-14
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 8/92 (8%)

Query: 18  MKGWLFKWTNY-LKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAI-----IQTE 71
            +GWL K     LK ++KRWFVL + +L YY+++ + S   +G I L   +       + 
Sbjct: 1   KEGWLKKRGGKGLKSWKKRWFVLFDDVLLYYKSKKDSSKKPKGLIPLSDGLEVELVSSSG 60

Query: 72  DSCTFII--SNGVQTFHIKASNEVERQRWVTA 101
               F +   +  +T++++A +E ER+ W+ A
Sbjct: 61  KPNCFELVTPDRGRTYYLQAESEEEREEWLEA 92


>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding
           protein related protein 2 Pleckstrin homology (PH)
           domain.  There are 2 types of ORPs found in
           Cryptosporidium: CpORP1 and CpORP2. Cryptosporium
           differs from other apicomplexans like Plasmodium,
           Toxoplasma, and Eimeria which possess only a single
           long-type ORP consisting of an N-terminal PH domain
           followed by a C-terminal ligand binding (LB) domain.
           CpORP2 is like this, but CpORP1 differs and has a
           truncated N-terminus resulting in only having a LB
           domain present. The exact functions of these proteins
           are largely unknown though CpORP1 is thought to be
           involved in lipid transport across the parasitophorous
           vacuole membrane. Oxysterol binding proteins are a
           multigene family that is conserved in yeast, flies,
           worms, mammals and plants. In general OSBPs and ORPs
           have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 88

 Score = 65.0 bits (159), Expect = 3e-13
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 5/90 (5%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGA--IIQTEDSCT 75
           M+G+L KWTN    ++ R+F+L  G+L Y + +       +GTI L+     +  +D   
Sbjct: 1   MEGYLKKWTNIFNSWKPRYFILYPGILCYSKQKGGPK---KGTIHLKICDIRLVPDDPLR 57

Query: 76  FIISNGVQTFHIKASNEVERQRWVTALELA 105
            II+ G    H++AS+  E+ +W  AL+ A
Sbjct: 58  IIINTGTNQLHLRASSVEEKLKWYNALKYA 87


>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1
           (AtPH1) PH domain.  AtPH1 is expressed in all plant
           tissue and is proposed to be the plant homolog of human
           pleckstrin. Pleckstrin consists of two PH domains
           separated by a linker region, while AtPH has a single PH
           domain with a short N-terminal extension. AtPH1 binds
           PtdIns3P specifically and is thought to be an adaptor
           molecule since it has no obvious catalytic functions. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 117

 Score = 65.5 bits (160), Expect = 4e-13
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 13  HSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG--AIIQT 70
            SD E  GWL K    +K +++RWFVL  G L Y++++   S   RG I L     +   
Sbjct: 4   WSDPEKAGWLTKQGGSIKTWRRRWFVLKQGKLFYFKDEDPDSEP-RGVIDLSDCLTVKSA 62

Query: 71  EDSC----TFIISNGVQTFHIKASNEVERQRWVTAL 102
           E++      F +S   +TF++ A +E E++ W++A+
Sbjct: 63  EEATNKEFAFEVSTPERTFYLIADSEKEKEEWISAI 98


>gnl|CDD|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related
           protein Pleckstrin homology (PH) domain.  Plant ORPs
           contain a N-terminal PH domain and a C-terminal
           OSBP-related domain. Not much is known about its
           specific function in plants to date. Members here
           include: Arabidopsis, spruce, and petunia. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score = 64.8 bits (158), Expect = 5e-13
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQ--TEDSCTFI 77
           G L+KW NY KG++ RWFVL +G+LSYY+          G + L+ + I+    D   F 
Sbjct: 3   GILYKWVNYGKGWRSRWFVLQDGVLSYYKVHGPDKVKPSGEVHLKVSSIRESRSDDKKFY 62

Query: 78  ISNGVQTFHIKASNEVERQRWVTALELAK 106
           I  G +T H++A +  +R  W+ AL+ AK
Sbjct: 63  IFTGTKTLHLRAESREDRAAWLEALQAAK 91


>gnl|CDD|241443 cd13289, PH_Osh3p_yeast, Yeast oxysterol binding protein homolog 3
           Pleckstrin homology (PH) domain.  Yeast Osh3p is
           proposed to function in sterol transport and regulation
           of nuclear fusion during mating and of pseudohyphal
           growth as well as sphingolipid metabolism. Osh3 contains
           a N-GOLD (Golgi dynamics) domain, a PH domain, a FFAT
           motif (two phenylalanines in an acidic tract), and a
           C-terminal OSBP-related domain. GOLD domains are thought
           to mediate protein-protein interactions, but their role
           in ORPs are unknown. Oxysterol binding proteins are a
           multigene family that is conserved in yeast, flies,
           worms, mammals and plants. In general OSBPs and ORPs
           have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 90

 Score = 64.2 bits (157), Expect = 6e-13
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 7/88 (7%)

Query: 20  GWLFKWT-NYLKGYQKRWFVL--SNGLLSYYRNQAEMSHTCRGTISLRGAIIQT-EDSCT 75
           GWL K     ++G+ +R+FVL    G LSYY N    +   RG I LR A I       T
Sbjct: 4   GWLLKKRRKKMQGFARRYFVLNFKYGTLSYYFNP---NSPVRGQIPLRLASISASPRRRT 60

Query: 76  FIISNGVQTFHIKASNEVERQRWVTALE 103
             I +G + +H+KA N+ + Q W+ AL 
Sbjct: 61  IHIDSGSEVWHLKALNDEDFQAWMKALR 88


>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain
           containing, family H (with MyTH4 domain) members 1 and 2
           (PLEKHH1) PH domain, repeat 1.  PLEKHH1 and PLEKHH2
           (also called PLEKHH1L) are thought to function in
           phospholipid binding and signal transduction. There are
           3 Human PLEKHH genes: PLEKHH1, PLEKHH2, and PLEKHH3.
           There are many isoforms, the longest of which contain a
           FERM domain, a MyTH4 domain, two PH domains, a peroximal
           domain, a vacuolar domain, and a coiled coil stretch.
           The FERM domain has a cloverleaf tripart structure
           (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe,
           B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the
           FERM domain is part of the PH domain family. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 96

 Score = 63.5 bits (155), Expect = 1e-12
 Identities = 27/86 (31%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGA--IIQTEDSCTFI 77
           G+L K    +K +++RWFVL NG L YY++  ++    +G I+L G+  I + E + TF 
Sbjct: 3   GYLTKLGGKVKTWKRRWFVLKNGELFYYKSPNDVIRKPQGQIALDGSCEIARAEGAQTFE 62

Query: 78  ISNGVQTFHIKASNEVERQRWVTALE 103
           I    +T+++ A +E +   W+  ++
Sbjct: 63  IVTEKRTYYLTADSENDLDEWIRVIQ 88


>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins
           1, 2, and 3 pleckstrin homology (PH) domain.  PEPP1
           (also called PLEKHA4/PH domain-containing family A
           member 4 and RHOXF1/Rhox homeobox family member 1), and
           related homologs PEPP2 (also called PLEKHA5/PH
           domain-containing family A member 5) and PEPP3 (also
           called PLEKHA6/PH domain-containing family A member 6),
           have PH domains that interact specifically with
           PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3
           specifically are: TAPP1 (tandem PH-domain-containing
           protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd-
           Ins(3,5)P2 (centaurin-beta2). All of these proteins
           contain at least 5 of the 6 conserved amino acids that
           make up the putative phosphatidylinositol 3,4,5-
           trisphosphate-binding motif (PPBM) located at their
           N-terminus. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 104

 Score = 59.2 bits (144), Expect = 6e-11
 Identities = 30/103 (29%), Positives = 46/103 (44%), Gaps = 11/103 (10%)

Query: 12  SHSDAEMKGWLFKWTNY-LKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQT 70
            ++     GWL K     LK ++KRWFVL +  L YY++  E      G+I L    I  
Sbjct: 3   PNAPVVFSGWLHKQGGSGLKNWKKRWFVLKDNCLYYYKDPEEEK--ALGSILLPSYTISP 60

Query: 71  EDSC-------TFIIS-NGVQTFHIKASNEVERQRWVTALELA 105
                       F     G++T++  A  + E ++W+ AL LA
Sbjct: 61  ASPSDEINRKFAFKAEHAGMRTYYFAADTQEEMEQWMKALSLA 103


>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH)
           domain.  The sesquipedalian family has 2 mammalian
           members: Ses1 and Ses2, which are also callled 7 kDa
           inositol polyphosphate phosphatase-interacting protein 1
           and 2. They play a role in endocytic trafficking and are
           required for receptor recycling from endosomes, both to
           the trans-Golgi network and the plasma membrane. Members
           of this family form homodimers and heterodimers.
           Sesquipedalian interacts with inositol polyphosphate
           5-phosphatase OCRL-1 (INPP5F) also known as Lowe
           oculocerebrorenal syndrome protein, a phosphatase enzyme
           that is involved in actin polymerization and is found in
           the trans-Golgi network and INPP5B. Sesquipedalian
           contains a single PH domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 120

 Score = 56.5 bits (137), Expect = 6e-10
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 11  ASHSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQ- 69
           + +S  + +G+L+K       YQKRWFVL   LL Y+  +        G I L G  ++ 
Sbjct: 3   SCNSPVDKEGYLWKKGERNTSYQKRWFVLKGNLLFYFEKKG--DREPLGVIVLEGCTVEL 60

Query: 70  --TEDSCTFII---SNGVQTFHIKASNEVERQRWVTAL 102
              E+   F I     G +++ + A ++ + + W+ AL
Sbjct: 61  SEDEEPYAFAIRFDGPGSRSYVLAAESQEDMESWMKAL 98


>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin
           homology (PH) domain.  TBC1D2A (also called
           PARIS-1/Prostate antigen recognized and identified by
           SEREX 1 and ARMUS) contains a PH domain and a TBC-type
           GTPase catalytic domain. TBC1D2A integrates signaling
           between Arf6, Rac1, and Rab7 during junction
           disassembly. Activated Rac1 recruits TBC1D2A to locally
           inactivate Rab7 via its C-terminal TBC/RabGAP domain and
           facilitate E-cadherin degradation in lysosomes. The
           TBC1D2A PH domain mediates localization at cell-cell
           contacts and coprecipitates with cadherin complexes. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 101

 Score = 53.4 bits (129), Expect = 5e-09
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 29  LKGYQKRWFVLSNG--LLSYYRNQAEMSHTCRGTISLRGAIIQ---TEDSCTFIISNGVQ 83
           LK ++ RWFV       L YYR+  +   T  G+I L GA        +  TF I    +
Sbjct: 15  LKTWKSRWFVFDERKCQLYYYRSPQD--ITPLGSIDLSGAAFSYDPEAEKGTFEIHTPGR 72

Query: 84  TFHIKASNEVERQRWVTALELAKSKARQH 112
            + +KAS+      W+  L   +SK R++
Sbjct: 73  VYILKASDRQAMLYWLQEL---QSKRREY 98


>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
           Pleckstrin homology (PH) domain.  The binding of TAPP2
           (also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
           not PI(3,4, 5)P3, function as negative regulators of
           insulin and PI3K signalling pathways (i.e.
           TAPP/utrophin/syntrophin complex). TAPP2 contains two
           sequential PH domains in which the C-terminal PH domain
           specifically binds PtdIns(3,4)P2 with high affinity. The
           N-terminal PH domain does not interact with any
           phosphoinositide tested. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. The members here are most
           sequence similar to TAPP2 proteins, but may not be
           actual TAPP2 proteins. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 52.4 bits (126), Expect = 1e-08
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 17/104 (16%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMS----------HTCRGTISLRGAIIQ 69
           G+L K     K ++KRWFVL    L+YY+N  E            HTC   + L+     
Sbjct: 10  GYLEKKGERRKTWKKRWFVLRPTKLAYYKNDKEYRLLRLIDLTDIHTC-TEVQLK----- 63

Query: 70  TEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHA 113
            +   TF I    +TF+++A ++ E + W++A+ LA+   R   
Sbjct: 64  -KHDNTFGIVTPARTFYVQADSKAEMESWISAINLARQALRATI 106


>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
           domains Pleckstrin homology (PH) domain.  ACAP (also
           called centaurin beta) functions both as a Rab35
           effector and as an Arf6-GTPase-activating protein (GAP)
           by which it controls actin remodeling and membrane
           trafficking. ACAP contain an NH2-terminal
           bin/amphiphysin/Rvs (BAR) domain, a phospholipid-binding
           domain, a PH domain, a GAP domain, and four ankyrin
           repeats. The AZAPs constitute a family of Arf GAPs that
           are characterized by an NH2-terminal pleckstrin homology
           (PH) domain and a central Arf GAP domain followed by two
           or more ankyrin repeats. On the basis of sequence and
           domain organization, the AZAP family is further
           subdivided into four subfamilies: 1) the ACAPs contain
           an NH2-terminal bin/amphiphysin/Rvs (BAR) domain (a
           phospholipid-binding domain that is thought to sense
           membrane curvature), a single PH domain followed by the
           GAP domain, and four ankyrin repeats; 2) the ASAPs also
           contain an NH2-terminal BAR domain, the tandem PH
           domain/GAP domain, three ankyrin repeats, two
           proline-rich regions, and a COOH-terminal Src homology 3
           domain; 3) the AGAPs contain an NH2-terminal GTPase-like
           domain (GLD), a split PH domain, and the GAP domain
           followed by four ankyrin repeats; and 4) the ARAPs
           contain both an Arf GAP domain and a Rho GAP domain, as
           well as an NH2-terminal sterile-a motif (SAM), a
           proline-rich region, a GTPase-binding domain, and five
           PH domains. PMID 18003747 and 19055940 Centaurin can
           bind to phosphatidlyinositol (3,4,5)P3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 98

 Score = 51.8 bits (125), Expect = 1e-08
 Identities = 24/101 (23%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 18  MKGWLFKWTNYL-KGYQKRWFVLSNGLLSYYRNQAEMS---HTCRGTISLRGAIIQTEDS 73
            +G+LFK ++   K +++RWF + NG L Y +   + +           LR   ++  + 
Sbjct: 1   KEGYLFKRSSNAFKTWKRRWFSIQNGQLVYQKRFKKDTPTVVVED----LRLCTVKPCED 56

Query: 74  -----CTFIISNGVQTFHIKASNEVERQRWVTALELAKSKA 109
                C  ++S   +++ ++A +E +RQ W+ A++ A + A
Sbjct: 57  IDRRFCFEVVSPT-KSYMLQAESEEDRQAWIQAIQAAIASA 96


