Query         psy3491
Match_columns 108
No_of_seqs    118 out of 1296
Neff          10.5
Searched_HMMs 46136
Date          Fri Aug 16 18:04:25 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3491.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3491hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8   4E-19 8.7E-24  110.3   3.1   86   13-99    163-264 (279)
  2 KOG2462|consensus               99.7 1.3E-18 2.9E-23  108.0   4.4   97   11-108   130-245 (279)
  3 KOG3623|consensus               99.4 1.1E-13 2.4E-18   95.8   2.5   91    8-99    237-330 (1007)
  4 KOG3623|consensus               99.3 3.2E-13 6.9E-18   93.6   1.6   75   13-99    896-971 (1007)
  5 KOG3576|consensus               99.3 1.7E-13 3.7E-18   82.4   0.1   81   12-104   118-199 (267)
  6 KOG3576|consensus               99.1 3.5E-11 7.7E-16   72.6   1.3   62   46-108   114-175 (267)
  7 PHA02768 hypothetical protein;  99.0 1.1E-10 2.3E-15   56.6   1.7   44   49-95      5-48  (55)
  8 PHA00733 hypothetical protein   99.0 3.3E-10 7.1E-15   64.8   3.7   55   46-103    70-124 (128)
  9 KOG1074|consensus               98.9 1.5E-10 3.3E-15   81.5   0.3   58   49-107   353-410 (958)
 10 KOG3608|consensus               98.8 5.2E-09 1.1E-13   68.0   4.0   83    8-102   259-345 (467)
 11 KOG1074|consensus               98.8 2.1E-09 4.6E-14   75.9   1.4   58   49-107   879-936 (958)
 12 PHA00616 hypothetical protein   98.8 4.9E-09 1.1E-13   48.5   1.7   32   50-82      2-33  (44)
 13 KOG3608|consensus               98.6 1.3E-08 2.9E-13   66.1   1.0   90   13-102   209-316 (467)
 14 PF13465 zf-H2C2_2:  Zinc-finge  98.6 4.8E-08   1E-12   40.6   2.1   26   64-90      1-26  (26)
 15 PHA00732 hypothetical protein   98.5 6.1E-08 1.3E-12   50.9   1.6   45   49-99      1-45  (79)
 16 PHA00616 hypothetical protein   98.4 1.3E-07 2.8E-12   43.8   1.7   30   78-107     1-30  (44)
 17 KOG3993|consensus               98.4 4.2E-08   9E-13   65.0  -0.5   80   13-104   269-382 (500)
 18 PHA02768 hypothetical protein;  98.3 3.3E-07 7.2E-12   44.5   2.0   24   79-102     6-29  (55)
 19 PF05605 zf-Di19:  Drought indu  98.3 9.8E-07 2.1E-11   43.1   3.6   52   49-103     2-54  (54)
 20 PLN03086 PRLI-interacting fact  98.3   2E-06 4.3E-11   59.8   5.2   59   13-88    455-514 (567)
 21 PF00096 zf-C2H2:  Zinc finger,  98.2 7.5E-07 1.6E-11   35.8   1.7   22   79-100     1-22  (23)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.1   2E-06 4.4E-11   35.6   1.5   25   26-61      2-26  (26)
 23 PF13894 zf-C2H2_4:  C2H2-type   98.1   3E-06 6.6E-11   34.0   2.0   24   79-102     1-24  (24)
 24 PF00096 zf-C2H2:  Zinc finger,  98.0 3.7E-06   8E-11   33.7   1.8   23   50-72      1-23  (23)
 25 PF09237 GAGA:  GAGA factor;  I  98.0 4.1E-06 8.8E-11   39.7   1.5   31   77-107    23-53  (54)
 26 PF13912 zf-C2H2_6:  C2H2-type   98.0 2.8E-06 6.2E-11   35.4   0.7   24   79-102     2-25  (27)
 27 PLN03086 PRLI-interacting fact  97.9 3.1E-05 6.7E-10   54.1   5.4   77   12-103   479-565 (567)
 28 PHA00733 hypothetical protein   97.9   8E-06 1.7E-10   46.8   1.9   55   46-101    37-96  (128)
 29 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.1E-05 2.5E-10   33.5   1.0   26   49-74      1-26  (27)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.2E-05 4.7E-10   42.6   2.1   72   13-101     1-73  (100)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.7 3.3E-05 7.1E-10   30.8   1.9   24   50-73      1-24  (24)
 32 smart00355 ZnF_C2H2 zinc finge  97.6 9.5E-05 2.1E-09   29.9   2.5   24   79-102     1-24  (26)
 33 PF05605 zf-Di19:  Drought indu  97.4 0.00058 1.3E-08   33.2   4.4   52   11-73      2-53  (54)
 34 COG5189 SFP1 Putative transcri  97.4 4.8E-05   1E-09   49.4   0.5   53   46-99    346-419 (423)
 35 KOG3993|consensus               97.3 3.8E-05 8.2E-10   51.5  -0.8   53   50-103   268-320 (500)
 36 smart00355 ZnF_C2H2 zinc finge  97.0 0.00045 9.7E-09   27.7   1.5   24   50-73      1-24  (26)
 37 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00081 1.8E-08   26.9   1.8   23   79-102     1-23  (24)
 38 PHA00732 hypothetical protein   96.9 0.00077 1.7E-08   35.4   2.0   25   78-102     1-26  (79)
 39 PF12874 zf-met:  Zinc-finger o  96.9  0.0005 1.1E-08   27.8   0.9   22   79-100     1-22  (25)
 40 PF09237 GAGA:  GAGA factor;  I  96.7  0.0024 5.1E-08   30.5   2.5   32   46-77     21-52  (54)
 41 PRK04860 hypothetical protein;  96.6  0.0021 4.5E-08   38.3   2.7   38   49-91    119-156 (160)
 42 PF12874 zf-met:  Zinc-finger o  96.5  0.0018 3.8E-08   26.1   1.3   23   50-72      1-23  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0049 1.1E-07   24.6   1.9   23   50-73      1-23  (24)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  96.1  0.0012 2.7E-08   27.3  -0.3   21   79-99      2-22  (27)
 45 PF12756 zf-C2H2_2:  C2H2 type   96.0  0.0045 9.7E-08   33.4   1.8   25   49-73     50-74  (100)
 46 COG5189 SFP1 Putative transcri  96.0  0.0041   9E-08   40.7   1.7   59   12-70    350-419 (423)
 47 PF13913 zf-C2HC_2:  zinc-finge  95.9  0.0091   2E-07   24.2   1.9   20   79-99      3-22  (25)
 48 smart00451 ZnF_U1 U1-like zinc  94.8   0.021 4.6E-07   24.8   1.4   21   79-99      4-24  (35)
 49 KOG2893|consensus               93.3   0.018   4E-07   36.4  -0.5   49   48-102    10-58  (341)
 50 PRK04860 hypothetical protein;  92.4   0.085 1.8E-06   31.5   1.5   27   78-108   119-145 (160)
 51 cd00350 rubredoxin_like Rubred  92.1    0.12 2.5E-06   22.4   1.4   24   50-86      2-25  (33)
 52 KOG2186|consensus               92.1    0.13 2.9E-06   32.8   2.1   54   11-77      3-56  (276)
 53 COG5048 FOG: Zn-finger [Genera  91.4   0.029 6.2E-07   37.6  -1.4   58   48-106   288-351 (467)
 54 COG4049 Uncharacterized protei  89.0    0.38 8.3E-06   23.4   1.7   31   44-74     12-42  (65)
 55 PF04959 ARS2:  Arsenite-resist  88.5    0.15 3.2E-06   32.0   0.1   26   79-104    78-103 (214)
 56 PF13719 zinc_ribbon_5:  zinc-r  88.1     0.3 6.5E-06   21.7   1.0   34   50-89      3-36  (37)
 57 cd00729 rubredoxin_SM Rubredox  87.7    0.27 5.9E-06   21.4   0.7   25   49-86      2-26  (34)
 58 PF05443 ROS_MUCR:  ROS/MUCR tr  86.2    0.37   8E-06   27.9   0.9   24   79-105    73-96  (132)
 59 smart00614 ZnF_BED BED zinc fi  86.1    0.71 1.5E-05   21.8   1.8   21   79-99     19-44  (50)
 60 PF13717 zinc_ribbon_4:  zinc-r  85.8    0.42 9.1E-06   21.1   0.8   33   50-88      3-35  (36)
 61 TIGR00373 conserved hypothetic  85.6    0.43 9.3E-06   28.4   1.0   34   47-90    107-140 (158)
 62 TIGR02098 MJ0042_CXXC MJ0042 f  85.3    0.46   1E-05   21.0   0.8   33   50-88      3-35  (38)
 63 COG2888 Predicted Zn-ribbon RN  84.8    0.93   2E-05   22.4   1.8   32   49-86     27-58  (61)
 64 PRK06266 transcription initiat  84.3    0.51 1.1E-05   28.7   0.9   34   47-90    115-148 (178)
 65 PRK00464 nrdR transcriptional   84.3    0.14   3E-06   30.4  -1.5   15   50-64     29-43  (154)
 66 PF09538 FYDLN_acid:  Protein o  83.4    0.79 1.7E-05   25.6   1.4   30   50-91     10-39  (108)
 67 COG1592 Rubrerythrin [Energy p  83.0    0.77 1.7E-05   27.7   1.3   24   49-86    134-157 (166)
 68 TIGR02605 CxxC_CxxC_SSSS putat  82.8    0.41 8.9E-06   22.7   0.1   30   49-86      5-34  (52)
 69 PF02892 zf-BED:  BED zinc fing  82.6     1.4   3E-05   20.1   1.9   22   79-100    17-42  (45)
 70 smart00531 TFIIE Transcription  82.5       1 2.2E-05   26.5   1.7   39   46-89     96-134 (147)
 71 KOG1146|consensus               82.5    0.93   2E-05   35.5   1.8   52   47-99    463-539 (1406)
 72 smart00834 CxxC_CXXC_SSSS Puta  81.9    0.47   1E-05   21.2   0.1   30   49-86      5-34  (41)
 73 TIGR00622 ssl1 transcription f  81.7       2 4.4E-05   24.1   2.6   84   13-102    17-105 (112)
 74 smart00734 ZnF_Rad18 Rad18-lik  81.4     1.7 3.8E-05   17.6   1.7   20   79-99      2-21  (26)
 75 PF12013 DUF3505:  Protein of u  79.8     1.7 3.8E-05   24.0   2.0   25   79-103    81-109 (109)
 76 KOG4173|consensus               79.1     1.2 2.6E-05   27.8   1.2   53   50-103   107-171 (253)
 77 smart00659 RPOLCX RNA polymera  78.0     1.8 3.9E-05   20.0   1.4   27   49-87      2-28  (44)
 78 KOG2186|consensus               77.8     1.1 2.5E-05   28.7   0.9   46   50-99      4-49  (276)
 79 PF09986 DUF2225:  Uncharacteri  77.3    0.34 7.4E-06   30.3  -1.5   11   79-89     49-59  (214)
 80 PF13878 zf-C2H2_3:  zinc-finge  77.2     2.2 4.7E-05   19.4   1.5   24   50-73     14-39  (41)
 81 PF09723 Zn-ribbon_8:  Zinc rib  76.1     1.1 2.4E-05   20.4   0.4   30   49-86      5-34  (42)
 82 PF04959 ARS2:  Arsenite-resist  75.7     2.6 5.5E-05   26.6   2.0   29   46-74     74-102 (214)
 83 PF08790 zf-LYAR:  LYAR-type C2  75.1    0.57 1.2E-05   19.5  -0.7   11   50-60      1-11  (28)
 84 PF07754 DUF1610:  Domain of un  73.9     1.6 3.4E-05   17.5   0.5   10   48-57     15-24  (24)
 85 KOG2785|consensus               72.4       4 8.6E-05   27.9   2.4   51   49-100   166-242 (390)
 86 PRK00398 rpoP DNA-directed RNA  72.2     1.4 2.9E-05   20.4   0.2   29   49-88      3-31  (46)
 87 TIGR02300 FYDLN_acid conserved  71.5     2.8 6.1E-05   24.1   1.3   30   50-91     10-39  (129)
 88 PRK09678 DNA-binding transcrip  68.4     1.4 2.9E-05   22.8  -0.3   15   49-63     27-43  (72)
 89 KOG4167|consensus               68.4       2 4.3E-05   31.9   0.4   25   49-73    792-816 (907)
 90 KOG1146|consensus               67.9     3.9 8.4E-05   32.4   1.8   56   47-103  1282-1353(1406)
 91 PRK14890 putative Zn-ribbon RN  67.8     4.1 8.9E-05   20.2   1.3   32   49-86     25-56  (59)
