BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3489
         (129 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4IIW|A Chain A, 2.6 Angstrom Crystal Structure Of Putative Yceg-like
           Protein Lmo1499 From Listeria Monocytogenes
 pdb|4IIW|B Chain B, 2.6 Angstrom Crystal Structure Of Putative Yceg-like
           Protein Lmo1499 From Listeria Monocytogenes
          Length = 349

 Score = 33.1 bits (74), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 14  ALKDAKNDRLWFKTNTKLGKLYFDR--EDFNKL 44
           AL   K+D L+F  NTK GK+YF +  E+ NKL
Sbjct: 308 ALYPEKSDYLYFLANTKTGKVYFSKTLEEHNKL 340


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.136    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,321,048
Number of Sequences: 62578
Number of extensions: 113693
Number of successful extensions: 295
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 292
Number of HSP's gapped (non-prelim): 3
length of query: 129
length of database: 14,973,337
effective HSP length: 88
effective length of query: 41
effective length of database: 9,466,473
effective search space: 388125393
effective search space used: 388125393
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)