>gnl|CDD|241439 cd13285, PH_ORP1, Human Oxysterol binding protein related protein 1
           Pleckstrin homology (PH) domain.  Human ORP1 has 2
           forms, a long (ORP1L) and a short (ORP1S). ORP1L
           contains 3 N-terminal ankyrin repeats, followed by a PH
           domain, a FFAT motif (two phenylalanines in an acidic
           tract), and a C-terminal OSBP-related domain. ORP1S is
           truncated and contains only an OSBP-related domain.
           ORP1L is proposed to function in motility and
           distribution of late endosomes, autophagy, and
           macrophage lipid metabolism. ORP1S is proposed to
           function in vesicle transport from Golgi. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 51.6 bits (124), Expect = 4e-08
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 25/115 (21%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCR--GTISLRGAIIQT--EDSCT 75
           G L+K + +  G++  W VL  G+LS+Y  QA+ +   +  G   L  A      EDSC 
Sbjct: 12  GPLWKSSRFF-GWRSHWVVLERGVLSWYHKQADAASGLKRQGCKYLTHAKCTVKEEDSCF 70

Query: 76  FIISNGVQTFHI-----KASNEVERQRWVTALELAKSKARQHALVAAFSTSAYST 125
           F I     + H      K + +V RQ+W+ ALE       +H        SAYST
Sbjct: 71  FTIRCFDDSVHHFKVPPKNNPQVTRQKWLNALE-------EH--------SAYST 110


>gnl|CDD|241441 cd13287, PH_ORP3_ORP6_ORP7, Human Oxysterol binding protein related
           proteins 3, 6, and 7 Pleckstrin homology (PH) domain.
           Human ORP3 is proposed to function in regulating the
           cell-matrix and cell-cell adhesion. A proposed specific
           function for Human ORP6 was not found at present. Human
           ORP7is proposed to function in negatively regulating the
           Golgi soluble NSF attachment protein receptor (SNARE) of
           28kDa (GS28) protein stability via sequestration of
           Golgi-associated ATPase enhancer of 16 kDa (GATE-16).
           ORP3 has 2 isoforms: the longer ORP3(1) and the shorter
           ORP3(2). ORP3(1), ORP6, and ORP7 all contain a
           N-terminal PH domain, a FFAT motif (two phenylalanines
           in an acidic tract), and a C-terminal OSBP-related
           domain. The shorter ORP3(2) is missing the C-terminal
           portion of its OSBP-related domain. Oxysterol binding
           proteins are a multigene family that is conserved in
           yeast, flies, worms, mammals and plants. In general
           OSBPs and ORPs have been found to be involved in the
           transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 123

 Score = 51.2 bits (123), Expect = 5e-08
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 8/101 (7%)

Query: 20  GWLFK---WTNYLKGYQKRWFVLSNGLLSYYRNQAEMSH-TCRGTISLRGAIIQT-EDSC 74
           G+L K   W   LKG+ KR+FVL  G+L Y ++  +++     G+I +  +++   + + 
Sbjct: 26  GYLLKKRKWP--LKGWHKRFFVLEKGILKYAKSPLDIAKGKLHGSIDVGLSVMSIKKKAR 83

Query: 75  TFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALV 115
              +      +H+KA ++     WV  L  A    RQ+ + 
Sbjct: 84  RIDLDTEEFIYHLKAKSQDLFDSWVAKLR-AHRLYRQNEIA 123


>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol
           3-beta-glucosyltransferase Pleckstrin homology (PH)
           domain, repeat 1.  ATG26 (also called
           UGT51/UDP-glycosyltransferase 51), a member of the
           glycosyltransferase 28 family, resulting in the
           biosynthesis of sterol glucoside. ATG26 in decane
           metabolism and autophagy. There are 32 known
           autophagy-related (ATG) proteins, 17 are components of
           the core autophagic machinery essential for all
           autophagy-related pathways and 15 are the additional
           components required only for certain pathways or
           species. The core autophagic machinery includes 1) the
           ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and
           ATG27), 2) the phosphatidylinositol 3-kinase complex
           (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the
           ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7,
           ATG8, ATG10, ATG12, and ATG16). Less is known about how
           the core machinery is adapted or modulated with
           additional components to accommodate the nonselective
           sequestration of bulk cytosol (autophagosome formation)
           or selective sequestration of specific cargos (Cvt
           vesicle, pexophagosome, or bacteria-containing
           autophagosome formation). The pexophagosome-specific
           additions include the ATG30-ATG11-ATG17
           receptor-adaptors complex, the coiled-coil protein
           ATG25, and the sterol glucosyltransferase ATG26. ATG26
           is necessary for the degradation of medium peroxisomes.
           It contains 2 GRAM domains and a single PH domain. PH
           domains are only found in eukaryotes. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. PH domains also have
           diverse functions. They are often involved in targeting
           proteins to the plasma membrane, but few display strong
           specificity in lipid binding. Any specificity is usually
           determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 130

 Score = 50.3 bits (121), Expect = 1e-07
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAI-IQTEDSC-- 74
             G+L K       Y + WFVL   +LS+YR+  ++ +   GTI LR  I  +  D    
Sbjct: 31  KSGYLSKRGKRTPRYNRYWFVLKGDVLSWYRSSTDL-YFPHGTIDLRYGISAEITDKDKE 89

Query: 75  --TFIISNGVQTFHIKASNEVERQRWVTALE 103
              F I+   +T+  KA +E   + WV AL+
Sbjct: 90  TTHFKITTNSRTYTFKADSEPSAKEWVKALQ 120


>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH)
           domain, repeat 1.  The functions of these fungal
           proteins are unknown, but they all contain 2 PH domains.
           This cd represents the first PH repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 106

 Score = 48.4 bits (116), Expect = 3e-07
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 7/95 (7%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG----AIIQTE-D 72
             GWL K +   K ++KRWFVL    LSYY+++ E  +  R  I+L      A ++ +  
Sbjct: 8   KSGWLLKRSRKTKTWKKRWFVLRPCQLSYYKDEKE--YKLRRVINLSELTAVAPLKDKKR 65

Query: 73  SCTFIISNGVQTFHIKASNEVERQRWVTALELAKS 107
              F I    + +H +AS+E +   WV A+     
Sbjct: 66  KNVFAIYTPSKNYHFQASSEKDANEWVEAIREESR 100


>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and
           related proteins Pleckstrin homology (PH) domain.
           RhoGAP25 (also called ArhGap25) like other RhoGaps are
           involved in cell polarity, cell morphology and
           cytoskeletal organization. They act as GTPase activators
           for the Rac-type GTPases by converting them to an
           inactive GDP-bound state and control actin remodeling by
           inactivating Rac downstream of Rho leading to suppress
           leading edge protrusion and promotes cell retraction to
           achieve cellular polarity and are able to suppress RAC1
           and CDC42 activity in vitro. Overexpression of these
           proteins induces cell rounding with partial or complete
           disruption of actin stress fibers and formation of
           membrane ruffles, lamellipodia, and filopodia. This
           hierarchy contains RhoGAP22, RhoGAP24, and RhoGAP25.
           Members here contain an N-terminal PH domain followed by
           a RhoGAP domain and either a BAR or TATA Binding Protein
           (TBP) Associated Factor 4 (TAF4) domain. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 114

 Score = 48.1 bits (115), Expect = 4e-07
 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 18/99 (18%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAII-------QTED 72
           GWL K    +K +Q+RWFVL    L YY+++ E     +G I L G  +       +   
Sbjct: 7   GWLKKQGGIVKNWQRRWFVLRGDQLYYYKDEDESKP--QGCIPLPGNTVKELPFNPEEPG 64

Query: 73  SCTFIISNGV---------QTFHIKASNEVERQRWVTAL 102
              F I  G           ++ + A+++ E + WV  +
Sbjct: 65  KFLFEIIPGDGGTRRSANHDSYLLMANSQAEMEEWVKVI 103


>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat
           2.  MyoX, a MyTH-FERM myosin, is a molecular motor that
           has crucial functions in the transport and/or tethering
           of integrins in the actin-based extensions known as
           filopodia, microtubule binding, and in netrin-mediated
           axon guidance. It functions as a dimer. MyoX walks on
           bundles of actin, rather than single filaments, unlike
           the other unconventional myosins. MyoX is present in
           organisms ranging from humans to choanoflagellates, but
           not in Drosophila and Caenorhabditis elegans.MyoX
           consists of a N-terminal motor/head region, a neck made
           of 3 IQ motifs, and a tail consisting of a coiled-coil
           domain, a PEST region, 3 PH domains, a myosin tail
           homology 4 (MyTH4), and a FERM domain at its very
           C-terminus. The first PH domain in the MyoX tail is a
           split-PH domain, interupted by the second PH domain such
           that PH 1a and PH 1b flanks PH 2. The third PH domain
           (PH 3) follows the PH 1b domain. This cd contains the
           second PH repeat. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 47.8 bits (114), Expect = 7e-07
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 20  GWLFK---WTNYL--KGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGA---IIQTE 71
           GWL+K    ++ L  K ++ RWFVL + +L YY N  E      GTI +R A   +  T 
Sbjct: 11  GWLYKKGGGSSTLSRKNWKSRWFVLRDTVLKYYENDQE-GAKALGTIDIRSAKEIVDNTP 69

Query: 72  DSCTFIISNGVQTFHIKASNEVERQRWVTAL 102
               F I+   +T+H  A +  +  +W + L
Sbjct: 70  KENGFDITTPSRTYHFVAESPEDASQWFSVL 100


>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for
           Phosphoinositides-1-like Pleckstrin homology (PH)
           domain.  GRP1/cytohesin3 and the related proteins ARNO
           (ARF nucleotide-binding site opener)/cytohesin-2 and
           cytohesin-1 are ARF exchange factors that contain a
           pleckstrin homology (PH) domain thought to target these
           proteins to cell membranes through binding
           polyphosphoinositides. The PH domains of all three
           proteins exhibit relatively high affinity for
           PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G)
           and triglycine (3G) splice variants, differing only in
           the number of glycine residues in the PH domain,
           strongly influence the affinity and specificity for
           phosphoinositides. The 2G variants selectively bind
           PtdIns(3,4,5)P3 with high affinity,the 3G variants bind
           PtdIns(3,4,5)P3 with about 30-fold lower affinity and
           require the polybasic region for plasma membrane
           targeting. These ARF-GEFs share a common, tripartite
           structure consisting of an N-terminal coiled-coil
           domain, a central domain with homology to the yeast
           protein Sec7, a PH domain, and a C-terminal polybasic
           region. The Sec7 domain is autoinhibited by conserved
           elements proximal to the PH domain. GRP1 binds to the
           DNA binding domain of certain nuclear receptors
           (TRalpha, TRbeta, AR, ER, but not RXR), and can repress
           thyroid hormone receptor (TR)-mediated transactivation
           by decreasing TR-complex formation on thyroid hormone
           response elements. ARNO promotes sequential activation
           of Arf6, Cdc42 and Rac1 and insulin secretion. Cytohesin
           acts as a PI 3-kinase effector mediating biological
           responses including cell spreading and adhesion,
           chemotaxis, protein trafficking, and cytoskeletal
           rearrangements, only some of which appear to depend on
           their ability to activate ARFs. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 118

 Score = 47.3 bits (113), Expect = 1e-06
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 26/111 (23%)

Query: 17  EMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG-AIIQTEDS-- 73
           + +GWL K    +K +++RWF+L++  L Y+          RG I L   ++ + EDS  
Sbjct: 4   DREGWLLKLGGRVKSWKRRWFILTDNCLYYFEYTT--DKEPRGIIPLENLSVREVEDSKK 61

Query: 74  --C--TFIISNGV-----------------QTFHIKASNEVERQRWVTALE 103
             C   +  SN V                   + I A+ E E   W+ +++
Sbjct: 62  PFCFELYSPSNEVIKACKTDSDGKVVEGNHTVYRISAATEEEMDEWIKSIK 112


>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human
          MTMR5) Pleckstrin Homology (PH) domain.  Sbf1 is a
          myotubularin-related pseudo-phosphatase. Both Sbf1 and
          myotubularin interact with the SET domains of Hrx and
          other epigenetic regulatory proteins, but Sbf1 lacks
          phosphatase activity due to several amino acid changes
          in its structurally preserved catalytic pocket. It
          contains pleckstrin (PH), GEF, and myotubularin
          homology domains that are thought to be responsible for
          signaling and growth control. Sbf1 functions as an
          inhibitor of cellular growth. The N-terminal GEF
          homology domain serves to inhibit the transforming
          effects of Sbf1. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 106

 Score = 46.9 bits (112), Expect = 1e-06
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 14 SDAEMKGWLFKWTNYLKGYQKRWFVL--SNGLLSYYRNQAEMSHTCRGTISLR 64
               +G+L+K    LKG+++RWFVL  +   L YY ++ +    C+G I L+
Sbjct: 1  ESRTCEGYLYKRGALLKGWKQRWFVLDLTKHQLRYYESKEDTK--CKGVIDLQ 51


>gnl|CDD|241255 cd01220, PH1_FARP1-like, FERM, RhoGEF and pleckstrin
           domain-containing protein 1 and related proteins
           Pleckstrin Homology (PH) domain, repeat 1.  Members here
           include FARP1 (also called Chondrocyte-derived
           ezrin-like protein; PH domain-containing family C member
           2), FARP2 (also called FIR/FERM domain including RhoGEF;
           FGD1-related Cdc42-GEF/FRG), and FARP6 (also called Zinc
           finger FYVE domain-containing protein 24). They are
           members of the Dbl family guanine nucleotide exchange
           factors (GEFs) which are upstream positive regulators of
           Rho GTPases. Little is known about FARP1 and FARP6,
           though FARP1 has increased expression in differentiated
           chondrocytes. FARP2 is thought to regulate neurite
           remodeling by mediating the signaling pathways from
           membrane proteins to Rac. It is found in brain, lung,
           and testis, as well as embryonic hippocampal and
           cortical neurons. FARP1 and FARP2 are composed of a
           N-terminal FERM domain, a proline-rich (PR) domain,
           Dbl-homology (DH), and two C-terminal PH domains. FARP6
           is composed of Dbl-homology (DH), and two C-terminal PH
           domains separated by a FYVE domain. This hierarchy
           contains the first PH repeat. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 123

 Score = 47.3 bits (113), Expect = 1e-06
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 17/104 (16%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYY------RNQAEMSHTCRGTISLRGAIIQ-TED 72
           G L K +   KG Q+R F L + +L Y         Q ++     G + LRG +++ +E 
Sbjct: 26  GCLLKLS--KKGLQQRMFFLFSDVLIYTSRGPTSTLQFKV----HGQLPLRGLMVEESEP 79