 92 PF13451 zf-trcl:  Probable zin  67.8     3.5 7.5E-05   19.6   1.0   19   47-65      2-20  (49)
 93 PF12013 DUF3505:  Protein of u  66.0       5 0.00011   22.1   1.7   26   49-74     80-109 (109)
 94 COG1996 RPC10 DNA-directed RNA  65.1       4 8.7E-05   19.4   1.0   28   48-86      5-32  (49)
 95 PF14353 CpXC:  CpXC protein     65.0     6.7 0.00015   22.3   2.1   17   49-65     38-54  (128)
 96 PF09963 DUF2197:  Uncharacteri  64.8     2.7 5.7E-05   20.6   0.3   36   51-86      4-39  (56)
 97 KOG4173|consensus               64.5     4.9 0.00011   25.2   1.5   51   48-102    78-130 (253)
 98 PF06524 NOA36:  NOA36 protein;  63.6       7 0.00015   25.5   2.1   71   13-87     99-180 (314)
 99 COG4957 Predicted transcriptio  61.6     3.6 7.8E-05   23.9   0.5   24   79-105    77-100 (148)
100 COG1571 Predicted DNA-binding   61.2     4.3 9.4E-05   28.2   0.9   15   49-63    367-381 (421)
101 KOG2593|consensus               60.9     4.4 9.6E-05   28.2   0.9   39   45-87    124-162 (436)
102 COG5151 SSL1 RNA polymerase II  60.9     4.2   9E-05   27.2   0.8   48   51-101   364-411 (421)
103 PHA00626 hypothetical protein   60.1     4.5 9.7E-05   19.8   0.6   17   47-63     21-37  (59)
104 COG5048 FOG: Zn-finger [Genera  59.8       7 0.00015   26.2   1.8   58   47-105    31-90  (467)
105 PF10571 UPF0547:  Uncharacteri  58.7       6 0.00013   16.0   0.8   11   79-89     15-25  (26)
106 COG2331 Uncharacterized protei  57.7     5.2 0.00011   20.9   0.7   31   49-87     12-42  (82)
107 PF02176 zf-TRAF:  TRAF-type zi  56.5       5 0.00011   19.3   0.5   39   49-89      9-53  (60)
108 PRK03824 hypA hydrogenase nick  54.7     4.8  0.0001   23.4   0.3   15   48-62     69-83  (135)
109 KOG2071|consensus               54.0     7.5 0.00016   28.2   1.2   28   47-74    416-443 (579)
110 KOG4167|consensus               54.0     2.6 5.6E-05   31.3  -1.0   25   79-103   793-817 (907)
111 KOG2231|consensus               52.7      14 0.00029   27.5   2.3   48   51-103   184-237 (669)
112 PF10537 WAC_Acf1_DNA_bd:  ATP-  51.7      22 0.00047   19.7   2.5   38   48-87      2-39  (102)
113 PF08274 PhnA_Zn_Ribbon:  PhnA   51.1       6 0.00013   16.7   0.2    7   79-85     20-26  (30)
114 smart00154 ZnF_AN1 AN1-like Zi  50.7     7.2 0.00016   17.4   0.5   13   49-61     12-24  (39)
115 PF09845 DUF2072:  Zn-ribbon co  50.6     6.3 0.00014   22.8   0.4   15   49-63      1-15  (131)
116 KOG3408|consensus               50.6      14 0.00031   21.1   1.7   26   46-71     54-79  (129)
117 PF10013 DUF2256:  Uncharacteri  47.1      12 0.00027   17.1   1.0   14   79-92      9-22  (42)
118 COG4306 Uncharacterized protei  46.8     5.1 0.00011   23.1  -0.4   15   48-62     67-81  (160)
119 KOG2636|consensus               46.7      15 0.00032   25.9   1.7   29   70-99    394-423 (497)
120 TIGR00100 hypA hydrogenase nic  46.7      11 0.00024   21.2   0.9   25   49-86     70-94  (115)
121 KOG2807|consensus               46.5      25 0.00054   23.9   2.6   16   13-28    292-308 (378)
122 KOG0717|consensus               46.4      11 0.00024   26.6   1.1   21   79-99    293-313 (508)
123 COG3364 Zn-ribbon containing p  45.5      10 0.00023   21.0   0.7   15   49-63      2-16  (112)
124 KOG2231|consensus               45.5      42 0.00092   25.1   3.8   52   11-82    182-240 (669)
125 PF04780 DUF629:  Protein of un  44.9      18 0.00039   25.7   1.9   22   79-100    58-79  (466)
126 KOG0978|consensus               43.8     2.1 4.6E-05   31.5  -2.7   15   79-93    679-693 (698)
127 PRK12380 hydrogenase nickel in  43.8      15 0.00032   20.7   1.1   25   49-86     70-94  (113)
128 KOG2071|consensus               42.7      19 0.00041   26.3   1.7   27   76-103   417-443 (579)
129 KOG2482|consensus               42.6      16 0.00034   24.9   1.3   51   49-100   144-217 (423)
130 PF01428 zf-AN1:  AN1-like Zinc  42.1     9.4  0.0002   17.3   0.2   14   48-61     12-25  (43)
131 PF04423 Rad50_zn_hook:  Rad50   41.1      10 0.00022   18.0   0.2   12   80-91     22-33  (54)
132 PF15269 zf-C2H2_7:  Zinc-finge  40.9      23  0.0005   16.5   1.3   16   50-65     21-36  (54)
133 PF14311 DUF4379:  Domain of un  40.1      25 0.00054   16.7   1.5   14   49-62     28-41  (55)
134 PF08209 Sgf11:  Sgf11 (transcr  40.1      26 0.00056   15.1   1.4   21   49-70      4-24  (33)
135 COG5236 Uncharacterized conser  39.5      33 0.00072   23.6   2.4   24   51-74    222-245 (493)
136 PF12907 zf-met2:  Zinc-binding  38.7     7.9 0.00017   17.6  -0.4   24   51-74      3-29  (40)
137 PRK00564 hypA hydrogenase nick  37.1      19 0.00041   20.3   0.9   27   49-87     71-97  (117)
138 PF07282 OrfB_Zn_ribbon:  Putat  36.4      20 0.00043   17.8   0.8   12   79-90     47-58  (69)
139 PF01363 FYVE:  FYVE zinc finge  36.1      16 0.00034   18.2   0.5   11   50-60     10-20  (69)
140 PLN02294 cytochrome c oxidase   36.0      16 0.00035   22.2   0.5   17   46-62    138-154 (174)
141 PF11931 DUF3449:  Domain of un  34.8      13 0.00028   23.2   0.0   21   76-97    100-121 (196)
142 cd00924 Cyt_c_Oxidase_Vb Cytoc  33.8      19 0.00041   19.8   0.5   15   47-61     77-91  (97)
143 KOG1842|consensus               32.8      32  0.0007   24.4   1.6   26   49-74     15-40  (505)
144 PF04780 DUF629:  Protein of un  31.5      40 0.00086   24.1   1.9   26   48-73     56-81  (466)
145 PF01155 HypA:  Hydrogenase exp  31.4      23 0.00049   19.8   0.6   26   49-87     70-95  (113)
146 cd00065 FYVE FYVE domain; Zinc  31.4      38 0.00082   15.9   1.4    8   52-59      5-12  (57)
147 COG4338 Uncharacterized protei  31.2      17 0.00037   17.2   0.1   12   80-91     14-25  (54)
148 PF10276 zf-CHCC:  Zinc-finger   30.6      18 0.00038   16.4   0.1   10   49-58     29-38  (40)
149 PF10083 DUF2321:  Uncharacteri  30.6     6.9 0.00015   23.4  -1.6   15   48-62     67-81  (158)
150 KOG3014|consensus               30.5      45 0.00097   21.7   1.9   32   43-74     28-64  (257)
151 COG1773 Rubredoxin [Energy pro  30.1      20 0.00043   17.5   0.2   14   49-62      3-16  (55)
152 PF06397 Desulfoferrod_N:  Desu  29.8      26 0.00056   15.5   0.5   12   48-59      5-16  (36)
153 smart00064 FYVE Protein presen  29.7      36 0.00077   16.8   1.1   10   51-60     12-21  (68)
154 KOG1842|consensus               29.5      34 0.00074   24.3   1.3   26   79-104    16-41  (505)
155 PLN02748 tRNA dimethylallyltra  28.4      48   0.001   23.7   1.9   23   76-99    417-440 (468)
156 PHA02998 RNA polymerase subuni  27.9      20 0.00043   22.1  -0.0   38   50-91    144-184 (195)
157 PRK05452 anaerobic nitric oxid  27.8      21 0.00044   25.4   0.1   41   46-87    422-467 (479)
158 COG3677 Transposase and inacti  26.7      37  0.0008   19.6   1.0   14   75-89     51-64  (129)
159 cd00730 rubredoxin Rubredoxin;  26.6      33 0.00071   16.3   0.6   12   79-90      2-13  (50)
160 PF00301 Rubredoxin:  Rubredoxi  26.2      25 0.00055   16.4   0.2   36   50-86      2-42  (47)
161 COG1675 TFA1 Transcription ini  26.2      43 0.00094   20.5   1.2   32   47-88    111-142 (176)
162 COG5188 PRP9 Splicing factor 3  26.0      41  0.0009   23.2   1.2   28   70-98    367-395 (470)
163 COG3357 Predicted transcriptio  25.1      24 0.00053   19.1   0.0   28   47-85     56-83  (97)
164 PF01215 COX5B:  Cytochrome c o  25.0      29 0.00063   20.3   0.3   16   47-62    110-125 (136)
165 COG4391 Uncharacterized protei  25.0      29 0.00063   17.3   0.3   40   45-89     20-59  (62)
166 PF02891 zf-MIZ:  MIZ/SP-RING z  24.7      58  0.0013   15.3   1.3    8   79-86     42-49  (50)
167 PF02591 DUF164:  Putative zinc  24.7      71  0.0015   15.2   1.7   33   50-87     23-55  (56)
168 COG1326 Uncharacterized archae  24.6      66  0.0014   20.2   1.8   10   79-88     31-40  (201)
169 PRK04351 hypothetical protein;  23.8      44 0.00095   19.8   0.9   32   49-89    112-143 (149)
170 KOG1280|consensus               23.1      90  0.0019   21.5   2.3   38   48-85     78-116 (381)
171 COG2879 Uncharacterized small   23.1   1E+02  0.0022   15.6   2.0   18   90-107    24-41  (65)
172 PF03194 LUC7:  LUC7 N_terminus  23.1      35 0.00076   22.2   0.5    7   50-56    191-197 (254)
173 PF12773 DZR:  Double zinc ribb  22.9      60  0.0013   14.8   1.2    9   79-87     30-38  (50)
174 PTZ00448 hypothetical protein;  22.8      66  0.0014   22.3   1.7   22   79-100   315-336 (373)
175 PF07503 zf-HYPF:  HypF finger;  22.6      17 0.00037   15.9  -0.7   10   79-88     22-31  (35)
176 PF10263 SprT-like:  SprT-like   22.3      22 0.00047   20.8  -0.6   31   49-88    123-153 (157)
177 PRK00762 hypA hydrogenase nick  22.3      39 0.00085   19.3   0.5   31   49-86     70-100 (124)
178 PF07975 C1_4:  TFIIH C1-like d  22.2      12 0.00026   18.0  -1.4   23   47-69     19-41  (51)
179 PF01286 XPA_N:  XPA protein N-  21.4      42  0.0009   14.6   0.4   14   50-63      4-17  (34)
180 KOG1994|consensus               21.4      61  0.0013   20.9   1.3   23   74-97    236-258 (268)
181 COG0675 Transposase and inacti  21.2      45 0.00097   21.8   0.7   15   76-91    321-335 (364)
182 COG1198 PriA Primosomal protei  20.9      29 0.00063   26.2  -0.3    6   13-18    437-442 (730)
183 TIGR03831 YgiT_finger YgiT-typ  20.4      38 0.00082   15.0   0.2   13   49-61     32-44  (46)
184 PRK14892 putative transcriptio  20.3      35 0.00076   18.8   0.1   34   48-89     20-53  (99)
185 PF14447 Prok-RING_4:  Prokaryo  20.3      60  0.0013   15.9   0.8   11   80-90     41-51  (55)
186 PRK08222 hydrogenase 4 subunit  20.1      77  0.0017   19.3   1.5   19   79-97    115-133 (181)