Query: 73  SC----TFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQH 112
                  F I  G +   + AS+E E++RW+  L  A   A++ 
Sbjct: 80  EMGVPHCFTIYGGNRALTVAASSEEEKERWLEDLSRAIDAAKKS 123


>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin
           homology (PH) domain.  SWAP-70 (also called
           Differentially expressed in FDCP 6/DEF-6 or IRF4-binding
           protein) functions in cellular signal transduction
           pathways (in conjunction with Rac), regulates cell
           motility through actin rearrangement, and contributes to
           the transformation and invasion activity of mouse embryo
           fibroblasts. Metazoan SWAP-70 is found in B lymphocytes,
           mast cells, and in a variety of organs. Metazoan SWAP-70
           contains an N-terminal EF-hand motif, a centrally
           located PH domain, and a C-terminal coiled-coil domain.
           The PH domain of Metazoan SWAP-70 contains a
           phosphoinositide-binding site and a nuclear localization
           signal (NLS), which localize SWAP-70 to the plasma
           membrane and nucleus, respectively. The NLS is a
           sequence of four Lys residues located at the N-terminus
           of the C-terminal a-helix; this is a unique
           characteristic of the Metazoan SWAP-70 PH domain. The
           SWAP-70 PH domain binds PtdIns(3,4,5)P3 and
           PtdIns(4,5)P2 embedded in lipid bilayer vesicles. There
           are additional plant SWAP70 proteins, but these are not
           included in this hierarchy. Rice SWAP70 (OsSWAP70)
           exhibits GEF activity toward the its Rho GTPase, OsRac1,
           and regulates chitin-induced production of reactive
           oxygen species and defense gene expression in rice.
           Arabidopsis SWAP70 (AtSWAP70) plays a role in both PAMP-
           and effector-triggered immunity. Plant SWAP70 contains
           both DH and PH domains, but their arrangement is the
           reverse of that in typical DH-PH-type Rho GEFs, wherein
           the DH domain is flanked by a C-terminal PH domain. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 110

 Score = 45.7 bits (109), Expect = 3e-06
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 19  KGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISL----RGAIIQTEDS- 73
           KG+L+K  + L  +++RWFVL    LSYY+++       +G I+L        +   +  
Sbjct: 11  KGYLWKKGHLLPTWRERWFVLKPNSLSYYKSEDLKEK--KGEIALDSNCCVESLPDREGK 68

Query: 74  -CTFIISNGVQTFHIKASNEVERQRWVTALELA 105
            C F +    +T+ + AS+   RQ W+ A++ A
Sbjct: 69  KCRFCVKTPDKTYELSASDHKTRQEWIQAIQTA 101


>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain, repeat 1.  ARAP
           proteins (also called centaurin delta) are
           phosphatidylinositol 3,4,5-trisphosphate-dependent
           GTPase-activating proteins that modulate actin
           cytoskeleton remodeling by regulating ARF and RHO family
           members. They bind phosphatidylinositol
           3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
           phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
           binding. There are 3 mammalian ARAP proteins: ARAP1,
           ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
           SAM (sterile alpha motif) domain, 5 PH domains, an
           ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
           Ras-associating domain. This hierarchy contains the
           first PH domain in ARAP. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 93

 Score = 45.0 bits (107), Expect = 4e-06
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 19  KGWLFKWT---NYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQ---TED 72
            GWL K +   NY   +QKRW V     L Y+ ++ EM    +G I L  +I       D
Sbjct: 3   SGWLDKLSPQGNY--VFQKRWVVFDGDSLRYFNSEKEM--YSKGIIPL-SSIKTVRSVGD 57

Query: 73  SCTFIISNGVQTFHIKASNEVERQRWVTALELAKSK 108
           +   +++   +TF  +A +E ER  WV+ L  A S+
Sbjct: 58  NKFEVVTGN-RTFVFRAESEDERNLWVSTLMAAISE 92


>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
           Pleckstrin homology (PH) domain, C-terminal repeat.  The
           binding of TAPP1 (also called PLEKHA1/pleckstrin
           homology domain containing, family A (phosphoinositide
           binding specific) member 1) and TAPP2 (also called
           PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
           5)P3, function as negative regulators of insulin and
           PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
           complex). TAPP1 and TAPP2 contain two sequential PH
           domains in which the C-terminal PH domain specifically
           binds PtdIns(3,4)P2 with high affinity. The N-terminal
           PH domain does not interact with any phosphoinositide
           tested. They also contain a C-terminal PDZ-binding motif
           that interacts with several PDZ-binding proteins,
           including PTPN13 (known previously as PTPL1 or FAP-1) as
           well as the scaffolding proteins MUPP1 (multiple
           PDZ-domain-containing protein 1), syntrophin and
           utrophin. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 45.0 bits (107), Expect = 7e-06
 Identities = 19/92 (20%), Positives = 44/92 (47%), Gaps = 10/92 (10%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAE--------MSHTCRGTISLRGAIIQTE 71
           G+  K     K +++R+F+L +  +SYY+++ +        +    +    L G ++  +
Sbjct: 12  GYCVKQGAVRKNWKRRYFILDDNTISYYKSETDKEPLRTIPLKEVLKVHECLSGDLLMRD 71

Query: 72  DSCTFIISNGVQTFHIKASNEVERQRWVTALE 103
           +   F I    +TF+I+A +  +   W+ A+ 
Sbjct: 72  N--LFEIITTSRTFYIQADSPEDMHSWIKAIS 101


>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH)
           domain.  Btk is a member of the Tec family of
           cytoplasmic protein tyrosine kinases that includes BMX,
           IL2-inducible T-cell kinase (Itk) and Tec. Btk plays a
           role in the maturation of B cells. Tec proteins general
           have an N-terminal PH domain, followed by a Tek homology
           (TH) domain, a SH3 domain, a SH2 domain and a kinase
           domain. The Btk PH domain binds phosphatidylinositol
           3,4,5-trisphosphate and responds to signalling via
           phosphatidylinositol 3-kinase. The PH domain is also
           involved in membrane anchoring which is confirmed by the
           discovery of a mutation of a critical arginine residue
           in the BTK PH domain. This results in severe human
           immunodeficiency known as X-linked agammaglobulinemia
           (XLA) in humans and a related disorder is mice.PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 140

 Score = 44.9 bits (107), Expect = 1e-05
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query: 32  YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAII----QTEDSCT----FIISNGVQ 83
           Y++RWFVL+   LSYY          +G+I L         + + S      F +     
Sbjct: 20  YKERWFVLTKSSLSYYEGDGGKRGKEKGSIDLSKIKCVEEVKDDASFERKYPFQVVYDDY 79

Query: 84  TFHIKASNEVERQRWVTAL 102
           T ++ A +E +R  W+ AL
Sbjct: 80  TLYVFAPSEEDRDEWILAL 98


>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1
          Pleckstrin homology (PH) domain.  Adaptor protein Skap1
          (also called Skap55/Src kinase-associated
          phosphoprotein of 55 kDa) and its partner, ADAP
          (adhesion and degranulation promoting adapter protein)
          help reorganize the cytoskeleton and/or promote
          integrin-mediated adhesion upon immunoreceptor
          activation. Skap1 is also involved in T Cell Receptor
          (TCR)-induced RapL-Rap1 complex formation and LFA-1
          activation. Skap1 has an N-terminal coiled-coil
          conformation which is proposed to be involved in
          homodimer formation, a central PH domain and a
          C-terminal SH3 domain that associates with ADAP. The
          Skap1 PH domain plays a role in controlling integrin
          function via recruitment of ADAP-SKAP complexes to
          integrins as well as in controlling the ability of ADAP
          to interact with the CBM signalosome and regulate
          NF-kappaB. SKAP1 is necessary for RapL binding to
          membranes in a PH domain-dependent manner and the PI3K
          pathway. Skap adaptor proteins couple receptors to
          cytoskeletal rearrangements. Skap55/Skap1, Skap2, and
          Skap-homology (Skap-hom) have an N-terminal coiled-coil
          conformation, a central PH domain and a C-terminal SH3
          domain. Their PH domains bind 3'-phosphoinositides as
          well as directly affecting targets such as in Skap55
          where it directly affecting integrin regulation by ADAP
          and NF-kappaB activation or in Skap-hom where the
          dimerization and PH domains comprise a
          3'-phosphoinositide-gated molecular switch that
          controls ruffle formation. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 106

 Score = 43.4 bits (102), Expect = 2e-05
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 32 YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQT---------EDSCTFIISNGV 82
          +QKRW VL+     YY N  E S   +G   ++ ++ Q           DSC  + +   
Sbjct: 21 WQKRWCVLTTRAFYYYAN--EKSKQPKGGFLIKDSLAQMAPHLRKDSRRDSCFELTTPNQ 78

Query: 83 QTFHIKASNEVERQRWV 99
          +T+   A++  E + WV
Sbjct: 79 RTYEFTAASPSEARDWV 95


>gnl|CDD|241270 cd01237, PH_fermitin, Fermitin family pleckstrin homology (PH)
           domain.  Fermitin functions as a mediator of integrin
           inside-out signalling. The recruitment of Fermitin
           proteins and Talin to the membrane mediates the terminal
           event of integrin signalling, via interaction with
           integrin beta subunits. Fermatin has FERM domain
           interrupted with a pleckstrin homology (PH) domain.
           Fermitin family homologs (Fermt1, 2, and 3, also known
           as Kindlins) are each encoded by a different gene. In
           mammalian studies, Fermt1 is generally expressed in
           epithelial cells, Fermt2 is expressed inmuscle tissues,
           and Fermt3 is expressed in hematopoietic lineages.
           Specifically Fermt2 is expressed in smooth and striated
           muscle tissues in mice and in the somites (a trunk
           muscle precursor) and neural crest in Xenopus embryos.
           As such it has been proposed that Fermt2 plays a role in
           cardiomyocyte and neural crest differentiation.
           Expression of mammalian Fermt3 is associated with
           hematopoietic lineages: the anterior ventral blood
           islands, vitelline veins, and early myeloid cells. In
           Xenopus embryos this expression, also include the
           notochord and cement gland. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 41.2 bits (97), Expect = 1e-04
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 13/109 (11%)

Query: 17  EMKGWL--FKWTNY-LKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDS 73
           E+  +L  FK   + LKG+++ WFV  +  LSYY+++ E +      I+L+G  +  + +
Sbjct: 2   ELADYLKYFKPKKFTLKGFKRYWFVFKDTHLSYYKSKEESNGAPIQQINLKGCEVTPDVN 61

Query: 74  CT---FII------SNGVQTFHIKASNEVERQRWVTALELAKSKARQHA 113
            +   F I        G+    ++  +E +  +W+ A  LA SK +  A
Sbjct: 62  VSQGKFGIKLLIPSPEGMNEVWLRCDSEEQYAKWMAACRLA-SKGKTMA 109


>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
           domain, repeat 1.  Pleckstrin is a protein found in
           platelets. This name is derived from platelet and
           leukocyte C kinase substrate and the KSTR string of
           amino acids. Pleckstrin 2 contains two PH domains and a
           DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
           pleckstrin 1, pleckstrin 2 does not contain obvious
           sites of PKC phosphorylation. Pleckstrin 2 plays a role
           in actin rearrangement, large lamellipodia and
           peripheral ruffle formation, and may help orchestrate
           cytoskeletal arrangement. The PH domains of pleckstrin 2
           are thought to contribute to lamellipodia formation.
           This cd contains the first PH domain repeat. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 108

 Score = 40.8 bits (96), Expect = 2e-04
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 13/95 (13%)

Query: 20  GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCT---- 75
           G+L K  + +  ++ RWFVL    L YY+ + + S   +G I L+G  I +   C     
Sbjct: 7   GFLVKKGHVVNNWKARWFVLLEDKLEYYKKKTDSSP--KGMILLKGCTITS--PCLEYEK 62

Query: 76  ----FIISNGVQTFH-IKASNEVERQRWVTALELA 105
               F ++      H ++A +  ER  W   +  A
Sbjct: 63  RPLVFKLTTAKGQDHFLQACSREERDAWAKDITKA 97


>gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family
           Pleckstrin homology (PH) domain.  Gab proteins are
           scaffolding adaptor proteins, which possess N-terminal
           PH domains and a C-terminus with proline-rich regions
           and multiple phosphorylation sites. Following activation
           of growth factor receptors, Gab proteins are tyrosine
           phosphorylated and activate PI3K, which generates
           3-phosphoinositide lipids. By binding to these lipids
           via the PH domain, Gab proteins remain in proximity to
           the receptor, leading to further signaling. While not
           all Gab proteins depend on the PH domain for
           recruitment, it is required for Gab activity. There are
           3 families: Gab1, Gab2, and Gab3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 103

 Score = 40.5 bits (95), Expect = 2e-04
 Identities = 26/103 (25%), Positives = 39/103 (37%), Gaps = 26/103 (25%)

Query: 14  SDAEMKGWLFKWTNYLKGYQKRWFVLSNG-------LLSYYRNQAEMSHTCRGTISLR-- 64
           S  E K     W       +KRWFVL +G       +L YY++         G I L   
Sbjct: 8   SPPEKKIKRAAW-------KKRWFVLRSGRLSGDPDVLEYYKDDH--CKKPIGAIDLDEC 58

Query: 65  -----GAIIQTED---SCTFIISNGVQTFHIKASNEVERQRWV 99
                G   + ++      F I    +T+++ A  E E  +WV
Sbjct: 59  EQVDAGLTFEYKEFKNQFIFDIVTPKRTYYLVAETEEEMNKWV 101


>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein
          family Pleckstrin homology (PH) domain.  Skap adaptor
          proteins couple receptors to cytoskeletal
          rearrangements. Src kinase-associated phosphoprotein of
          55 kDa (Skap55)/Src kinase-associated phosphoprotein 1
          (Skap1), Skap2, and Skap-homology (Skap-hom) have an
          N-terminal coiled-coil conformation, a central PH
          domain and a C-terminal SH3 domain. Their PH domains
          bind 3'-phosphoinositides as well as directly affecting
          targets such as in Skap55 where it directly affecting
          integrin regulation by ADAP and NF-kappaB activation or
          in Skap-hom where the dimerization and PH domains
          comprise a 3'-phosphoinositide-gated molecular switch
          that controls ruffle formation. PH domains are only
          found in eukaryotes. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 106

 Score = 40.5 bits (95), Expect = 2e-04
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 11/77 (14%)

Query: 32 YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQ---------TEDSCTFIISNGV 82
          +QKRW VLSN    YY +  E     +G  ++ G   +          +D C  I +   
Sbjct: 21 WQKRWCVLSNTAFYYYGS--EKDKQQKGEFAIDGYRARMNPTLRKDSKKDCCFEISAPDK 78

Query: 83 QTFHIKASNEVERQRWV 99
          + +   A++  E + WV
Sbjct: 79 RVYQFTAASPKEAREWV 95


>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin
          homology (PH) domain.  RhoGAP2 (also called RhoGap22 or
          ArhGap22) are involved in cell polarity, cell
          morphology and cytoskeletal organization. They activate
          a GTPase belonging to the RAS superfamily of small
          GTP-binding proteins. The encoded protein is
          insulin-responsive, is dependent on the kinase Akt, and
          requires the Akt-dependent 14-3-3 binding protein which
          binds sequentially to two serine residues resulting in
          regulation of cell motility. Members here contain an
          N-terminal PH domain followed by a RhoGAP domain and
          either a BAR or TATA Binding Protein (TBP) Associated
          Factor 4 (TAF4) domain. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 116

 Score = 40.7 bits (95), Expect = 2e-04
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 20 GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG 65
          GWL K  + +K +Q+RWFVL    L YY+++ E     +G ISL+G
Sbjct: 7  GWLKKQRSIMKNWQQRWFVLRGDQLFYYKDEEETKP--QGCISLQG 50


>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain.  There
           are 2 members of the evectin family (also called
           pleckstrin homology domain containing, family B): evt-1
           (also called PLEKHB1) and evt-2 (also called PLEKHB2).
           evt-1 is specific to the nervous system, where it is
           expressed in photoreceptors and myelinating glia. evt-2
           is widely expressed in both neural and nonneural
           tissues. Evectins possess a single N-terminal PH domain
           and a C-terminal hydrophobic region. evt-1 is thought to
           function as a mediator of post-Golgi trafficking in
           cells that produce large membrane-rich organelles. It is
           a candidate gene for the inherited human retinopathy
           autosomal dominant familial exudative vitreoretinopathy
           and a susceptibility gene for multiple sclerosis. evt-2
           is essential for retrograde endosomal membrane transport
           from the plasma membrane (PM) to the Golgi. Two membrane
           trafficking pathways pass through recycling endosomes: a
           recycling pathway and a retrograde pathway that links
           the PM to the Golgi/ER. Its PH domain that is unique in
           that it specifically recognizes phosphatidylserine (PS),
           but not polyphosphoinositides. PS is an anionic
           phospholipid class in eukaryotic biomembranes, is highly
           enriched in the PM, and plays key roles in various
           physiological processes such as the coagulation cascade,
           recruitment and activation of signaling molecules, and
           clearance of apoptotic cells. PH domains are only found
           in eukaryotes. They share little sequence conservation,
           but all have a common fold, which is electrostatically
           polarized. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 108

 Score = 40.0 bits (94), Expect = 3e-04
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 19/104 (18%)

Query: 20  GWLFKWTNYLKGYQKRWFVL-SNGLLSYYRNQAEMSHTCRGTISLRGAII---------- 68
           GWL + +  LK ++K WFVL S+G LSYY  + E      G I++               
Sbjct: 7   GWLLRQSTILKRWKKNWFVLYSDGELSYY--EDESRRDVEGRINMPIECRNIRVGLECRD 64

Query: 69  ------QTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAK 106
                 ++ D    I++   +   + A +  +   W  ALE A+
Sbjct: 65  VQPPEGRSRDCLLQIVTRDGKRLILCAESADDALAWKLALEDAR 108


>gnl|CDD|241536 cd13385, PH_Gab3, Grb2-associated binding protein 3 pleckstrin
           homology (PH) domain.  The Gab subfamily includes
           several Gab proteins, Drosophila DOS and C. elegans
           SOC-1. They are scaffolding adaptor proteins, which
           possess N-terminal PH domains and a C-terminus with
           proline-rich regions and multiple phosphorylation sites.
           Following activation of growth factor receptors, Gab
           proteins are tyrosine phosphorylated and activate PI3K,
           which generates 3-phosphoinositide lipids. By binding to
           these lipids via the PH domain, Gab proteins remain in
           proximity to the receptor, leading to further signaling.
           While not all Gab proteins depend on the PH domain for
           recruitment, it is required for Gab activity. The
           members in this cd include the Gab1, Gab2, and Gab3
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 40.3 bits (94), Expect = 4e-04
 Identities = 35/108 (32%), Positives = 46/108 (42%), Gaps = 20/108 (18%)

Query: 12  SHSDAEMKGWLFKW--TNYLKGY--QKRWFVLSNG-------LLSYYRNQAEMS------ 54
           S  D    GWL K      LK Y  +KRWFVL  G       +L YYRN+          
Sbjct: 2   SAGDVVCTGWLIKSPPEKKLKRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSKKPIRVID 61

Query: 55  -HTCRGTISLRGAIIQTE--DSCTFIISNGVQTFHIKASNEVERQRWV 99
            + C  T       I+ E  ++  FI+    +TF++ A  E E Q WV
Sbjct: 62  LNECEVTKHAGVNFIKKEFQNNFVFIVKTTTRTFYLVAKTEEEMQDWV 109


>gnl|CDD|241535 cd13384, PH_Gab2_2, Grb2-associated binding protein family
           pleckstrin homology (PH) domain.  The Gab subfamily
           includes several Gab proteins, Drosophila DOS and C.
           elegans SOC-1. They are scaffolding adaptor proteins,
           which possess N-terminal PH domains and a C-terminus
           with proline-rich regions and multiple phosphorylation
           sites. Following activation of growth factor receptors,
           Gab proteins are tyrosine phosphorylated and activate
           PI3K, which generates 3-phosphoinositide lipids. By
           binding to these lipids via the PH domain, Gab proteins
           remain in proximity to the receptor, leading to further
           signaling. While not all Gab proteins depend on the PH
           domain for recruitment, it is required for Gab activity.
           Members here include insect, nematodes, and crustacean
           Gab2s. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 115

 Score = 39.0 bits (91), Expect = 0.001
 Identities = 28/107 (26%), Positives = 43/107 (40%), Gaps = 29/107 (27%)

Query: 20  GWLFK----WTNYLKGYQKRWFVLSNG------LLSYYRNQAEMSHTCR---GTISLR-- 64
           GWL K       +   +++R+FVL          L YY +      TCR   G+I L   
Sbjct: 7   GWLTKSPPEKRIWRAKWRRRYFVLRQSEIPGQYFLEYYTD-----RTCRKLKGSIDLDQC 61

Query: 65  -----GAIIQTE----DSCTFIISNGVQTFHIKASNEVERQRWVTAL 102
                G   +T+    D   F I    +T+++ A  E E  +WV  +
Sbjct: 62  EQVDAGLTFETKNKLKDQHIFDIRTPKRTYYLVADTEDEMNKWVNCI 108


>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein
          Pleckstrin homology (PH) domain.  M-RIP is proposed to
          play a role in myosin phosphatase regulation by RhoA.
          M-RIP contains 2 PH domains followed by a Rho binding
          domain (Rho-BD), and a C-terminal myosin binding
          subunit (MBS) binding domain (MBS-BD). The amino
          terminus of M-RIP with its adjacent PH domains and
          polyproline motifs mediates binding to both actin and
          Galpha. M-RIP brings RhoA and MBS into close proximity
          where M-RIP can target RhoA to the myosin phosphatase
          complex to regulate the myosin phosphorylation state.
          M-RIP does this via its C-terminal coiled-coil domain
          which interacts with the MBS leucine zipper domain of
          myosin phosphatase, while its Rho-BD, directly binds
          RhoA in a nucleotide-independent manner. PH domains
          have diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 103

 Score = 38.1 bits (89), Expect = 0.001
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 19 KGWLFKWTNYLKGYQKRWFVLSNGLLSYYRN-QAEMSHTCRGTISLR 64
          KGWL K       ++K WFVL +  L YYR+  AE +    G I L 
Sbjct: 2  KGWLMKQDED-GEWKKHWFVLRDASLRYYRDSVAEEAGELDGVIDLS 47


>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH
           domain-containing protein Pleckstrin homology (PH)
           domain.  AGAP (also called centaurin gamma;
           PIKE/Phosphatidylinositol-3-kinase enhancer) reside
           mainly in the nucleus and are known to activate
           phosphoinositide 3-kinase, a key regulator of cell
           proliferation, motility and vesicular trafficking. There
           are 3 isoforms of AGAP (PIKE-A, PIKE-L, and PIKE-S) the
           longest of which PIKE-L consists of N-terminal proline
           rich domains (PRDs), followed by a GTPase domain, a
           split PH domain (PHN and PHC), an ArfGAP domain and two
           ankyrin repeats. PIKE-S terminates after the PHN domain
           and PIKE-A is missing the PRD region. Centaurin binds
           phosphatidlyinositol (3,4,5)P3. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 114

 Score = 38.5 bits (90), Expect = 0.001
 Identities = 21/99 (21%), Positives = 40/99 (40%), Gaps = 15/99 (15%)

Query: 20  GWLFKW-TNYLK--GYQKRWFVLSNGLLSYYRNQAE-MSHTCRGTISLRGAII------- 68
           G+L+K  +  L     +K   +  +G L+Y+ +  + M +     I L    +       
Sbjct: 8   GYLYKRSSKSLNKEWKKKYVTLCDDGRLTYHPSLHDYMENVHGKEIDLLRTTVKVPGKRP 67

Query: 69  ----QTEDSCTFIISNGVQTFHIKASNEVERQRWVTALE 103
                       I+S   + +H +A++  ER  WV A+E
Sbjct: 68  PRASSKSAFEFIIVSLDGKQWHFEAASSEERDEWVQAIE 106


>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology
           (PH) domain.  SH3BP2 (the gene that encodes the adaptor
           protein 3BP2), HD, ITU, IT10C3, and ADD1 are located
           near the Huntington's Disease Gene on Human Chromosome
           4pl6.3. SH3BP2 lies in a region that is often missing in
           individuals with Wolf-Hirschhorn syndrome (WHS). Gain of
           function mutations in SH3BP2 causes enhanced B-cell
           antigen receptor (BCR)-mediated activation of nuclear
           factor of activated T cells (NFAT), resulting in a rare,
           genetic disorder called cherubism. This results in an
           increase in the signaling complex formation with Syk,
           phospholipase C-gamma2 (PLC-gamma2), and Vav1. It was
           recently discovered that Tankyrase regulates 3BP2
           stability through ADP-ribosylation and ubiquitylation by
           the E3-ubiquitin ligase. Cherubism mutations uncouple
           3BP2 from Tankyrase-mediated protein destruction, which
           results in its stabilization and subsequent
           hyperactivation of the Src, Syk, and Vav signaling
           pathways. SH3BP2 is also a potential negative regulator
           of the abl oncogene. PH domains have diverse functions,
           but in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 113

 Score = 38.1 bits (89), Expect = 0.001
 Identities = 21/95 (22%), Positives = 41/95 (43%), Gaps = 14/95 (14%)

Query: 20  GWLFKWTNYLKG---YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGA-IIQTEDSCT 75
           G+L K     K    +  R+ ++  G + Y++N    S   +G  SL G      E++ +
Sbjct: 13  GYLTKKGGSQKQLLKWPLRYVIIHKGCVYYFKNS--QSAKPKGVFSLNGYNRRAAEETTS 70

Query: 76  FI--------ISNGVQTFHIKASNEVERQRWVTAL 102
                     +S   +T++  A +E E + W+ +L
Sbjct: 71  KKKFVFKIIHLSKDHRTWYFSAKSEDEMKEWMESL 105


>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase
           suppressor of ras) (CNK) pleckstrin homology (PH)
           domain.  CNK family members function as protein
           scaffolds, regulating the activity and the subcellular
           localization of RAS activated RAF. There is a single CNK
           protein present in Drosophila and Caenorhabditis elegans
           in contrast to mammals which have 3 CNK proteins (CNK1,
           CNK2, and CNK3). All of the CNK members contain a
           sterile a motif (SAM), a conserved region in CNK (CRIC)
           domain, and a PSD-95/DLG-1/ZO-1 (PDZ) domain, and, with
           the exception of CNK3, a PH domain. A CNK2 splice
           variant CNK2A also has a PDZ domain-binding motif at its
           C terminus and Drosophila CNK (D-CNK) also has a domain
           known as the Raf-interacting region (RIR) that mediates
           binding of the Drosophila Raf kinase. This cd contains
           CNKs from mammals, chickens, amphibians, fish, and
           crustacea. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 38.1 bits (89), Expect = 0.002
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 13/99 (13%)

Query: 20  GWLFKWTNYLKGY-----QKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSC 74
           GWL+K     KG+     ++ WFVL    L +Y N         G I+L    I+    C
Sbjct: 17  GWLWKKKEA-KGFFGQKWKRYWFVLKGSSLYWYNNP--QDEKAEGFINLPDFKIERASEC 73

Query: 75  ----TFIISN-GVQTFHIKASNEVERQRWVTALELAKSK 108
                F  S+  ++TF+  A N  +  +W++ L  A +K
Sbjct: 74  KKKYAFKASHPKIKTFYFAAENLDDMNKWLSKLITAINK 112


>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology
           (PH) domain, repeat 2.  ADAP (also called centaurin
           alpha) is a phophatidlyinositide binding protein
           consisting of an N-terminal ArfGAP domain and two PH
           domains. In response to growth factor activation, PI3K
           phosphorylates phosphatidylinositol 4,5-bisphosphate to
           phosphatidylinositol 3,4,5-trisphosphate. Centaurin
           alpha 1 is recruited to the plasma membrane following
           growth factor stimulation by specific binding of its PH
           domain to phosphatidylinositol 3,4,5-trisphosphate.
           Centaurin alpha 2 is constitutively bound to the plasma
           membrane since it binds phosphatidylinositol
           4,5-bisphosphate and phosphatidylinositol
           3,4,5-trisphosphate with equal affinity. This cd
           contains the second PH domain repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 37.2 bits (87), Expect = 0.003
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 17/105 (16%)

Query: 18  MKGWLFKWTNYLK--GYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISL----------RG 65
            +G+L K T   +  G++KRWF L +  L Y+++   +    +G I +           G
Sbjct: 4   KEGYLEK-TGPKQTDGFRKRWFTLDDRRLMYFKDP--LDAFPKGEIFIGSKEEGYSVREG 60

Query: 66  AI--IQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSK 108
               I+      F +    +TF + A  E ER+ W+TA++    +
Sbjct: 61  LPAGIKGHWGFGFTLVTPDRTFVLSAETEEERREWITAIQKVLER 105