No 1  
>KOG2462|consensus
Probab=99.76  E-value=4e-19  Score=110.28  Aligned_cols=86  Identities=24%  Similarity=0.415  Sum_probs=55.6

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcC-------CCCCcc--------ccccCCCceeeccchhhhccCchHHHHHHhHHhcCC
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFS-------SGASFS--------SFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKE   76 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~-------~~~~~~--------~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~   76 (108)
                      .|++|. .+...+.|.-|++++.       .++.+.        .+.++|+|||.|..|+++|...++|+.|+++|.+.+
T Consensus       163 ~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K  242 (279)
T KOG2462|consen  163 SCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK  242 (279)
T ss_pred             cCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCc
Confidence            677777 6777777777766553       111211        123466777777777777777777777777777666


Q ss_pred             CCccCCCCccccCCchhHHHHHH
Q psy3491          77 AGLQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        77 ~~~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      + |.|..|+|.|...+.|.+|..
T Consensus       243 ~-~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  243 K-HQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             c-ccCcchhhHHHHHHHHHHhhh
Confidence            5 777777777777777777664


No 2  
>KOG2462|consensus
Probab=99.75  E-value=1.3e-18  Score=107.97  Aligned_cols=97  Identities=20%  Similarity=0.312  Sum_probs=81.4

Q ss_pred             CccCCCCC-CCcChhHHHHHhhhcCCC------------------CCccccccCCCceeeccchhhhccCchHHHHHHhH
Q psy3491          11 NIVDPVCP-AFVDAPWLYFLLYSFSSG------------------ASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKF   71 (108)
Q Consensus        11 ~~~~~~c~-~~~~~~~~~~~~~~~~~~------------------~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   71 (108)
                      .+.|+.|. .+....+|..|...+...                  .++.+|..++.-+++|.+||+.|.+..-|+.|+++
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhccccc
Confidence            34889998 788888887775544322                  23335666677799999999999999999999999


Q ss_pred             HhcCCCCccCCCCccccCCchhHHHHHHHhcCCCCCC
Q psy3491          72 ECGKEAGLQCPFCPYKSKHKSNLKTHMAIRHQNGLHV  108 (108)
Q Consensus        72 ~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~~  108 (108)
                      |+|+++ |.|+.|+|.|.-+++|+.|+++|.+.|.|.
T Consensus       210 HTGEKP-F~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  210 HTGEKP-FSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             ccCCCC-ccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence            999988 999999999999999999999999999874


No 3  
>KOG3623|consensus
Probab=99.40  E-value=1.1e-13  Score=95.82  Aligned_cols=91  Identities=22%  Similarity=0.419  Sum_probs=73.4

Q ss_pred             CccCccCCCCC-CCcChhHHHHHhhhcCCCCCcccc--ccCCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCC
Q psy3491           8 RTVNIVDPVCP-AFVDAPWLYFLLYSFSSGASFSSF--KPLQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFC   84 (108)
Q Consensus         8 ~~~~~~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C   84 (108)
                      ...|+-|+.|. .|.-...|..|+..+..+..-...  ...+.+.|+|..||++|..+-.|..|+++|.|+++ |.|+.|
T Consensus       237 ne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKP-feCpnC  315 (1007)
T KOG3623|consen  237 NEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKP-FECPNC  315 (1007)
T ss_pred             CCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCC-cCCccc
Confidence            35677899998 888888998998887665433222  22356779999999999999999999999999887 999999


Q ss_pred             ccccCCchhHHHHHH
Q psy3491          85 PYKSKHKSNLKTHMA   99 (108)
Q Consensus        85 ~~~f~~~~~l~~H~~   99 (108)
                      +|.|....++..|+.
T Consensus       316 kKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  316 KKRFSHSGSYSSHMS  330 (1007)
T ss_pred             ccccccCCccccccc
Confidence            999999888888864


No 4  
>KOG3623|consensus
Probab=99.34  E-value=3.2e-13  Score=93.59  Aligned_cols=75  Identities=27%  Similarity=0.483  Sum_probs=55.9

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCc
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHK   91 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~   91 (108)
                      .|..|. +|...+.|..|-+-+           +|.+||+|.+|.++|..+-.|..|++.|.|+++ |.|+-|+|.|...
T Consensus       896 aCDqCDK~FqKqSSLaRHKYEH-----------sGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHS  963 (1007)
T KOG3623|consen  896 ACDQCDKAFQKQSSLARHKYEH-----------SGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHS  963 (1007)
T ss_pred             hHHHHHHHHHhhHHHHHhhhhh-----------cCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccc
Confidence            666666 666666666664433           677788888888888888888888888888776 8888888888888


Q ss_pred             hhHHHHHH
Q psy3491          92 SNLKTHMA   99 (108)
Q Consensus        92 ~~l~~H~~   99 (108)
                      .++..|+-
T Consensus       964 GSYSQHMN  971 (1007)
T KOG3623|consen  964 GSYSQHMN  971 (1007)
T ss_pred             cchHhhhc
Confidence            77777763


No 5  
>KOG3576|consensus
Probab=99.33  E-value=1.7e-13  Score=82.38  Aligned_cols=81  Identities=21%  Similarity=0.365  Sum_probs=66.0

Q ss_pred             ccCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCC
Q psy3491          12 IVDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKH   90 (108)
Q Consensus        12 ~~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~   90 (108)
                      +.|-+|. .|.-...|..|++++           ...+.+.|..||+.|....+|.+|.++|++.++ |.|..|++.|.+
T Consensus       118 ftCrvCgK~F~lQRmlnrh~kch-----------~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftq  185 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNRHLKCH-----------SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQ  185 (267)
T ss_pred             eeeehhhhhhhHHHHHHHHhhhc-----------cHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHh
Confidence            4788888 788778888888877           345668888888888888888888888888776 888888888888


Q ss_pred             chhHHHHHHHhcCC
Q psy3491          91 KSNLKTHMAIRHQN  104 (108)
Q Consensus        91 ~~~l~~H~~~h~~~  104 (108)
                      +-+|..|.+..|+.
T Consensus       186 rcsleshl~kvhgv  199 (267)
T KOG3576|consen  186 RCSLESHLKKVHGV  199 (267)
T ss_pred             hccHHHHHHHHcCc
Confidence            88888888776664


No 6  
>KOG3576|consensus
Probab=99.08  E-value=3.5e-11  Score=72.57  Aligned_cols=62  Identities=23%  Similarity=0.364  Sum_probs=57.9

Q ss_pred             CCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhcCCCCCC
Q psy3491          46 QSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRHQNGLHV  108 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~~  108 (108)
                      +...|.|..|++.|.-...|.+|++.|...+. +.|..||+-|+-...|++|.|+|+|.+||.
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr-~lct~cgkgfndtfdlkrh~rthtgvrpyk  175 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR-HLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  175 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHH-HHHhhccCcccchhhhhhhhccccCccccc
Confidence            45679999999999999999999999999888 999999999999999999999999999983


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.03  E-value=1.1e-10  Score=56.57  Aligned_cols=44  Identities=18%  Similarity=0.285  Sum_probs=39.2

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHH
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLK   95 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~   95 (108)
                      .|.|+.||+.|...+.|..|++.|.  ++ +.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecccceeE
Confidence            3899999999999999999999988  45 99999999999877653


No 8  
>PHA00733 hypothetical protein
Probab=99.03  E-value=3.3e-10  Score=64.78  Aligned_cols=55  Identities=18%  Similarity=0.503  Sum_probs=49.3

Q ss_pred             CCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhcC
Q psy3491          46 QSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      +.+||.|..|++.|.....|..|++.+.  .+ +.|.+|++.|.....|.+|+...|+
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~r~h~--~~-~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHIRYTE--HS-KVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHHhcCC--cC-ccCCCCCCccCCHHHHHHHHHHhcC
Confidence            4679999999999999999999998762  44 9999999999999999999988775


No 9  
>KOG1074|consensus
Probab=98.94  E-value=1.5e-10  Score=81.45  Aligned_cols=58  Identities=26%  Similarity=0.510  Sum_probs=53.9

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhcCCCCC
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRHQNGLH  107 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~  107 (108)
                      +++|..|.+.|...+.|+.|.+.|+++++ |+|.+||..|.++.+|+.|...|+...|+
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERP-fqCnvCG~~FSTkGNLKvH~~rH~e~~p~  410 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERP-FQCNVCGNRFSTKGNLKVHFQRHREKYPH  410 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCC-eeecccccccccccceeeeeeeccccCCc
Confidence            57899999999999999999999999887 99999999999999999999988877654


No 10 
>KOG3608|consensus
Probab=98.82  E-value=5.2e-09  Score=67.96  Aligned_cols=83  Identities=23%  Similarity=0.441  Sum_probs=62.7

Q ss_pred             CccC-ccCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCC--
Q psy3491           8 RTVN-IVDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPF--   83 (108)
Q Consensus         8 ~~~~-~~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~--   83 (108)
                      +++| +.||.|. .....+.|..|++.-+          ...+||+|..|.+.+.+.++|.+|...|. +.. |.|..  
T Consensus       259 rHvn~ykCplCdmtc~~~ssL~~H~r~rH----------s~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~-y~C~h~~  326 (467)
T KOG3608|consen  259 RHVNCYKCPLCDMTCSSASSLTTHIRYRH----------SKDKPFKCDECDTRCVRESDLAKHVQVHS-KTV-YQCEHPD  326 (467)
T ss_pred             HhhhcccccccccCCCChHHHHHHHHhhh----------ccCCCccccchhhhhccHHHHHHHHHhcc-ccc-eecCCCC
Confidence            3444 4889998 7888888888887553          45789999999999999999999998776 344 67754  


Q ss_pred             CccccCCchhHHHHHHHhc
Q psy3491          84 CPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        84 C~~~f~~~~~l~~H~~~h~  102 (108)
                      |..++.+...+++|.+.++
T Consensus       327 C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  327 CHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             CcHHHHHHHHHHHHHHHhc
Confidence            6666666666777766555


No 11 
>KOG1074|consensus
Probab=98.78  E-value=2.1e-09  Score=75.93  Aligned_cols=58  Identities=26%  Similarity=0.499  Sum_probs=54.7

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhcCCCCC
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRHQNGLH  107 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~  107 (108)
                      .+.|..||+.|...++|..|+++|.++++ |.|.+|++.|....+|+.|+.+|.+..+.
T Consensus       879 ~h~C~vCgk~FsSSsALqiH~rTHtg~KP-F~C~fC~~aFttrgnLKvHMgtH~w~q~~  936 (958)
T KOG1074|consen  879 AHVCNVCGKQFSSSAALEIHMRTHTGPKP-FFCHFCEEAFTTRGNLKVHMGTHMWVQPP  936 (958)
T ss_pred             hhhhccchhcccchHHHHHhhhcCCCCCC-ccchhhhhhhhhhhhhhhhhccccccCCC
Confidence            47899999999999999999999999998 99999999999999999999999998764


No 12 
>PHA00616 hypothetical protein
Probab=98.75  E-value=4.9e-09  Score=48.51  Aligned_cols=32  Identities=16%  Similarity=0.302  Sum_probs=15.4

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCC
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCP   82 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~   82 (108)
                      |+|..||+.|...+.|..|++.+++..+ +.|+
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCc-ccee
Confidence            4455555555555555555554444433 4443


No 13 
>KOG3608|consensus
Probab=98.60  E-value=1.3e-08  Score=66.11  Aligned_cols=90  Identities=20%  Similarity=0.365  Sum_probs=48.1

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcCC-----------------CCCccccccCCCceeeccchhhhccCchHHHHHHhHHhc
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFSS-----------------GASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      .||.|. .|....-+..|++....                 .+.+.+|......-|.|+.|.......+.|..|++..+.
T Consensus       209 ACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs  288 (467)
T KOG3608|consen  209 ACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHS  288 (467)
T ss_pred             ecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhc
Confidence            688888 67777777666553321                 111112222223345555555555555555555554333


Q ss_pred             CCCCccCCCCccccCCchhHHHHHHHhc
Q psy3491          75 KEAGLQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        75 ~~~~~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      ...||+|+.|.+.+...+.|++|...|.
T Consensus       289 ~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  289 KDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cCCCccccchhhhhccHHHHHHHHHhcc
Confidence            2223666666666666666666666544


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.58  E-value=4.8e-08  Score=40.61  Aligned_cols=26  Identities=27%  Similarity=0.723  Sum_probs=21.8

Q ss_pred             HHHHHHhHHhcCCCCccCCCCccccCC
Q psy3491          64 SLERHKKFECGKEAGLQCPFCPYKSKH   90 (108)
Q Consensus        64 ~l~~h~~~~~~~~~~~~c~~C~~~f~~   90 (108)
                      +|..|++.|.++++ |.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCC-CCCCCCcCeeCc
Confidence            47889999999887 999999988863


No 15 
>PHA00732 hypothetical protein
Probab=98.49  E-value=6.1e-08  Score=50.89  Aligned_cols=45  Identities=24%  Similarity=0.490  Sum_probs=29.8

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHH
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      ||.|..|++.|.....|..|++.++.  + +.|+.|++.|.   .+..|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~-~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--L-TKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--C-CccCCCCCEeC---Chhhhhc
Confidence            46777777777777777777764222  2 57777777776   3555653


No 16 
>PHA00616 hypothetical protein
Probab=98.43  E-value=1.3e-07  Score=43.81  Aligned_cols=30  Identities=20%  Similarity=0.243  Sum_probs=28.4