>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate
           4-phosphatase and Type II inositol 3,4-bisphosphate
           4-phosphatase Pleckstrin homology (PH) domain.  INPP4A
           (also called Inositol polyphosphate 4-phosphatase type
           I) and INPP4B (also called Inositol polyphosphate
           4-phosphatase type II) both catalyze the hydrolysis of
           the 4-position phosphate of phosphatidylinositol
           3,4-bisphosphate and inositol 1,3,4-trisphosphate. They
           differ in that INPP4A additionally catalyzes the
           hydrolysis of the 4-position phosphate of inositol
           3,4-bisphosphate, while INPP4B catalyzes the hydrolysis
           of the 4-position phosphate of inositol
           1,4-bisphosphate. They both have a single PH domain
           followed by a C2 domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 116

 Score = 36.8 bits (86), Expect = 0.004
 Identities = 21/86 (24%), Positives = 35/86 (40%), Gaps = 16/86 (18%)

Query: 30  KGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHI-- 87
           + +++RWF L   LL Y+++  E      G I L    +Q E+        G   F +  
Sbjct: 13  EVFKERWFKLRGNLLFYFKSN-EPGSEPAGVIVLENCRVQREEP-----DPGGFAFSLVF 66

Query: 88  --------KASNEVERQRWVTALELA 105
                      +E ER  W+ A++ A
Sbjct: 67  KDEKKYRFSCRSEEERDEWIEAIKQA 92


>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and
          3-Phosphoinositides Pleckstrin homology (PH) domain.
          DAPP1 (also known as PHISH/3'
          phosphoinositide-interacting SH2 domain-containing
          protein or Bam32) plays a role in B-cell activation and
          has potential roles in T-cell and mast cell function.
          DAPP1 promotes B cell receptor (BCR) induced activation
          of Rho GTPases Rac1 and Cdc42, which feed into
          mitogen-activated protein kinases (MAPK) activation
          pathways and affect cytoskeletal rearrangement.
          DAPP1can also regulate BCR-induced activation of
          extracellular signal-regulated kinase (ERK), and c-jun
          NH2-terminal kinase (JNK). DAPP1 contains an N-terminal
          SH2 domain and a C-terminal pleckstrin homology (PH)
          domain with a single tyrosine phosphorylation site
          located centrally. DAPP1 binds strongly to both
          PtdIns(3,4,5)P3 and PtdIns(3,4)P2. The PH domain is
          essential for plasma membrane recruitment of PI3K upon
          cell activation. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 96

 Score = 36.1 bits (84), Expect = 0.005
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 7/85 (8%)

Query: 20 GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCT---- 75
          G+L K    +K ++ RWFVL    L Y++ + + +   R T+ L        D       
Sbjct: 7  GYLTKQGGIVKNWKTRWFVLRKNELKYFKTRTD-TKPIR-TLDLTECSSVQADYSQGKPN 64

Query: 76 -FIISNGVQTFHIKASNEVERQRWV 99
           F +    +TF++ A  E E   WV
Sbjct: 65 CFRLVFPDRTFYMYAKTEEEADEWV 89


>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH)
           domain, repeat 3.  MyoX, a MyTH-FERM myosin, is a
           molecular motor that has crucial functions in the
           transport and/or tethering of integrins in the
           actin-based extensions known as filopodia, microtubule
           binding, and in netrin-mediated axon guidance. It
           functions as a dimer. MyoX walks on bundles of actin,
           rather than single filaments, unlike the other
           unconventional myosins. MyoX is present in organisms
           ranging from humans to choanoflagellates, but not in
           Drosophila and Caenorhabditis elegans.MyoX consists of a
           N-terminal motor/head region, a neck made of 3 IQ
           motifs, and a tail consisting of a coiled-coil domain, a
           PEST region, 3 PH domains, a myosin tail homology 4
           (MyTH4), and a FERM domain at its very C-terminus. The
           first PH domain in the MyoX tail is a split-PH domain,
           interupted by the second PH domain such that PH 1a and
           PH 1b flanks PH 2. The third PH domain (PH 3) follows
           the PH 1b domain. This cd contains the third MyoX PH
           repeat. PLEKHH3/Pleckstrin homology (PH) domain
           containing, family H (with MyTH4 domain) member 3 is
           also part of this CD and like MyoX contains a FERM
           domain, a MyTH4 domain, and a single PH domain. Not much
           is known about the function of PLEKHH3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 123

 Score = 36.2 bits (84), Expect = 0.009
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 13/109 (11%)

Query: 14  SDAEMKGWLFKWTNYLKG--YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG--AIIQ 69
            +   KGWL K          +KRWFVL+   L YY++    +    G++ L    +++ 
Sbjct: 11  QEVIEKGWLLKEGGKGGNLTKKKRWFVLTPNSLDYYKSSERNALKL-GSLVLNSLCSVVP 69

Query: 70  TEDSC-------TFIISNGVQTFHIKASNEVERQRWVTAL-ELAKSKAR 110
            ++         TF +     ++++    + E  RWV A+ E+  SK  
Sbjct: 70  PDEKVYKETGYWTFTVHGRKHSYYLYTKLQEEANRWVNAIQEVIDSKPP 118


>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin
          homology (PH) domain.  RhoGap24 (also called ARHGAP24,
          p73RhoGAp, and Filamin-A-associated RhoGAP) like other
          RhoGAPs are involved in cell polarity, cell morphology
          and cytoskeletal organization. They act as GTPase
          activators for the Rac-type GTPases by converting them
          to an inactive GDP-bound state and control actin
          remodeling by inactivating Rac downstream of Rho
          leading to suppress leading edge protrusion and
          promotes cell retraction to achieve cellular polarity
          and are able to suppress RAC1 and CDC42 activity in
          vitro. Overexpression of these proteins induces cell
          rounding with partial or complete disruption of actin
          stress fibers and formation of membrane ruffles,
          lamellipodia, and filopodia. Members here contain an
          N-terminal PH domain followed by a RhoGAP domain and
          either a BAR or TATA Binding Protein (TBP) Associated
          Factor 4 (TAF4) domain. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 114

 Score = 35.7 bits (82), Expect = 0.012
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 20 GWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG 65
          GWL K   ++K +  RWFVL    L Y++++ E      GTI L G
Sbjct: 7  GWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL--GTIFLPG 50


>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin
           homology (PH) domain.  DOCK-D subfamily (also called
           Zizimin subfamily) consists of Dock9/Zizimin1,
           Dock10/Zizimin3, and Dock11/Zizimin2. DOCK-D has a
           N-terminal DUF3398 domain, a PH-like domain, a Dock
           Homology Region 1, DHR1 (also called CZH1), a C2 domain,
           and a C-terminal DHR2 domain (also called CZH2).
           Zizimin1 is enriched in the brain, lung, and kidney;
           zizimin2 is found in B and T lymphocytes, and zizimin3
           is enriched in brain, lung, spleen and thymus. Zizimin1
           functions in autoinhibition and membrane targeting.
           Zizimin2 is an immune-related and age-regulated guanine
           nucleotide exchange factor, which facilitates filopodial
           formation through activation of Cdc42, which results in
           activation of cell migration. No function has been
           determined for Zizimin3 to date. The N-terminal half of
           zizimin1 binds to the GEF domain through three distinct
           areas, including CZH1, to inhibit the interaction with
           Cdc42. In addition its PH domain binds phosphoinositides
           and mediates zizimin1 membrane targeting. DOCK is a
           family of proteins involved in intracellular signalling
           networks. They act as guanine nucleotide exchange
           factors for small G proteins of the Rho family, such as
           Rac and Cdc42. There are 4 subfamilies of DOCK family
           proteins based on their sequence homology: A-D. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 35.4 bits (82), Expect = 0.016
 Identities = 25/113 (22%), Positives = 45/113 (39%), Gaps = 38/113 (33%)

Query: 20  GWLFKWTNYL---------KGYQKRWFVLSNG-----LLSYYRNQAEMSHTCRGTISLRG 65
           G+L+K              K +++R+F L        +L +Y++  E S   +GTI L  
Sbjct: 10  GYLYK-GPENSSMFISLAMKSFKRRFFHLKQLVDGSYILEFYKD--EKSKEAKGTIYL-- 64

Query: 66  AIIQTEDSCTFIISN-------------GVQTFHIKASNEVERQRWVTALELA 105
                 DSCT ++ N               +++ + A +E E   W++ L   
Sbjct: 65  ------DSCTGVVQNSKRRKFCFELRMQDGKSYVLAAESESEMDDWISKLNKI 111


>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain.  ASAPs (ASAP1,
           ASAP2, and ASAP3) function as an Arf-specific GAPs,
           participates in rhodopsin trafficking, is associated
           with tumor cell metastasis, modulates phagocytosis,
           promotes cell proliferation, facilitates vesicle
           budding, Golgi exocytosis, and regulates vesicle coat
           assembly via a Bin/Amphiphysin/Rvs domain. ASAPs contain
           an NH2-terminal BAR domain, a tandem PH domain/GAP
           domain, three ankyrin repeats, two proline-rich regions,
           and a COOH-terminal Src homology 3 (SH3) domain. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 108

 Score = 34.6 bits (80), Expect = 0.024
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 17/111 (15%)

Query: 12  SHSDAEMKGWLFKWTNYL--KGYQKRWFVLSNGLLSYYRNQAEMSH------TCRGTISL 63
                E  G+L K +     K +QKR   + NG L+   +            TC+  +  
Sbjct: 6   KEHGTEKSGYLLKKSEGKLRKVWQKRRCSIRNGFLTISHSDENKPPVKLNLLTCQ--VKP 63

Query: 64  RGAIIQTEDSCTF-IISNGVQTFHIKASNEVERQRWVTALELAKSKARQHA 113
                  ED   F +IS+  +T+H +A +E E + W++ L+ +K +A   A
Sbjct: 64  NP-----EDKKCFDLISHN-RTYHFQAEDEQEAEAWISVLQNSKEEALNKA 108


>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins 5 and 6
           pleckstrin homology (PH) domain, C-terminus.  FGD5
           regulates promotes angiogenesis of vascular endothelial
           growth factor (VEGF) in vascular endothelial cells,
           including network formation, permeability, directional
           movement, and proliferation. The specific function of
           FGD6 is unknown. In general, FGDs have a RhoGEF (DH)
           domain, followed by a PH domain, a FYVE domain and a
           C-terminal PH domain. All FGDs are guanine nucleotide
           exchange factors that activate the Rho GTPase Cdc42, an
           important regulator of membrane trafficking. The RhoGEF
           domain is responsible for GEF catalytic activity, while
           the PH domain is involved in intracellular targeting of
           the DH domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 90

 Score = 33.5 bits (77), Expect = 0.046
 Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 10/92 (10%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFI 77
           M G+L++     K +++ WFVL + +L  Y+   ++      +I L G  +         
Sbjct: 1   MSGYLYRRKRKKKSWKRLWFVLKDKVLYTYKASEDVVAL--ESIPLLGYTVVPAKEGFEG 58

Query: 78  ISNGV-QTFH-------IKASNEVERQRWVTA 101
             + V Q  H        +A +    QRW+ A
Sbjct: 59  DESLVFQLLHKGQLPYIFRADDAETAQRWIEA 90


>gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing,
           family D (with coiled-coil domains) member 1 PH domain. 
           Human PLEKHD1 (also called UPF0639, pleckstrin homology
           domain containing, family D (with M protein repeats)
           member 1) is a single transcript and contains a single
           PH domain. PLEKHD1 is conserved in human, chimpanzee, ,
           dog, cow, mouse, chicken, zebrafish, and Caenorhabditis
           elegans. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 139

 Score = 34.3 bits (79), Expect = 0.053
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 22/108 (20%)

Query: 14  SDAEMKGWLFKWTN--YLKGYQKRWFVLSNGLLSYY---------RNQAEMSHTCRGTIS 62
           +  ++ G L+K         + KR+FVL    L YY         + +    H  +G I 
Sbjct: 10  TKVQLSGVLWKRPFGRQSAKWSKRFFVLKECFLLYYAESEKKDFEKTRRFNIHP-KGVIP 68

Query: 63  LRGAIIQ-TEDS---CTFIISNGVQTFH----IKASNEVERQRWVTAL 102
           L G  I+   D      F+IS+    F     + A +E E++ W+  L
Sbjct: 69  LGGCSIEAGRDPGRPYCFLISH--PDFKGSIILAADSEEEQESWLDML 114


>gnl|CDD|241521 cd13370, PH_GAP1m_mammal-like, GTPase activating protein 1 m
           pleckstrin homology (PH) domain.  GAP1(m) (also called
           RASA2/RAS p21 protein activator (GTPase activating
           protein) 2) is a member of the GAP1 family of
           GTPase-activating proteins, along with RASAL1,
           GAP1(IP4BP), and CAPRI. With the notable exception of
           GAP1(m), they all possess an arginine finger-dependent
           GAP activity on the Ras-related protein Rap1. GAP1(m)
           contains two C2 domains, a PH domain, a RasGAP domain,
           and a BTK domain. Its C2 domains, like those of
           GAP1IP4BP, do not contain the C2 motif that is known to
           be required for calcium-dependent phospholipid binding.
           GAP1(m) is regulated by the binding of its PH domains to
           phophoinositides, PIP3 (phosphatidylinositol
           3,4,5-trisphosphate). It suppresses RAS, enhancing the
           weak intrinsic GTPase activity of RAS proteins resulting
           in the inactive GDP-bound form of RAS, allowing control
           of cellular proliferation and differentiation. GAP1(m)
           binds inositol tetrakisphosphate (IP4). PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 133

 Score = 34.1 bits (78), Expect = 0.061
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 30  KGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAI-IQTEDSCTFIISNGVQTFH-- 86
           K ++KRWF L++  L+Y++ Q         TI ++  + ++  +   F   N  Q  H  
Sbjct: 35  KNFKKRWFCLTSRELTYHK-QKGKEAIF--TIPVKNILAVEKLEESAFNKKNMFQVIHSE 91

Query: 87  ----IKASNEVERQRWVTAL 102
               ++A+N VE   W+  L
Sbjct: 92  KPLYVQANNCVEANEWIEVL 111


>gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins 5 and 6
           Pleckstrin Homology (PH) domain.  FGD5 regulates
           promotes angiogenesis of vascular endothelial growth
           factor (VEGF) in vascular endothelial cells, including
           network formation, permeability, directional movement,
           and proliferation. The specific function of FGD6 is
           unknown. In general, FGDs have a RhoGEF (DH) domain,
           followed by a PH domain, a FYVE domain and a C-terminal
           PH domain. All FGDs are guanine nucleotide exchange
           factors that activate the Rho GTPase Cdc42, an important
           regulator of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the PH
           domain is involved in intracellular targeting of the DH
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 33.4 bits (77), Expect = 0.077
 Identities = 23/91 (25%), Positives = 34/91 (37%), Gaps = 8/91 (8%)