Q ss_pred             CccCCCCccccCCchhHHHHHHHhcCCCCC
Q psy3491          78 GLQCPFCPYKSKHKSNLKTHMAIRHQNGLH  107 (108)
Q Consensus        78 ~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~  107 (108)
                      ||+|..||+.|...++|.+|++.||+++++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~   30 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKL   30 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcc
Confidence            499999999999999999999999999985


No 17 
>KOG3993|consensus
Probab=98.40  E-value=4.2e-08  Score=65.05  Aligned_cols=80  Identities=18%  Similarity=0.374  Sum_probs=60.0

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhc-----------------
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECG-----------------   74 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~-----------------   74 (108)
                      +|-.|. .+.+...|.+|. +.          .+-.-.|.|+.|++.|....+|..|+++|-.                 
T Consensus       269 iCqLCK~kYeD~F~LAQHr-C~----------RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~  337 (500)
T KOG3993|consen  269 ICQLCKEKYEDAFALAQHR-CP----------RIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVE  337 (500)
T ss_pred             HHHHHHHhhhhHHHHhhcc-CC----------eeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhh
Confidence            566666 566665655542 22          1222359999999999999999999998852                 


Q ss_pred             ----------------CCCCccCCCCccccCCchhHHHHHHHhcCC
Q psy3491          75 ----------------KEAGLQCPFCPYKSKHKSNLKTHMAIRHQN  104 (108)
Q Consensus        75 ----------------~~~~~~c~~C~~~f~~~~~l~~H~~~h~~~  104 (108)
                                      +.. |.|..|++.|....-|+.|+.+|+..
T Consensus       338 ~rae~~ea~rsg~dss~gi-~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  338 TRAEVQEAERSGDDSSSGI-FSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             hhhhhhhccccCCcccCce-eecHHhhhhhHHHHHHHHhHHhhhcc
Confidence                            122 88999999999999999999988864


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.34  E-value=3.3e-07  Score=44.46  Aligned_cols=24  Identities=21%  Similarity=0.533  Sum_probs=23.6

Q ss_pred             ccCCCCccccCCchhHHHHHHHhc
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      |.|+.||+.|...++|..|+++|+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC
Confidence            899999999999999999999999


No 19 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.33  E-value=9.8e-07  Score=43.08  Aligned_cols=52  Identities=29%  Similarity=0.544  Sum_probs=38.6

Q ss_pred             eeeccchhhhccCchHHHHHHhHHh-cCCCCccCCCCccccCCchhHHHHHHHhcC
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFEC-GKEAGLQCPFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~-~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      .|.|+.|++ ......|..|....+ .+...+.|++|...+.  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            488999999 555678999966544 3333499999987544  489999988774


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.27  E-value=2e-06  Score=59.76  Aligned_cols=59  Identities=20%  Similarity=0.383  Sum_probs=33.9

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcccc
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKS   88 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f   88 (108)
                      .|+.|. .| ....+..|++.++             +++.|+ ||..+ ....|..|+..+.+.++ +.|..|++.+
T Consensus       455 ~C~~Cgk~f-~~s~LekH~~~~H-------------kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v  514 (567)
T PLN03086        455 HCEKCGQAF-QQGEMEKHMKVFH-------------EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMV  514 (567)
T ss_pred             cCCCCCCcc-chHHHHHHHHhcC-------------CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCcc
Confidence            677887 44 4566777776541             345555 65433 33555566555555554 6666666555


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.24  E-value=7.5e-07  Score=35.76  Aligned_cols=22  Identities=45%  Similarity=0.759  Sum_probs=14.3

Q ss_pred             ccCCCCccccCCchhHHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAI  100 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~  100 (108)
                      |.|+.|++.|.....|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666665


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.09  E-value=2e-06  Score=35.61  Aligned_cols=25  Identities=16%  Similarity=0.364  Sum_probs=19.9

Q ss_pred             HHHHhhhcCCCCCccccccCCCceeeccchhhhccC
Q psy3491          26 LYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKA   61 (108)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~   61 (108)
                      |..|++.+           ++++||.|+.|++.|..
T Consensus         2 l~~H~~~H-----------~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    2 LRRHMRTH-----------TGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHH-----------SSSSSEEESSSSEEESS
T ss_pred             HHHHhhhc-----------CCCCCCCCCCCcCeeCc
Confidence            45666655           78999999999999863


No 23 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.09  E-value=3e-06  Score=34.01  Aligned_cols=24  Identities=42%  Similarity=0.848  Sum_probs=15.5

Q ss_pred             ccCCCCccccCCchhHHHHHHHhc
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      |.|++|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            457777777777777777777664


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.04  E-value=3.7e-06  Score=33.66  Aligned_cols=23  Identities=30%  Similarity=0.766  Sum_probs=20.8

Q ss_pred             eeccchhhhccCchHHHHHHhHH
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFE   72 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~   72 (108)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998864


No 25 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.97  E-value=4.1e-06  Score=39.75  Aligned_cols=31  Identities=29%  Similarity=0.563  Sum_probs=21.4

Q ss_pred             CCccCCCCccccCCchhHHHHHHHhcCCCCC
Q psy3491          77 AGLQCPFCPYKSKHKSNLKTHMAIRHQNGLH  107 (108)
Q Consensus        77 ~~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~  107 (108)
                      .|-.|++|+..+.+..+|++|+++.|+.||-
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            3488899998888889999999888888863


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.96  E-value=2.8e-06  Score=35.38  Aligned_cols=24  Identities=21%  Similarity=0.328  Sum_probs=15.8

Q ss_pred             ccCCCCccccCCchhHHHHHHHhc
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      |.|..|++.|.+...|..|++.|.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            566666666666666666666554


No 27 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.91  E-value=3.1e-05  Score=54.07  Aligned_cols=77  Identities=19%  Similarity=0.318  Sum_probs=58.2

Q ss_pred             ccCCCCCCCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccC----------chHHHHHHhHHhcCCCCccC
Q psy3491          12 IVDPVCPAFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKA----------KGSLERHKKFECGKEAGLQC   81 (108)
Q Consensus        12 ~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~----------~~~l~~h~~~~~~~~~~~~c   81 (108)
                      +.|| |........+..|+...           -..+++.|..|+..+..          ...|..|.... +.++ +.|
T Consensus       479 v~Cp-Cg~~~~R~~L~~H~~th-----------Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt-~~C  544 (567)
T PLN03086        479 LQCP-CGVVLEKEQMVQHQAST-----------CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT-APC  544 (567)
T ss_pred             ccCC-CCCCcchhHHHhhhhcc-----------CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc-eEc
Confidence            4788 88544566777776543           45689999999998852          34788998875 6677 999


Q ss_pred             CCCccccCCchhHHHHHHHhcC
Q psy3491          82 PFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        82 ~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      ..||+.+..+ .+..|+...|+
T Consensus       545 ~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        545 DSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             cccCCeeeeh-hHHHHHHHhhc
Confidence            9999998877 47888877665


No 28 
>PHA00733 hypothetical protein
Probab=97.88  E-value=8e-06  Score=46.80  Aligned_cols=55  Identities=13%  Similarity=0.182  Sum_probs=42.3

Q ss_pred             CCceeeccchhhhccCchHHHHH--Hh---HHhcCCCCccCCCCccccCCchhHHHHHHHh
Q psy3491          46 QSALFMCESCHKTYKAKGSLERH--KK---FECGKEAGLQCPFCPYKSKHKSNLKTHMAIR  101 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h--~~---~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h  101 (108)
                      ..+++.|..|...|.....|..+  ..   ...+.++ |.|..|++.|.+...|..|++.+
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kP-y~C~~Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSP-YVCPLCLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCC-ccCCCCCCcCCCHHHHHHHHhcC
Confidence            45679999999888877666555  11   2223455 99999999999999999999865


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.77  E-value=1.1e-05  Score=33.48  Aligned_cols=26  Identities=35%  Similarity=0.830  Sum_probs=23.2

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      ||.|..|++.|.....|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58999999999999999999987753


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.74  E-value=2.2e-05  Score=42.62  Aligned_cols=72  Identities=17%  Similarity=0.262  Sum_probs=16.6

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCc
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHK   91 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~   91 (108)
                      .|.+|. .|.+...+..|+...+.. .+.             . ...+.....+..+...... .. +.|..|++.|.+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~-~~~-------------~-~~~l~~~~~~~~~~~~~~~-~~-~~C~~C~~~f~s~   63 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGF-DIP-------------D-QKYLVDPNRLLNYLRKKVK-ES-FRCPYCNKTFRSR   63 (100)
T ss_dssp             ----------------------------------------------------------------SS-EEBSSSS-EESSH
T ss_pred             Ccccccccccccccccccccccccc-ccc-------------c-ccccccccccccccccccC-CC-CCCCccCCCCcCH
Confidence            478888 788888888887544321 111             0 0000111112222221111 23 7777777777777


Q ss_pred             hhHHHHHHHh
Q psy3491          92 SNLKTHMAIR  101 (108)
Q Consensus        92 ~~l~~H~~~h  101 (108)
                      ..|..|++.+
T Consensus        64 ~~l~~Hm~~~   73 (100)
T PF12756_consen   64 EALQEHMRSK   73 (100)
T ss_dssp             HHHHHHHHHT
T ss_pred             HHHHHHHcCc
Confidence            7777777653


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.70  E-value=3.3e-05  Score=30.83  Aligned_cols=24  Identities=29%  Similarity=0.733  Sum_probs=19.3

Q ss_pred             eeccchhhhccCchHHHHHHhHHh
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      |.|+.|++.|.....|..|+..++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999988753


No 32 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.57  E-value=9.5e-05  Score=29.85  Aligned_cols=24  Identities=42%  Similarity=0.613  Sum_probs=16.0