Query: 30  KGYQKRWFVLSNGLLSYYRNQAEMSHTCR--GTISLRG----AIIQTEDSCTFIISNGVQ 83
           K  Q R+  L N +L Y           +    + L G         E S  F I +  +
Sbjct: 26  KEMQPRYLFLFNDVLLYTTPVQSGVGKYKLKNELPLSGMKVSLPEDEEYSNEFQIESTKR 85

Query: 84  TFHIKASNEVERQRWVTALELAK--SKARQH 112
           +F + AS+  ER  WV AL  A      ++ 
Sbjct: 86  SFTLSASSAEERDEWVKALSRAIEDYTKKRR 116


>gnl|CDD|241440 cd13286, PH_OPR5_ORP8, Human Oxysterol binding protein related
           proteins 5 and 8 Pleckstrin homology (PH) domain.  Human
           ORP5 is proposed to function in efficient nonvesicular
           transfer of low-density lipoproteins-derived cholesterol
           (LDL-C) from late endosomes/lysosomes to the endoplasmic
           reticulum (ER). Human ORP8 is proposed to modulate lipid
           homeostasis and sterol regulatory element binding
           proteins (SREBP) activity. Both ORP5 and ORP8 contain a
           N-terminal PH domain, a C-terminal OSBP-related domain,
           followed by a transmembrane domain that localizes ORP5
           to the ER. Unlike all the other human OSBP/ORPs they
           lack a FFAT motif (two phenylalanines in an acidic
           tract). Oxysterol binding proteins are a multigene
           family that is conserved in yeast, flies, worms, mammals
           and plants. In general OSBPs and ORPs have been found to
           be involved in the transport and metabolism of
           cholesterol and related lipids in eukaryotes. They all
           contain a C-terminal oxysterol binding domain, and most
           contain an N-terminal PH domain. OSBP PH domains bind to
           membrane phosphoinositides and thus likely play an
           important role in intracellular targeting. They are
           members of the oxysterol binding protein (OSBP) family
           which includes OSBP, OSBP-related proteins (ORP),
           Goodpasture antigen binding protein (GPBP), and Four
           phosphate adaptor protein 1 (FAPP1). They have a wide
           range of purported functions including sterol transport,
           cell cycle control, pollen development and vessicle
           transport from Golgi recognize both PI lipids and ARF
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 130

 Score = 33.5 bits (77), Expect = 0.080
 Identities = 26/116 (22%), Positives = 45/116 (38%), Gaps = 31/116 (26%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGA-IIQ---TEDS 73
           +  WL K    LK + K W VL  G+L  Y++         GT+ L    +I+    +D 
Sbjct: 10  LSDWL-KIRGTLKSWTKLWCVLKPGVLLLYKSPKH--GQWVGTVLLNACEVIERPSKKDG 66

Query: 74  CTFIISNGV-QTFH-----------------------IKASNEVERQRWVTALELA 105
             F + + + Q+                          +A+ E + + W+ ALEL+
Sbjct: 67  FCFKLYHPLDQSIWATRGPKGESVGAITQPLPSSHLIFRAATESDGRCWMDALELS 122


>gnl|CDD|241410 cd13256, PH3_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and
          PH domain Pleckstrin homology (PH) domain, repeat 3.
          ARAP proteins (also called centaurin delta) are
          phosphatidylinositol 3,4,5-trisphosphate-dependent
          GTPase-activating proteins that modulate actin
          cytoskeleton remodeling by regulating ARF and RHO
          family members. They bind phosphatidylinositol
          3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
          phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
          binding. There are 3 mammalian ARAP proteins: ARAP1,
          ARAP2, and ARAP3. All ARAP proteins contain a
          N-terminal SAM (sterile alpha motif) domain, 5 PH
          domains, an ArfGAP domain, 2 ankyrin domain, A RhoGap
          domain, and a Ras-associating domain. This hierarchy
          contains the third PH domain in ARAP. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 110

 Score = 33.1 bits (76), Expect = 0.083
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 32 YQKRWFVLSNGLLSYYRNQAEMSHTCRGTI 61
          + +RW VL +G LSYY +  + S T  G I
Sbjct: 27 FSRRWCVLEDGFLSYYES--DKSTTPNGEI 54


>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin
           homology (PH) domain.  The kinesin-3 family motors KIFIA
           (Caenorhabditis elegans homolog unc-104) and KIFIB
           transport synaptic vesicle precursors that contain
           synaptic vesicle proteins, such as synaptophysin,
           synaptotagmin and the small GTPase RAB3A, but they do
           not transport organelles that contain plasma membrane
           proteins. They have a N-terminal motor domain, followed
           by a coiled-coil domain, and a C-terminal PH domain.
           KIF1A adopts a monomeric form in vitro, but acts as a
           processive dimer in vivo. KIF1B has alternatively
           spliced isoforms distinguished by the presence or
           absence of insertion sequences in the conserved
           amino-terminal region of the protein; this results in
           their different motor activities. KIF1A and KIF1B bind
           to RAB3 proteins through the adaptor protein
           mitogen-activated protein kinase (MAPK) -activating
           death domain (MADD; also calledDENN), which was first
           identified as a RAB3 guanine nucleotide exchange factor
           (GEF). PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 32.9 bits (76), Expect = 0.085
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 10/92 (10%)

Query: 19  KGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQ-TED----- 72
           KG+L    +   G+ +RW VL    L  Y ++ +     RG I+L  A ++ + D     
Sbjct: 17  KGYLLFLEDATDGWVRRWVVLRRPYLHIYSSEKDGDE--RGVINLSTARVEYSPDQEALL 74

Query: 73  --SCTFIISNGVQTFHIKASNEVERQRWVTAL 102
                F +     ++ ++A +E E   W+ A+
Sbjct: 75  GRPNVFAVYTPTNSYLLQARSEKEMHDWLYAI 106


>gnl|CDD|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating
           protein) family pleckstrin homology (PH) domain.
           RASAL1, GAP1(m), GAP1(IP4BP), and CAPRI are all members
           of the GAP1 family of GTPase-activating proteins. They
           contain N-terminal SH2-SH3-SH2 domains, followed by two
           C2 domains, a PH domain, a RasGAP domain, and a BTK
           domain. With the notable exception of GAP1(m), they all
           possess an arginine finger-dependent GAP activity on the
           Ras-related protein Rap1. They act as a suppressor of
           RAS enhancing the weak intrinsic GTPase activity of RAS
           proteins resulting in the inactive GDP-bound form of
           RAS, allowing control of cellular proliferation and
           differentiation. PH domains share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 107

 Score = 32.6 bits (75), Expect = 0.10
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 12/82 (14%)

Query: 29  LKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRG--AIIQTEDSCTFIISNGVQ--- 83
            K ++KR+F L+N  LSY +++         +I L+   A+ + ++   F + N  Q   
Sbjct: 18  RKNFKKRYFRLTNEALSYSKSKGSQP---LCSIPLQDILAVERVDEKS-FKMKNMFQVVQ 73

Query: 84  ---TFHIKASNEVERQRWVTAL 102
              T +++A N VE   W++AL
Sbjct: 74  PDRTLYLQAKNVVELNEWLSAL 95


>gnl|CDD|197394 cd10159, CsoR-like_DUF156_2, Uncharacterized family 2; belongs to a
           superfamily containing transcriptional regulators CsoR
           (copper-sensitive operon repressor), RcnR, and FrmR, and
           related domains; this family was previously known as
           part of DUF156.  Uncharacterized family 2, belonging to
           a larger superfamily that contains various
           transcriptional regulators that respond to different
           stressors such as Cu(I), Ni(I), sulfite, and
           formaldehyde, and includes CsoRs (copper-sensitive
           operon repressors). CsoRs form homotetramers (dimer of
           dimers). In Mycobacterium tuberculosis CsoR, within each
           dimer, two Cys residues on opposite subunits, along with
           a His residue, bind the Cu(I) ion (forming a triagonal
           S2N coordination complex, C-H-C). These residues are
           conserved in the majority of members of this
           superfamily, including this family, and a conserved Tyr
           and a Glu residue that facilitate allosteric regulation
           of DNA binding for CsoRs are also conserved.
          Length = 82

 Score = 31.4 bits (72), Expect = 0.19
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 451 KSTNKQDLKTIRGDQITWI-----DGRETYCSNIGRLISEVDAIIMRANRMVNNGRM 502
           K    + LKT RG QI  I     + R  YC +I   I    A++ +AN+ + +  M
Sbjct: 2   KKKALRLLKTARG-QIDGIIKMIEEDR--YCIDISNQILATQALLKKANKEILSAHM 55


>gnl|CDD|241522 cd13371, PH_GAP1_mammal-like, GAP1(IP4BP) pleckstrin homology (PH)
           domain.  GAP1 (also called IP4BP, RASA3/Ras
           GTPase-activating protein 3, and RAS p21 protein
           activator (GTPase activating protein)
           3/GAPIII/MGC46517/MGC47588)) is a member of the GAP1
           family of GTPase-activating proteins, along with RASAL1,
           GAP1(m), and CAPRI. With the notable exception of
           GAP1(m), they all possess an arginine finger-dependent
           GAP activity on the Ras-related protein Rap1.
           GAP1(IP4BP) contains two C2 domains, a PH domain, a
           RasGAP domain, and a BTK domain. Its C2 domains, like
           those of GAP1M, do not contain the C2 motif that is
           known to be required for calcium-dependent phospholipid
           binding. GAP1(IP4BP) is regulated by the binding of its
           PH domains to phophoinositides, PIP3
           (phosphatidylinositol 3,4,5-trisphosphate) and PIP2
           (phosphatidylinositol 4,5-bisphosphate). It suppresses
           RAS, enhancing the weak intrinsic GTPase activity of RAS
           proteins resulting in the inactive GDP-bound form of
           RAS, allowing control of cellular proliferation and
           differentiation. GAP1(IP4BP) binds tyrosine-protein
           kinase, HCK. Members here include humans, chickens,
           frogs, and fish. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 32.3 bits (73), Expect = 0.19
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 29  LKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQ----- 83
           +K ++KRWF L+N   +Y++++ +    C   I    A+ + E+  +F + N  Q     
Sbjct: 34  MKNFKKRWFRLTNHEFTYHKSKGDHP-LCSIPIENILAVERLEEE-SFKMKNMFQVIQPE 91

Query: 84  -TFHIKASNEVERQRWVTAL 102
              +I+A+N VE + W+  L
Sbjct: 92  RALYIQANNCVEAKDWIDIL 111


>gnl|CDD|241285 cd01254, PH_PLD, Phospholipase D pleckstrin homology (PH) domain.
           PLD hydrolyzes phosphatidylcholine to phosphatidic acid
           (PtdOH), which can bind target proteins. PLD contains a
           PH domain, a PX domain and four conserved PLD signature
           domains. The PLD PH domain is specific for
           bisphosphorylated inositides. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 134

 Score = 32.2 bits (74), Expect = 0.27
 Identities = 17/80 (21%), Positives = 32/80 (40%), Gaps = 8/80 (10%)

Query: 32  YQKRWFVLSNGLLSYYRNQAEMSHTC------RGTISLRGAIIQTEDSCTFIISNGVQTF 85
           + KRWF++ +  L+Y  +                 +S      +T       I+N  +T 
Sbjct: 57  WSKRWFIVKDSFLAYVDDPDSGKILDVFLFDKEFKVSRGK--KETGSRHGLKITNLSRTL 114

Query: 86  HIKASNEVERQRWVTALELA 105
            IK  +  + + WV ++E A
Sbjct: 115 KIKCKSYRKAKEWVESIEEA 134


>gnl|CDD|241532 cd13381, PH_Skap-hom_Skap2, Src kinase-associated phosphoprotein
           homolog and Skap 2 Pleckstrin homology (PH) domain.
           Adaptor protein Skap-hom, a homolog of Skap55, which
           interacts with actin and with ADAP (adhesion and
           degranulation promoting adapter protein) undergoes
           tyrosine phosphorylation in response to plating of bone
           marrow-derived macrophages on fibronectin. Skap-hom has
           an N-terminal coiled-coil conformation that is involved
           in homodimer formation, a central PH domain and a
           C-terminal SH3 domain that associates with ADAP. The
           Skap-hom PH domain regulates intracellular targeting;
           its interaction with the DM domain inhibits Skap-hom
           actin-based ruffles in macrophages and its binding to
           3'-phosphoinositides reverses this autoinhibition. The
           Skap-hom PH domain binds PI[3,4]P2 and PI[3,4,5]P3, but
           not to PI[3]P, PI[5]P, or PI[4,5]P2. Skap2 is a
           downstream target of Heat shock transcription factor 4
           (HSF4) and functions in the regulation of actin
           reorganization during lens differentiation. It is
           thought that SKAP2 anchors the complex of tyrosine
           kinase adaptor protein 2 (NCK20/focal adhesion to
           fibroblast growth factor receptors at the lamellipodium
           in lens epithelial cells. Skap2 has an N-terminal
           coiled-coil conformation which interacts with the SH2
           domain of NCK2, a central PH domain and a C-terminal SH3
           domain that associates with ADAP (adhesion and
           degranulation promoting adapter protein)/FYB (the Fyn
           binding protein). Skap2 PH domain binds to membrane
           lipids. Skap adaptor proteins couple receptors to
           cytoskeletal rearrangements. Src kinase-associated
           phosphoprotein of 55 kDa (Skap55)/Src kinase-associated
           phosphoprotein 1 (Skap1), Skap2, and Skap-hom have an
           N-terminal coiled-coil conformation, a central PH domain
           and a C-terminal SH3 domain. Their PH domains bind
           3'-phosphoinositides as well as directly affecting
           targets such as in Skap55 where it directly affecting
           integrin regulation by ADAP and NF-kappaB activation or
           in Skap-hom where the dimerization and PH domains
           comprise a 3'-phosphoinositide-gated molecular switch
           that controls ruffle formation. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 106

 Score = 31.4 bits (71), Expect = 0.32
 Identities = 17/83 (20%), Positives = 36/83 (43%), Gaps = 11/83 (13%)

Query: 32  YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDS--------CTF-IISNGV 82
           +QKRW  LS  +  YY +  +     +G  ++ G  ++  ++        C F I +   
Sbjct: 21  WQKRWCALSKTVFYYYGSDKDKQQ--KGEFAIDGYTVRMNNTLRKDAKKDCCFEISAPDK 78