Q ss_pred             ccCCCCccccCCchhHHHHHHHhc
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            456677777777777777776543


No 33 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.41  E-value=0.00058  Score=33.18  Aligned_cols=52  Identities=17%  Similarity=0.179  Sum_probs=37.7

Q ss_pred             CccCCCCCCCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHh
Q psy3491          11 NIVDPVCPAFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        11 ~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      .+.||+|....+...|..|....+..         +.+...|+.|...+.  .+|..|+...+
T Consensus         2 ~f~CP~C~~~~~~~~L~~H~~~~H~~---------~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKGFSESSLVEHCEDEHRS---------ESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCccCHHHHHHHHHhHCcC---------CCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            36799999656677888887766432         234689999998655  37888987654


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.39  E-value=4.8e-05  Score=49.38  Aligned_cols=53  Identities=25%  Similarity=0.509  Sum_probs=42.6

Q ss_pred             CCceeeccc--hhhhccCchHHHHHHhHHh-------------------cCCCCccCCCCccccCCchhHHHHHH
Q psy3491          46 QSALFMCES--CHKTYKAKGSLERHKKFEC-------------------GKEAGLQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        46 ~~~~~~C~~--c~~~f~~~~~l~~h~~~~~-------------------~~~~~~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      +++||.|+.  |.+.|.+...|..|+.-.+                   .+++ |.|++|+|.++....|+.|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP-YrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP-YRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc-eeccccchhhccCccceeccc
Confidence            469999975  9999999999998875322                   1354 999999999999888887754


No 35 
>KOG3993|consensus
Probab=97.29  E-value=3.8e-05  Score=51.46  Aligned_cols=53  Identities=21%  Similarity=0.445  Sum_probs=46.0

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhcC
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      |.|..|...|.....|.+|+-....... |.|++|+|+|+-..+|..|.|=|..
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWHKP  320 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWHKP  320 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhcccCC
Confidence            8999999999999999999765555456 9999999999999999999886643


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.03  E-value=0.00045  Score=27.74  Aligned_cols=24  Identities=29%  Similarity=0.735  Sum_probs=20.7

Q ss_pred             eeccchhhhccCchHHHHHHhHHh
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      +.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988653


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.93  E-value=0.00081  Score=26.94  Aligned_cols=23  Identities=48%  Similarity=1.024  Sum_probs=12.6

Q ss_pred             ccCCCCccccCCchhHHHHHHHhc
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      |.|+.|+.... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666665555 556666666655


No 38 
>PHA00732 hypothetical protein
Probab=96.90  E-value=0.00077  Score=35.43  Aligned_cols=25  Identities=24%  Similarity=0.525  Sum_probs=22.3

Q ss_pred             CccCCCCccccCCchhHHHHHHH-hc
Q psy3491          78 GLQCPFCPYKSKHKSNLKTHMAI-RH  102 (108)
Q Consensus        78 ~~~c~~C~~~f~~~~~l~~H~~~-h~  102 (108)
                      ||.|..|++.|.+..+|..|++. |.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~   26 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT   26 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC
Confidence            48999999999999999999985 44


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.85  E-value=0.0005  Score=27.79  Aligned_cols=22  Identities=18%  Similarity=0.514  Sum_probs=13.9

Q ss_pred             ccCCCCccccCCchhHHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAI  100 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~  100 (108)
                      |.|.+|++.|.+...+..|.+.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3566666666666666666643


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.67  E-value=0.0024  Score=30.46  Aligned_cols=32  Identities=19%  Similarity=0.309  Sum_probs=22.8

Q ss_pred             CCceeeccchhhhccCchHHHHHHhHHhcCCC
Q psy3491          46 QSALFMCESCHKTYKAKGSLERHKKFECGKEA   77 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~   77 (108)
                      .+.|..|+.|+..+....+|..|+...++.++
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            46789999999999999999999988777554


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=96.63  E-value=0.0021  Score=38.31  Aligned_cols=38  Identities=21%  Similarity=0.538  Sum_probs=31.7

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHK   91 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~   91 (108)
                      +|.|. |+.   ....+..|.+++.+.++ |.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            78998 986   56678899999999887 9999999887644


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.49  E-value=0.0018  Score=26.11  Aligned_cols=23  Identities=30%  Similarity=0.834  Sum_probs=19.5

Q ss_pred             eeccchhhhccCchHHHHHHhHH
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFE   72 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~   72 (108)
                      |.|..|+..|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57899999999999999988754


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.23  E-value=0.0049  Score=24.56  Aligned_cols=23  Identities=30%  Similarity=0.592  Sum_probs=17.1

Q ss_pred             eeccchhhhccCchHHHHHHhHHh
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      |.|+.|..... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67899998887 888999988765


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.07  E-value=0.0012  Score=27.26  Aligned_cols=21  Identities=29%  Similarity=0.515  Sum_probs=14.8

Q ss_pred             ccCCCCccccCCchhHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      |.|..|++.|.....+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567777777777777766654


No 45 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.05  E-value=0.0045  Score=33.36  Aligned_cols=25  Identities=28%  Similarity=0.708  Sum_probs=21.8

Q ss_pred             eeeccchhhhccCchHHHHHHhHHh
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      .+.|..|++.|.....|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6999999999999999999998754


No 46 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.01  E-value=0.0041  Score=40.71  Aligned_cols=59  Identities=22%  Similarity=0.404  Sum_probs=41.3

Q ss_pred             ccCCC--CC-CCcChhHHHHHhhhcCCCCCcccc-------c-cCCCceeeccchhhhccCchHHHHHHh
Q psy3491          12 IVDPV--CP-AFVDAPWLYFLLYSFSSGASFSSF-------K-PLQSALFMCESCHKTYKAKGSLERHKK   70 (108)
Q Consensus        12 ~~~~~--c~-~~~~~~~~~~~~~~~~~~~~~~~~-------~-~~~~~~~~C~~c~~~f~~~~~l~~h~~   70 (108)
                      +.||+  |. ++.....|++|+.--++...+..-       . ....|||.|..|++.|.+.-.|..|+.
T Consensus       350 ykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         350 YKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            37876  66 788888999987644433333211       1 135689999999999999888877743


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.89  E-value=0.0091  Score=24.25  Aligned_cols=20  Identities=30%  Similarity=0.675  Sum_probs=12.1

Q ss_pred             ccCCCCccccCCchhHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      ..|+.||+.| ..+.|.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4567777777 3345666654


No 48 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.80  E-value=0.021  Score=24.75  Aligned_cols=21  Identities=14%  Similarity=0.521  Sum_probs=16.3

Q ss_pred             ccCCCCccccCCchhHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      |.|.+|++.|.....+..|..
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            778888888887777777764


No 49 
>KOG2893|consensus
Probab=93.32  E-value=0.018  Score=36.38  Aligned_cols=49  Identities=22%  Similarity=0.458  Sum_probs=34.7

Q ss_pred             ceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhc
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      +|| |=.|++.|.....|.+|++.    +. |+|-+|.|.+-+...|..|-...|
T Consensus        10 kpw-cwycnrefddekiliqhqka----kh-fkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   10 KPW-CWYCNREFDDEKILIQHQKA----KH-FKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             Cce-eeecccccchhhhhhhhhhh----cc-ceeeeehhhhccCCCceeehhhhh
Confidence            454 66788899999889988875    44 899999877666555655544333


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=92.43  E-value=0.085  Score=31.51  Aligned_cols=27  Identities=15%  Similarity=0.402  Sum_probs=22.9

Q ss_pred             CccCCCCccccCCchhHHHHHHHhcCCCCCC
Q psy3491          78 GLQCPFCPYKSKHKSNLKTHMAIRHQNGLHV  108 (108)
Q Consensus        78 ~~~c~~C~~~f~~~~~l~~H~~~h~~~k~~~  108 (108)
                      +|.|. |++   ....+.+|.+++.++++|.
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~Yr  145 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYR  145 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEE
Confidence            39998 986   7778899999999999873


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.10  E-value=0.12  Score=22.35  Aligned_cols=24  Identities=25%  Similarity=0.783  Sum_probs=16.3

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      |.|..||..+....            . ++.|++|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~-~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------A-PWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------C-CCcCcCCCC
Confidence            67888887665432            3 488888874


No 52 
>KOG2186|consensus
Probab=92.09  E-value=0.13  Score=32.77  Aligned_cols=54  Identities=24%  Similarity=0.308  Sum_probs=30.2

Q ss_pred             CccCCCCCCCcChhHHHHHhhhcCCCCCccccccCCCceeeccchhhhccCchHHHHHHhHHhcCCC
Q psy3491          11 NIVDPVCPAFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESCHKTYKAKGSLERHKKFECGKEA   77 (108)
Q Consensus        11 ~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~   77 (108)
                      .|.|.+|.....++.+..|+..-           .+ .-|.|..|++.|.. .++..|....+....
T Consensus         3 ~FtCnvCgEsvKKp~vekH~srC-----------rn-~~fSCIDC~k~F~~-~sYknH~kCITEaQK   56 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQVEKHMSRC-----------RN-AYFSCIDCGKTFER-VSYKNHTKCITEAQK   56 (276)
T ss_pred             EEehhhhhhhccccchHHHHHhc-----------cC-CeeEEeeccccccc-chhhhhhhhcchHHH
Confidence            45666666555555555554322           11 34777777777766 345666655554444


No 53 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.41  E-value=0.029  Score=37.61  Aligned_cols=58  Identities=19%  Similarity=0.449  Sum_probs=50.6

Q ss_pred             ceeeccchhhhccCchHHHHHHh--HHhcC--CCCccCC--CCccccCCchhHHHHHHHhcCCCC
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKK--FECGK--EAGLQCP--FCPYKSKHKSNLKTHMAIRHQNGL  106 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~--~~~~~--~~~~~c~--~C~~~f~~~~~l~~H~~~h~~~k~  106 (108)
                      .++.|..|...|.....+..|.+  .|.+.  .+ +.|+  .|++.|.....+..|..+|.+-.+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  351 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTSISP  351 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccCCCc
Confidence            46889999999999999999999  78887  55 9999  799999999999999988887654


No 54 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.95  E-value=0.38  Score=23.43  Aligned_cols=31  Identities=16%  Similarity=0.372  Sum_probs=24.1

Q ss_pred             cCCCceeeccchhhhccCchHHHHHHhHHhc
Q psy3491          44 PLQSALFMCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        44 ~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      ..|+.-+.|+-|+..|....+...|..-.++
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3466678899999999988888888765444


No 55 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=88.49  E-value=0.15  Score=31.96  Aligned_cols=26  Identities=23%  Similarity=0.520  Sum_probs=16.5

Q ss_pred             ccCCCCccccCCchhHHHHHHHhcCC
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRHQN  104 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~~~  104 (108)
                      |.|.+|+|.|.-..-+.+|+..-|.+
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHH
Confidence            77777777777777777777665543


No 56 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.12  E-value=0.3  Score=21.66  Aligned_cols=34  Identities=21%  Similarity=0.672  Sum_probs=19.3

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccC
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSK   89 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~   89 (108)
                      -.|+.|+..|.-..+     +...+... ..|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~-----~l~~~~~~-vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD-----KLPAGGRK-VRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHH-----HcccCCcE-EECCCCCcEee
Confidence            357777777765542     11122344 77777776653


No 57 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.69  E-value=0.27  Score=21.40  Aligned_cols=25  Identities=28%  Similarity=0.747  Sum_probs=16.7

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      .|.|..||..+...             .+|..|++|+.
T Consensus         2 ~~~C~~CG~i~~g~-------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE-------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC-------------cCCCcCcCCCC
Confidence            47888998665332             23478999874


No 58 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=86.24  E-value=0.37  Score=27.91  Aligned_cols=24  Identities=29%  Similarity=0.380  Sum_probs=13.4

Q ss_pred             ccCCCCccccCCchhHHHHHHHhcCCC
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRHQNG  105 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~~~k  105 (108)
                      ..|-+||+.|..-   ++|.+.|||-.
T Consensus        73 i~clecGk~~k~L---krHL~~~~glt   96 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGLT   96 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S-
T ss_pred             eEEccCCcccchH---HHHHHHccCCC
Confidence            6777788776653   78888777643


No 59 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=86.12  E-value=0.71  Score=21.80  Aligned_cols=21  Identities=33%  Similarity=0.741  Sum_probs=12.1

Q ss_pred             ccCCCCccccCCc-----hhHHHHHH
Q psy3491          79 LQCPFCPYKSKHK-----SNLKTHMA   99 (108)
Q Consensus        79 ~~c~~C~~~f~~~-----~~l~~H~~   99 (108)
                      ..|..|++.+...     ++|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666655332     46666666


No 60 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=85.78  E-value=0.42  Score=21.09  Aligned_cols=33  Identities=15%  Similarity=0.424  Sum_probs=18.6

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcccc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKS   88 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f   88 (108)
                      ..|+.|+..|.-....     ....... ..|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~-v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRK-VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcE-EECCCCCCEe
Confidence            3577777777655432     1122234 7777777665


No 61 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.60  E-value=0.43  Score=28.44  Aligned_cols=34  Identities=18%  Similarity=0.464  Sum_probs=25.6

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCC
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKH   90 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~   90 (108)
                      ..-|.|+.|+..|+....+.         .. |.|+.||.....
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~~  140 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLDY  140 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEeee
Confidence            44589999998888776653         24 999999987543


No 62 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=85.26  E-value=0.46  Score=20.95  Aligned_cols=33  Identities=15%  Similarity=0.406  Sum_probs=18.2

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcccc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKS   88 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f   88 (108)
                      ..|+.|+..|.-..+..     ...... ..|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~-v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGK-VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCE-EECCCCCCEE
Confidence            46777777765544321     111123 6777777665


No 63 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=84.84  E-value=0.93  Score=22.41  Aligned_cols=32  Identities=22%  Similarity=0.506  Sum_probs=19.5

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      .|.|+.||+.-.....     +...-..+ |.|+.||-
T Consensus        27 ~F~CPnCGe~~I~Rc~-----~CRk~g~~-Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCA-----KCRKLGNP-YRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhh-----hHHHcCCc-eECCCcCc
Confidence            5999999966544321     11111244 99999973


No 64 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=84.30  E-value=0.51  Score=28.72  Aligned_cols=34  Identities=24%  Similarity=0.697  Sum_probs=25.2

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCC
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKH   90 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~   90 (108)
                      ..-|.|+.|+..|+....+.         .. |.|+.||..+..
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCee
Confidence            34589999998887765442         24 999999987544


No 65 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=84.25  E-value=0.14  Score=30.42  Aligned_cols=15  Identities=20%  Similarity=0.428  Sum_probs=10.8

Q ss_pred             eeccchhhhccCchH
Q psy3491          50 FMCESCHKTYKAKGS   64 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~   64 (108)
                      ++|+.||..|.....
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            778888888776543


No 66 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.37  E-value=0.79  Score=25.61  Aligned_cols=30  Identities=23%  Similarity=0.541  Sum_probs=20.2

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHK   91 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~   91 (108)
                      ..|+.||..|.-   |        + +.|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYD---L--------n-k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD---L--------N-KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc---C--------C-CCCccCCCCCCccCcc
Confidence            678888877643   2        1 2348888888877654


No 67 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=82.96  E-value=0.77  Score=27.67  Aligned_cols=24  Identities=38%  Similarity=0.789  Sum_probs=18.0

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      -|.|++||..+             .+ .+|-.|++||-
T Consensus       134 ~~vC~vCGy~~-------------~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cC-CCCCcCCCCCC
Confidence            69999998543             34 44699999984


No 68 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=82.84  E-value=0.41  Score=22.73  Aligned_cols=30  Identities=17%  Similarity=0.506  Sum_probs=19.3

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      -|.|..||..|.....+.      . ... ..|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~------~-~~~-~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMS------D-DPL-ATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecC------C-CCC-CCCCCCCC
Confidence            378999998886543221      1 233 67999885


No 69 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=82.60  E-value=1.4  Score=20.05  Aligned_cols=22  Identities=36%  Similarity=0.621  Sum_probs=12.4

Q ss_pred             ccCCCCccccCC----chhHHHHHHH
Q psy3491          79 LQCPFCPYKSKH----KSNLKTHMAI  100 (108)
Q Consensus        79 ~~c~~C~~~f~~----~~~l~~H~~~  100 (108)
                      ..|..|++.+..    .+.|.+|++.
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            677777766554    3567777643


No 70 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=82.49  E-value=1  Score=26.49  Aligned_cols=39  Identities=18%  Similarity=0.456  Sum_probs=25.5

Q ss_pred             CCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccC
Q psy3491          46 QSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSK   89 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~   89 (108)
                      ...-|.|+.|+..|.....+.    ....... |.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~----~~d~~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQ----LLDMDGT-FTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHH----hcCCCCc-EECCCCCCEEE
Confidence            344699999998887544322    1112344 99999997653


No 71 
>KOG1146|consensus
Probab=82.46  E-value=0.93  Score=35.54  Aligned_cols=52  Identities=23%  Similarity=0.472  Sum_probs=43.1

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhc-------------------------CCCCccCCCCccccCCchhHHHHHH
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECG-------------------------KEAGLQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~-------------------------~~~~~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      .+.+.|+.|+..|.....|..|++..+.                         .+ +|.|..|...+....+|..|+.
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~-p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGK-PYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCC-cccceeeeeeeecchHHHHHHH
Confidence            3679999999999999999999987221                         23 4999999999999999999976


No 72 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=81.87  E-value=0.47  Score=21.17  Aligned_cols=30  Identities=23%  Similarity=0.571  Sum_probs=19.6

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      .|.|..||..|.......      . ... ..|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~~------~-~~~-~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKIS------D-DPL-ATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEecC------C-CCC-CCCCCCCC
Confidence            478999998886543321      1 233 77888886


No 73 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=81.73  E-value=2  Score=24.14  Aligned_cols=84  Identities=12%  Similarity=0.189  Sum_probs=46.2

Q ss_pred             cCCCCC-CCcChhHHHHHhhhcCCCCCccc--cccC--CCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          13 VDPVCP-AFVDAPWLYFLLYSFSSGASFSS--FKPL--QSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      .||+|. .+...+.|...   ++.-..+..  ....  ....-.|-.|...|........-.  ...... |.|+.|...
T Consensus        17 ~CpiCgLtLVss~HLARS---yHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~~--~~~~~~-y~C~~C~~~   90 (112)
T TIGR00622        17 ECPICGLTLILSTHLARS---YHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFDE--LKDSHR-YVCAVCKNV   90 (112)
T ss_pred             cCCcCCCEEeccchHHHh---hhccCCCcccccccccccCCCCcccCcCCCCCCcccccccc--cccccc-eeCCCCCCc
Confidence            789998 77777777541   111111110  0000  111234888888886543111000  112234 999999999


Q ss_pred             cCCchhHHHHHHHhc
Q psy3491          88 SKHKSNLKTHMAIRH  102 (108)
Q Consensus        88 f~~~~~l~~H~~~h~  102 (108)
                      |--.-.+-.|..+|.
T Consensus        91 FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        91 FCVDCDVFVHESLHC  105 (112)
T ss_pred             cccccchhhhhhccC
Confidence            988877777776654