Query: 83  QTFHIKASNEVERQRWVTALELA 105
           + +   A++  E + WV  ++  
Sbjct: 79  RIYQFTAASPKEAEEWVQQIKFI 101


>gnl|CDD|241461 cd13307, PH2_AFAP, Actin filament associated protein family
           Pleckstrin homology (PH) domain, repeat 2.  There are 3
           members of the AFAP family of adaptor proteins: AFAP1,
           AFAP1L1, and AFAP1L2/XB130. AFAP1 is a cSrc binding
           partner and actin cross-linking protein. AFAP1L1 is
           thought to play a similar role to AFAP1 in terms of
           being an actin cross-linking protein, but it
           preferentially binds to cortactin and not cSrc, thereby
           playing a role in invadosome formation. AFAP1L2 is a
           cSrc binding protein, but does not bind to actin
           filaments. AFAP1L2 acts as an intermediary between the
           RET/PTC kinase and PI-3kinase pathway in the thyroid.
           The AFAPs share a similar structure of a SH3 binding
           motif, 3 SH2 binding motifs, 2 PH domains, a coiled-coil
           region corresponding to the AFAP1 leucine zipper, and an
           actin binding domain. This cd is the second PH domain of
           AFAP. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 101

 Score = 31.2 bits (71), Expect = 0.37
 Identities = 17/76 (22%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 32  YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSC----TF-IISNGVQTFH 86
           ++ RW  + +G L +Y+++ +   + +  + LRG  +          +F I+ NG +   
Sbjct: 16  WRSRWCCVKDGQLHFYQDRNK-LKSPQQPLPLRGCEVIPGPDPKHPYSFRILRNGEEVAV 74

Query: 87  IKASNEVERQRWVTAL 102
           ++AS+  +  RW+  L
Sbjct: 75  LEASSSEDMGRWLGLL 90


>gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin
           homology (PH) domain.  Bud emergence in Saccharomyces
           cerevisiae involves cell cycle-regulated reorganizations
           of cortical cytoskeletal elements and requires the
           action of the Rho-type GTPase Cdc42. Bem3 contains a
           RhoGAP domain and a PH domain. Though Bem3 and Bem2 both
           contain a RhoGAP, but only Bem3 is able to stimulate the
           hydrolysis of GTP on Cdc42. Bem3 is thought to be the
           GAP for Cdc42. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 30.7 bits (70), Expect = 0.53
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 21/89 (23%)

Query: 31  GYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAII--QT---EDSC----TFII--- 78
           G++ R+ VL   +L  Y            +I LR A I  Q    +D       F+I   
Sbjct: 22  GWKLRYGVLDGNILELY-ESRGGQLL--ESIKLRNAQIERQPNLPDDKYGTRHGFLINEH 78

Query: 79  -----SNGVQTFHIKASNEVERQRWVTAL 102
                S+  + + + A  + ER  WV+AL
Sbjct: 79  KKSGLSSTTKYY-LCAETDKERDEWVSAL 106


>gnl|CDD|241415 cd13261, PH_RasGRF1_2, Ras-specific guanine nucleotide-releasing
           factors 1 and 2 Pleckstrin homology (PH) domain.
           RasGRF1 (also called GRF1; CDC25Mm/Ras-specific
           nucleotide exchange factor CDC25; GNRP/Guanine
           nucleotide-releasing protein) and RasGRF2 (also called
           GRF2; Ras guanine nucleotide exchange factor 2) are a
           family of guanine nucleotide exchange factors (GEFs).
           They both promote the exchange of Ras-bound GDP by GTP,
           thereby regulating the RAS signaling pathway. RasGRF1
           and RasGRF2 form homooligomers and heterooligomers. GRF1
           has 3 isoforms and GRF2 has 2 isoforms. The longest
           isoforms of RasGRF1 and RasGRF2 contain the following
           domains: a Rho-GEF domain sandwiched between 2 PH
           domains, IQ domains, a REM (Ras exchanger motif) domain,
           and a Ras-GEF domainwhich gives them the capacity to
           activate both Ras and Rac GTPases in response to signals
           from a variety of neurotransmitter receptors. Their IQ
           domains allow them to act as calcium sensors to mediate
           the actions of NMDA-type and calcium-permeable AMPA-type
           glutamate receptors. GRF1 also mediates the action of
           dopamine receptors that signal through cAMP. GRF1 and
           GRF2 play strikingly different roles in regulating MAP
           kinase family members, neuronal synaptic plasticity,
           specific forms of learning and memory, and behavioral
           responses to psychoactive drugs. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 136

 Score = 31.2 bits (71), Expect = 0.56
 Identities = 24/112 (21%), Positives = 41/112 (36%), Gaps = 23/112 (20%)

Query: 13  HSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCR--GTISLRGAI--- 67
             D   +G+L K ++    +  +WF L   LL Y+ N++    + R  G   L G     
Sbjct: 2   RKDGTRRGYLSKKSSDNSKWHTKWFALYQNLLFYFENES----SSRPSGLYLLEGCYCER 57

Query: 68  -----------IQTEDSCTFIIS---NGVQTFHIKASNEVERQRWVTALELA 105
                         E    F IS      + + ++   E +   WV A++ A
Sbjct: 58  APSPKRAGKGKDHLEKQHYFTISFRHENQRQYELRTETETDCDTWVEAIKQA 109


>gnl|CDD|241288 cd01257, PH_IRS, Insulin receptor substrate (IRS) pleckstrin
           homology (PH) domain.  Insulin receptor substrate (IRS)
           molecules are mediators in insulin signaling and play a
           role in maintaining basic cellular functions such as
           growth and metabolism. They act as docking proteins
           between the insulin receptor and a complex network of
           intracellular signaling molecules containing Src
           homology 2 (SH2) domains. Four members (IRS-1, IRS-2,
           IRS-3, IRS-4) of this family have been identified that
           differ as to tissue distribution, subcellular
           localization, developmental expression, binding to the
           insulin receptor, and interaction with SH2
           domain-containing proteins. IRS molecules have an
           N-terminal PH domain, followed by an IRS-like PTB domain
           which has a PH-like fold. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.cytoskeletal
           associated molecules, and in lipid associated enzymes.
          Length = 106

 Score = 30.3 bits (69), Expect = 0.65
 Identities = 31/120 (25%), Positives = 45/120 (37%), Gaps = 37/120 (30%)

Query: 14  SDAEMKGWLFKWTNYLKGYQKRWFVL---SNGL---LSYYRNQAEMSHTC--RGTISLRG 65
           +D    G+L K    LK  +KR+FVL   S+G    L YY N+ +       +  I L  
Sbjct: 1   TDVRKSGYLKK----LKTMRKRYFVLRAESHGGPARLEYYENEKKFRRNAEPKRVIPLSS 56

Query: 66  A---------------IIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKAR 110
                            + T+D C          F + A +E E+  W  AL   +  AR
Sbjct: 57  CFNINKRADAKHKHLIALYTKDEC----------FGLVAESEEEQDEWYQALLELQRPAR 106


>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain.  Yeast Boi
           proteins Boi1 and Boi2 are functionally redundant and
           important for cell growth with Boi mutants displaying
           defects in bud formation and in the maintenance of cell
           polarity.They appear to be linked to Rho-type GTPase,
           Cdc42 and Rho3. Boi1 and Boi2 display two-hybrid
           interactions with the GTP-bound ("active") form of
           Cdc42, while Rho3 can suppress of the lethality caused
           by deletion of Boi1 and Boi2. These findings suggest
           that Boi1 and Boi2 are targets of Cdc42 that promote
           cell growth in a manner that is regulated by Rho3. Boi
           proteins contain a N-terminal SH3 domain, followed by a
           SAM (sterile alpha motif) domain, a proline-rich region,
           which mediates binding to the second SH3 domain of Bem1,
           and C-terminal PH domain. The PH domain is essential for
           its function in cell growth and is important for
           localization to the bud, while the SH3 domain is needed
           for localization to the neck. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 95

 Score = 30.0 bits (68), Expect = 0.86
 Identities = 22/96 (22%), Positives = 39/96 (40%), Gaps = 10/96 (10%)

Query: 19  KGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDS----- 73
            GW+ K       ++ R+FVL    L Y +++ +     +G I L G  +  +DS     
Sbjct: 2   SGWMKKRGERYGTWKTRYFVLKGTRLYYLKSENDSKE--KGLIDLTGHRVTVDDSNSKPG 59

Query: 74  --CTFIISNGVQTFHIKAS-NEVERQRWVTALELAK 106
                ++   V+  H  A   +   + W+ AL  A 
Sbjct: 60  RYGFKLVPPAVEKVHYFAVDEKEVLREWMKALMKAT 95


>gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain.  Budding
          yeast contain two main p21-activated kinases (PAKs),
          Cla4 and Ste20. The yeast Ste20 protein kinase is
          involved in pheromone response, though the function of
          Ste20 mammalian homologs is unknown. Cla4 is involved
          in budding and cytokinesis and interacts with Cdc42, a
          GTPase required for polarized cell growth as is Pak.
          Cla4 and Ste20 kinases share a function in localizing
          cell growth with respect to the septin ring. They both
          contain a PH domain, a Cdc42/Rac interactive binding
          (CRIB) domain, and a C-terminal Protein Kinase
          catalytic (PKc) domain. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 91

 Score = 29.5 bits (67), Expect = 1.0
 Identities = 15/73 (20%), Positives = 31/73 (42%), Gaps = 7/73 (9%)

Query: 32 YQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAI-IQTEDSCTFII----SNGVQTFH 86
          + KR+ VL    L +Y+N  E S +   +I L+    +   D   +       +  ++ +
Sbjct: 19 WSKRYLVLREQSLDFYKN--ESSSSASLSIPLKDISNVSRTDLKPYCFEIVRKSSTKSIY 76

Query: 87 IKASNEVERQRWV 99
          I   ++ E   W+
Sbjct: 77 ISVKSDDELYDWM 89


>gnl|CDD|241453 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin homology (PH)
           domain, repeat 2.  The functions of these fungal
           proteins are unknown, but they all contain 2 PH domains.
           This cd represents the second PH repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 102

 Score = 29.9 bits (68), Expect = 1.1
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 12/94 (12%)

Query: 18  MKGWLFKW-TNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTE----- 71
            +G+L       +  ++K W VL N  LS+Y++Q+E  ++    I +   I   E     
Sbjct: 8   EQGYLQVLKKKGVNQWKKYWLVLRNRSLSFYKDQSE--YSPVKIIPIDDIIDVVELDPLS 65

Query: 72  ---DSCTFIISNGVQTFHIKASNEVERQRWVTAL 102
                C  II+   +     A +E    +W+ AL
Sbjct: 66  KSKKWCLQIITPE-KRIRFCADDEESLIKWLGAL 98


>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187,
           ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain.
           Phafin2 is differentially expressed in the liver cancer
           cell and regulates the structure and function of the
           endosomes through Rab5-dependent processes. Phafin2
           modulates the cell's response to extracellular
           stimulation by modulating the receptor density on the
           cell surface. Phafin2 contains a PH domain and a FYVE
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 123

 Score = 30.3 bits (69), Expect = 1.1
 Identities = 19/90 (21%), Positives = 32/90 (35%), Gaps = 22/90 (24%)

Query: 30  KGYQKRWFVLSNGLLSY---------YRNQAEMSHTCRGTISLRGAIIQT-EDSCT---- 75
           K  + R F L N +L Y         Y  Q          I L    I+  ED+      
Sbjct: 42  KKPKPRQFFLFNDILVYGSIVINKKKYNKQR--------IIPLEDVKIEDLEDTGELKNG 93

Query: 76  FIISNGVQTFHIKASNEVERQRWVTALELA 105
           + I +  ++F + A+   E+  W+  +   
Sbjct: 94  WQIISPKKSFVVYAATATEKSEWMDHINKC 123


>gnl|CDD|241276 cd01243, PH_MRCK, MRCK (myotonic dystrophy-related Cdc42-binding
           kinase) pleckstrin homology (PH) domain.  MRCK is
           thought to be coincidence detector of signaling by Cdc42
           and phosphoinositides. It has been shown to promote
           cytoskeletal reorganization, which affects many
           biological processes. There are 2 members of this
           family: MRCKalpha and MRCKbeta. MRCK consists of a
           serine/threonine kinase domain, a cysteine rich (C1)
           region, a PH domain and a p21 binding motif. The MRCK PH
           domain is responsible for its targeting to cell to cell
           junctions. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 136

 Score = 30.0 bits (68), Expect = 1.4
 Identities = 10/37 (27%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 73  SCTFIISNGVQTFH--IKASNEVERQRWVTAL-ELAK 106
           + + + +  +      + A +E E+Q+WV AL EL +
Sbjct: 95  TASQLHAPLLLKSSQLLLADSEAEKQKWVGALKELHR 131


>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain.
           Anillin (Rhotekin/RTKN; also called PLEKHK/Pleckstrin
           homology domain-containing family K) is an actin binding
           protein involved in cytokinesis. It interacts with
           GTP-bound Rho proteins and results in the inhibition of
           their GTPase activity. Dysregulation of the Rho signal
           transduction pathway has been implicated in many forms
           of cancer. Anillin proteins have a N-terminal HRI
           domain/ACC (anti-parallel coiled-coil) finger domain or
           Rho-binding domain binds small GTPases from the Rho
           family. The C-terminal PH domain helps target anillin to
           ectopic septin containing foci. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 119

 Score = 29.2 bits (66), Expect = 2.0
 Identities = 22/94 (23%), Positives = 34/94 (36%), Gaps = 21/94 (22%)

Query: 33  QKRWFVLSNGLLSYYRNQAEMSHTC-RGTISLRGAI---IQT--EDSC----TFIISNGV 82
            +RW VL  G LS+++   +       G+I LR  I   ++    + C    TF +    
Sbjct: 21  HRRWCVLRGGYLSFWKYPEDEEKKKPIGSIDLRKCINEKVEPASRELCARPNTFELETLR 80

Query: 83  QTFHIKASNEV-----------ERQRWVTALELA 105
                  +NE            ER  W+ AL   
Sbjct: 81  PAEDSDGTNEKKRVLLSADTKEERIEWLDALNQT 114


>gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
           Pleckstrin homology (PH) domain, N-terminal repeat.  The
           binding of TAPP1 (also called PLEKHA1/pleckstrin
           homology domain containing, family A (phosphoinositide
           binding specific) member 1) and TAPP2 (also called
           PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
           5)P3, function as negative regulators of insulin and
           PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
           complex). TAPP1 and TAPP2 contain two sequential PH
           domains in which the C-terminal PH domain binds
           PtdIns(3,4)P2. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 118

 Score = 29.0 bits (65), Expect = 2.4
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 32  YQKRWFVL--SNGLLSYYRNQ---AEMSHTCRGTISLRGAIIQTEDS---------CTFI 77
           + +R+F+L  + GLL +Y +            G+++L   I +  D+         C F+
Sbjct: 25  FLRRYFILDTAAGLLLWYMDNPQNLPDGAAPVGSLNL-TYISKVSDAPKQKPKAEFC-FV 82

Query: 78  ISNGVQTFHIKASNEVERQRWVTALELA 105
           I+   + + ++A+++ + + WV AL  A
Sbjct: 83  INALSRRYFLQANDQQDLEEWVEALNDA 110


>gnl|CDD|241264 cd01230, PH1_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2
           Pleckstrin Homology (PH) domain, N-terminal domain.
           Tiam1 activates Rac GTPases to induce membrane ruffling
           and cell motility while Tiam2 (also called STEF (SIF
           (still life) and Tiam1 like-exchange factor) contributes
           to neurite growth. Tiam1/2 are Dbl-family of GEFs that
           possess a Dbl(DH) domain with a PH domain in tandem.
           DH-PH domain catalyzes the GDP/GTP exchange reaction in
           the GTPase cycle and facillitating the switch between
           inactive GDP-bound and active GTP-bound states. Tiam1/2
           possess two PH domains, which are often referred to as
           PHn and PHc domains. The DH-PH tandem domain is made up
           of the PHc domain while the PHn is part of a novel
           N-terminal PHCCEx domain which is made up of the PHn
           domain, a coiled coil region(CC), and an extra region
           (Ex). PHCCEx mediates binding to plasma membranes and
           signalling proteins in the activation of Rac GTPases.
           The PH domain resembles the beta-spectrin PH domain,
           suggesting non-canonical phosphatidylinositol binding.
           CC and Ex form a positively charged surface for protein
           binding. There are 2 motifs in Tiam1/2-interacting
           proteins that bind to the PHCCEx domain: Motif-I in
           CD44, ephrinBs, and the NMDA receptor and Motif-II in
           Par3 and JIP2.Neither of these fall in the PHn domain.
           PH domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 127

 Score = 28.5 bits (64), Expect = 3.7
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 30  KGYQKRWFVLSNGLLSYY----RNQAEMSHTCRGTISLRGAIIQT-----EDSCTFIISN 80
           + ++K W  L    L +Y    R   + + T +  + + G+I Q      +    F +SN
Sbjct: 29  RKWKKYWVTLKGCTLLFYECDERTGIDDNSTPKHALFVEGSIAQAVPEHPKKDNVFCLSN 88

Query: 81  GV-QTFHIKASNEVERQRWVTALELAKSK--ARQH 112
                +  +A+++ E + W+TA+  A +   ARQH
Sbjct: 89  SFGDAYLFQATSQTELENWITAIHSACASAFARQH 123


>gnl|CDD|205278 pfam13097, CENP-U, CENP-A nucleosome associated complex (NAC)
           subunit.  CENP-U is one of the components that assembles
           onto the CENP-A-nucleosome associated complex (NAC). The
           centromere, which is the basic element of chromosome
           inheritance, is epigenetically determined in mammals.
           CENP-A, the centromere-specific histone H3 variant,
           assembles an array of nucleosomes and it is this that
           seems to be the prime candidate for specifying
           centromere identity. CENP-A nucleosomes directly recruit
           a proximal CENP-A nucleosome associated complex (NAC)
           comprised of CENP-M, CENP-N and CENP-T, CENP-U(50),
           CENP-C and CENP-H. Assembly of the CENP-A NAC at
           centromeres is dependent on CENP-M, CENP-N and CENP-T.
           Additionally, there are seven other subunits which make
           up the CENP-A-nucleosome distal (CAD) centromere,
           CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and
           CENP-S, also assembling on the CENP-A NAC. FTA4 is the
           equivalent component of the fission yeast Sim4 complex.
          Length = 174

 Score = 29.1 bits (65), Expect = 3.8
 Identities = 8/31 (25%), Positives = 15/31 (48%)

Query: 259 RQTQRRVLPWKPNTPRRSIIPEKPPGSMQIW 289
            +TQ+++ P +   PR S        S+ +W
Sbjct: 62  SETQKKLSPGRRKKPRSSHSGSDSSDSVHVW 92


>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating
           protein) 1 Pleckstrin homology (PH) domain.  RASA1 (also
           called RasGap1 or p120) is a member of the RasGAP family
           of GTPase-activating proteins. RASA1 contains N-terminal
           SH2-SH3-SH2 domains, followed by two C2 domains, a PH
           domain, a RasGAP domain, and a BTK domain. Splice
           variants lack the N-terminal domains. It is a cytosolic
           vertebrate protein that acts as a suppressor of RAS via
           its C-terminal GAP domain function, enhancing the weak
           intrinsic GTPase activity of RAS proteins resulting in
           the inactive GDP-bound form of RAS, allowing control of
           cellular proliferation and differentiation.
           Additionally, it is involved in mitogenic signal
           transmission towards downstream interacting partners
           through its N-terminal SH2-SH3-SH2 domains. RASA1
           interacts with a number of proteins including: G3BP1,
           SOCS3, ANXA6, Huntingtin, KHDRBS1, Src, EPHB3, EPH
           receptor B2, Insulin-like growth factor 1 receptor,
           PTK2B, DOK1, PDGFRB, HCK, Caveolin 2, DNAJA3, HRAS,
           GNB2L1 and NCK1. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 28.1 bits (63), Expect = 4.0
 Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 14/97 (14%)

Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNG--LLSYYRNQAEMSHTCRGTISLR-GAIIQTEDS- 73
            KG+L K +   K ++  +FVL      L ++ N  E     +G I L   ++    DS 
Sbjct: 5   KKGYLLKKSGKNKKWKNLYFVLEGAEQHLYFFEN--EKRTKPKGLIDLSYSSVYPVHDSL 62

Query: 74  -----CTFIIS---NGVQTFHIKASNEVERQRWVTAL 102
                C  I+    N    +++ A      Q W+ AL
Sbjct: 63  FGRPNCFQIVVRALNESTIYYLCADTAELAQDWMKAL 99


>gnl|CDD|219267 pfam07007, DUF1311, Protein of unknown function (DUF1311).  This
           family consists of several bacterial proteins of around
           120 residues in length. Members of this family contain
           four highly conserved cysteine residues. The function of
           this family is unknown.
          Length = 84

 Score = 27.4 bits (61), Expect = 4.6
 Identities = 9/41 (21%), Positives = 14/41 (34%)

Query: 455 KQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANR 495
                 +R  Q  W+  R+  C+    L     A + R  R
Sbjct: 38  PDAKAALRKAQRAWLKYRDAECAFEASLYEGYAACLARLTR 78


>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
           domain, repeat 2.  Pleckstrin is a protein found in
           platelets. This name is derived from platelet and
           leukocyte C kinase substrate and the KSTR string of
           amino acids. Pleckstrin 2 contains two PH domains and a
           DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
           pleckstrin 1, pleckstrin 2 does not contain obvious
           sites of PKC phosphorylation. Pleckstrin 2 plays a role
           in actin rearrangement, large lamellipodia and
           peripheral ruffle formation, and may help orchestrate
           cytoskeletal arrangement. The PH domains of pleckstrin 2
           are thought to contribute to lamellipodia formation.
           This cd contains the second PH domain repeat. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 109

 Score = 27.9 bits (62), Expect = 4.7
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 16/101 (15%)

Query: 19  KGWLFKWTNYLKGYQKRWFVLSN--GLLSYYRNQAEMSHTCRGTISLRGAII-------- 68
           +G L K  +  K ++ R FVL +    L YY           G I LRG ++        
Sbjct: 10  QGCLLKQGHRRKNWKVRKFVLRDDPAYLHYYDPAKG--EDPLGAIHLRGCVVTAVEDNSN 67

Query: 69  ---QTEDSCTF-IISNGVQTFHIKASNEVERQRWVTALELA 105
               + +   F II+     ++++A+   ER  W+ A+++A
Sbjct: 68  PAKGSVEGNLFEIITADEVHYYLQAATPAERTEWIKAIQMA 108


>gnl|CDD|241254 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 1 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Mutations in the FGD1 gene
           are responsible for the X-linked disorder known as
           faciogenital dysplasia (FGDY). Both FGD1 and FGD3 are
           targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
           upon phosphorylation of two serine residues in its
           DSGIDS motif and subsequently degraded by the
           proteasome. However, FGD1 and FGD3 induced significantly
           different morphological changes in HeLa Tet-Off cells
           and while FGD1 induced long finger-like protrusions,
           FGD3 induced broad sheet-like protrusions when the level
           of GTP-bound Cdc42 was significantly increased by the
           inducible expression of FGD3. They also reciprocally
           regulated cell motility in inducibly expressed in HeLa
           Tet-Off cells, FGD1 stimulated cell migration while FGD3
           inhibited it. FGD1 and FGD3 therefore play different
           roles to regulate cellular functions, even though their
           intracellular levels are tightly controlled by the same
           destruction pathway through SCF(FWD1/beta-TrCP).  PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 28.1 bits (62), Expect = 5.3
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 33  QKRWFVLSNGLLSYYRNQAEM---SHTCRGTISLRGAIIQTEDSC----TFIISNGVQTF 85
           Q R+ +L N  L Y   +  +     + R  I + G  ++   S     TF++S   ++ 
Sbjct: 17  QDRYLILFNDRLLYCVPKLRLIGQKFSVRARIDVDGMELKESSSPNLPRTFLVSGKQRSL 76

Query: 86  HIKASNEVERQRWVTALELAKSKARQ 111
            ++A  E E++ W+ A+E   ++  Q
Sbjct: 77  ELQARTEEEKKDWIQAIEATINRHEQ 102


>gnl|CDD|241408 cd13254, PH2_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain, repeat 2.  ARAP
           proteins (also called centaurin delta) are
           phosphatidylinositol 3,4,5-trisphosphate-dependent
           GTPase-activating proteins that modulate actin
           cytoskeleton remodeling by regulating ARF and RHO family
           members. They bind phosphatidylinositol
           3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
           phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
           binding. There are 3 mammalian ARAP proteins: ARAP1,
           ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
           SAM (sterile alpha motif) domain, 5 PH domains, an
           ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
           Ras-associating domain. This hierarchy contains the
           second PH domain in ARAP. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 90

 Score = 27.3 bits (61), Expect = 5.5
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 29  LKGYQKRWFVLSNGLLSY-YRNQAEMSHTCRGT-ISLRGAIIQTEDSCTFIISNGVQTFH 86
           L+G++ + +   +G   + Y+N+ E       T I +  A ++  D  +F ++   + F 
Sbjct: 14  LRGHKSKVYTALSGDKVWLYKNEQEFRLGIGITVIDMNVANVKDVDKRSFDLTTPYRIFS 73

Query: 87  IKASNEVERQRWVTAL 102
             A +E E+Q WV AL
Sbjct: 74  FTAESEREKQEWVEAL 89


>gnl|CDD|237272 PRK13017, PRK13017, dihydroxy-acid dehydratase; Provisional.
          Length = 596

 Score = 29.5 bits (67), Expect = 5.5
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 393 WKAWQDLAVHSKFRGKYIQVTPA-----GRFNLVFTKSSMAVLHEVLGM 436
           WKA + LA       +++++  +     G  N + T S+M  L E LGM
Sbjct: 173 WKARELLAAGEIDYEEFMELVASSAPSVGHCNTMGTASTMNALAEALGM 221


>gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH)
          domain.  PKB (also called Akt), a member of the AGC
          kinase family, is a phosphatidylinositol 3'-kinase
          (PI3K)-dependent Ser/Thr kinase which alters the
          activity of the targeted protein. The name AGC is based
          on the three proteins that it is most similar to
          cAMP-dependent protein kinase 1 (PKA; also known as
          PKAC), cGMP-dependent protein kinase (PKG; also known
          as CGK1) and protein kinase C (PKC). Human Akt has
          three isoforms derived for distinct genes:
          Akt1/PKBalpha, Akt2/PKBbeta, and Akt3/PKBgamma. All
          Akts have an N-terminal PH domain with an activating
          Thr phosphorylation site, a kinase domain, and a short
          C-terminal regulatory tail with an activating Ser
          phosphorylation site. The PH domain recruits Akt to the
          plasma membrane by binding to phosphoinositides
          (PtdIns-3,4-P2) and is required for activation. The
          phosphorylation of Akt at its Thr and Ser
          phosphorylation sites leads to increased Akt activity
          toward forkhead transcription factors, the mammalian
          target of rapamycin (mTOR), and the
          Bcl-xL/Bcl-2-associated death promoter (BAD), all of
          which possess a consensus motif R-X-R-XX-ST-B (X =
          amino acid, B = bulky hydrophobic residue) for Akt
          phosphorylation. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 121

 Score = 27.7 bits (62), Expect = 6.2
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 20 GWLFKWTNYLKGYQKRWFVL 39
          GWL K   Y+K ++ RWFVL
Sbjct: 7  GWLTKRGEYIKTWRPRWFVL 26


>gnl|CDD|234522 TIGR04249, SCM_chp_ScmC, SynChlorMet cassette protein ScmC.  A
           biosynthesis cassette found in Syntrophobacter
           fumaroxidans MPOB, Chlorobium limicola DSM 245,
           Methanocella paludicola SANAE, and delta proteobacterium
           NaphS2 contains two PqqE-like radical SAM/SPASM domain
           proteins, a PqqD homolog, and a conserved hypothetical
           protein. These components suggest modification of a
           ribosomally produced peptide precursor, but the
           precursor has not been identified. Members of this
           family are designated ScmC.
          Length = 292

 Score = 28.3 bits (63), Expect = 9.0
 Identities = 18/67 (26%), Positives = 27/67 (40%), Gaps = 8/67 (11%)

Query: 114 LVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHP-PIAAQYVEG 172
           L+AA   +  ST   R G P+     +        D G++A       HP P  + ++ G
Sbjct: 141 LLAASGGTGKSTCCRRIGDPWRCHCDDESLVVPDTDKGYRA-------HPFPTWSNFLFG 193

Query: 173 KAWKAWQ 179
              K WQ
Sbjct: 194 SEEKTWQ 200


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.319    0.132    0.408 

Gapped
Lambda     K      H
   0.267   0.0618    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 27,216,953
Number of extensions: 2586654
Number of successful extensions: 2168
Number of sequences better than 10.0: 1
Number of HSP's gapped: 2105
Number of HSP's successfully gapped: 94
Length of query: 538
Length of database: 10,937,602
Length adjustment: 102
Effective length of query: 436
Effective length of database: 6,413,494
Effective search space: 2796283384
Effective search space used: 2796283384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (27.5 bits)