No 74 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=81.36  E-value=1.7  Score=17.59  Aligned_cols=20  Identities=25%  Similarity=0.690  Sum_probs=13.7

Q ss_pred             ccCCCCccccCCchhHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      ..|++|++.+ ....+..|..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            4678888776 5556777765


No 75 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=79.78  E-value=1.7  Score=24.00  Aligned_cols=25  Identities=28%  Similarity=0.762  Sum_probs=22.6

Q ss_pred             ccC----CCCccccCCchhHHHHHHHhcC
Q psy3491          79 LQC----PFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        79 ~~c----~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      |.|    ..|+....+...+.+|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    8999999999999999998875


No 76 
>KOG4173|consensus
Probab=79.14  E-value=1.2  Score=27.84  Aligned_cols=53  Identities=26%  Similarity=0.478  Sum_probs=37.4

Q ss_pred             eeccchhhhccCchHHHHHHh-HHh---------cCCCCccC--CCCccccCCchhHHHHHHHhcC
Q psy3491          50 FMCESCHKTYKAKGSLERHKK-FEC---------GKEAGLQC--PFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~-~~~---------~~~~~~~c--~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      ..|..|.+.|.+..-|..|+. +|.         |... |.|  ..|+..|.+...-..|+...|.
T Consensus       107 ~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dM-y~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  107 NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDM-YQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccH-HHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            478889888888877777754 222         3334 888  4688888888888888765553


No 77 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=77.95  E-value=1.8  Score=20.03  Aligned_cols=27  Identities=26%  Similarity=0.901  Sum_probs=17.6

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      .|.|..||..+...           ...+ ..|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~-irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDV-VRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCc-eECCCCCce
Confidence            37888888766533           2233 888888853


No 78 
>KOG2186|consensus
Probab=77.77  E-value=1.1  Score=28.74  Aligned_cols=46  Identities=22%  Similarity=0.402  Sum_probs=36.0

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHH
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      |.|..||....-.. +..|+...++ .- |.|-.|++.|-. .++..|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn-~~-fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN-AY-FSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC-Ce-eEEeeccccccc-chhhhhhh
Confidence            78999998876654 6779877766 55 999999999987 56677754


No 79 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=77.34  E-value=0.34  Score=30.32  Aligned_cols=11  Identities=36%  Similarity=0.966  Sum_probs=6.6

Q ss_pred             ccCCCCccccC
Q psy3491          79 LQCPFCPYKSK   89 (108)
Q Consensus        79 ~~c~~C~~~f~   89 (108)
                      ..|+.||-.+.
T Consensus        49 ~vCP~CgyA~~   59 (214)
T PF09986_consen   49 WVCPHCGYAAF   59 (214)
T ss_pred             EECCCCCCccc
Confidence            46677776543


No 80 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=77.22  E-value=2.2  Score=19.36  Aligned_cols=24  Identities=25%  Similarity=0.491  Sum_probs=18.2

Q ss_pred             eeccchhhhccC--chHHHHHHhHHh
Q psy3491          50 FMCESCHKTYKA--KGSLERHKKFEC   73 (108)
Q Consensus        50 ~~C~~c~~~f~~--~~~l~~h~~~~~   73 (108)
                      -.|+.||..|..  ..+...|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            489999998875  466777877764


No 81 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=76.11  E-value=1.1  Score=20.42  Aligned_cols=30  Identities=23%  Similarity=0.670  Sum_probs=20.0

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      .|.|..||..|.....+      .. ... ..|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~------~~-~~~-~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSI------SE-DDP-VPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEc------CC-CCC-CcCCCCCC
Confidence            37899999888664322      12 233 78999986


No 82 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=75.74  E-value=2.6  Score=26.57  Aligned_cols=29  Identities=17%  Similarity=0.310  Sum_probs=22.0

Q ss_pred             CCceeeccchhhhccCchHHHHHHhHHhc
Q psy3491          46 QSALFMCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      ++..|.|..|++.|.-...+.+|+...+.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            44579999999999999999999876554


No 83 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=75.05  E-value=0.57  Score=19.52  Aligned_cols=11  Identities=36%  Similarity=1.059  Sum_probs=6.2

Q ss_pred             eeccchhhhcc
Q psy3491          50 FMCESCHKTYK   60 (108)
Q Consensus        50 ~~C~~c~~~f~   60 (108)
                      |.|-.|++.|.
T Consensus         1 ~sCiDC~~~F~   11 (28)
T PF08790_consen    1 FSCIDCSKDFD   11 (28)
T ss_dssp             EEETTTTEEEE
T ss_pred             CeeecCCCCcC
Confidence            34566666663


No 84 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=73.85  E-value=1.6  Score=17.51  Aligned_cols=10  Identities=30%  Similarity=0.703  Sum_probs=7.7

Q ss_pred             ceeeccchhh
Q psy3491          48 ALFMCESCHK   57 (108)
Q Consensus        48 ~~~~C~~c~~   57 (108)
                      ..|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            3699999874


No 85 
>KOG2785|consensus
Probab=72.36  E-value=4  Score=27.89  Aligned_cols=51  Identities=24%  Similarity=0.290  Sum_probs=40.9

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhc-----------------------CCCCccCCCCc---cccCCchhHHHHHHH
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECG-----------------------KEAGLQCPFCP---YKSKHKSNLKTHMAI  100 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~-----------------------~~~~~~c~~C~---~~f~~~~~l~~H~~~  100 (108)
                      |-.|-.|+..+........||..+++                       ... +.|-.|.   +.|.+..+.+.|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~-~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIG-FICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccC-ceEEEeccccCcccccHHHHHHHhh
Confidence            46789999999888888889887776                       233 7777777   889999999999863


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=72.23  E-value=1.4  Score=20.43  Aligned_cols=29  Identities=21%  Similarity=0.770  Sum_probs=17.1

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcccc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKS   88 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f   88 (108)
                      .|.|+.||..+.....          ... ..|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~-~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTG-VRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCc-eECCCCCCeE
Confidence            4778888766644321          113 7788887543


No 87 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=71.48  E-value=2.8  Score=24.11  Aligned_cols=30  Identities=10%  Similarity=0.205  Sum_probs=18.6

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHK   91 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~   91 (108)
                      ..|+.||..|.-   |        + +.|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD---L--------n-k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD---L--------N-RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc---c--------C-CCCccCCCcCCccCcc
Confidence            578888776633   2        1 2347788888776544


No 88 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=68.42  E-value=1.4  Score=22.80  Aligned_cols=15  Identities=20%  Similarity=0.603  Sum_probs=8.7

Q ss_pred             eeecc--chhhhccCch
Q psy3491          49 LFMCE--SCHKTYKAKG   63 (108)
Q Consensus        49 ~~~C~--~c~~~f~~~~   63 (108)
                      =++|.  .||..|....
T Consensus        27 Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678         27 YHQCQNVNCSATFITYE   43 (72)
T ss_pred             eeecCCCCCCCEEEEEE
Confidence            35665  6666665543


No 89 
>KOG4167|consensus
Probab=68.42  E-value=2  Score=31.85  Aligned_cols=25  Identities=28%  Similarity=0.469  Sum_probs=22.2

Q ss_pred             eeeccchhhhccCchHHHHHHhHHh
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      -|.|..|++.|....++..||+.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            5999999999998888889988875


No 90 
>KOG1146|consensus
Probab=67.91  E-value=3.9  Score=32.44  Aligned_cols=56  Identities=18%  Similarity=0.437  Sum_probs=43.1

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHh----------------cCCCCccCCCCccccCCchhHHHHHHHhcC
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFEC----------------GKEAGLQCPFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~----------------~~~~~~~c~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      ..+|.|..|...|.....|..|++...                .+..+| |..|...|.....|+.|+++.+.
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAH 1353 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhh
Confidence            456889999999999998988875322                123335 99999999999999999986444


No 91 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=67.81  E-value=4.1  Score=20.15  Aligned_cols=32  Identities=19%  Similarity=0.602  Sum_probs=18.4

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      .|.|+.||+.....-.   .-+..  ..+ |.|+.||-
T Consensus        25 ~F~CPnCG~~~I~RC~---~CRk~--~~~-Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCE---KCRKQ--SNP-YTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeech---hHHhc--CCc-eECCCCCC
Confidence            5999999976322211   11111  134 99999974


No 92 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=67.78  E-value=3.5  Score=19.62  Aligned_cols=19  Identities=11%  Similarity=0.392  Sum_probs=13.8

Q ss_pred             CceeeccchhhhccCchHH
Q psy3491          47 SALFMCESCHKTYKAKGSL   65 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l   65 (108)
                      .+.+.|..||..|.....-
T Consensus         2 Dk~l~C~dCg~~FvfTa~E   20 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGE   20 (49)
T ss_pred             CeeEEcccCCCeEEEehhH
Confidence            3568899999888765533


No 93 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=65.96  E-value=5  Score=22.14  Aligned_cols=26  Identities=23%  Similarity=0.506  Sum_probs=22.2

Q ss_pred             eeec----cchhhhccCchHHHHHHhHHhc
Q psy3491          49 LFMC----ESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        49 ~~~C----~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      -|.|    ..|+........+..|.+.+++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4889    9999999999999999887653


No 94 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=65.08  E-value=4  Score=19.40  Aligned_cols=28  Identities=18%  Similarity=0.689  Sum_probs=18.2

Q ss_pred             ceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      ..|.|..||+.+...          ..... ..|+.||.
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~-irCp~Cg~   32 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRG-IRCPYCGS   32 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCc-eeCCCCCc
Confidence            358999999887111          11233 88999984


No 95 
>PF14353 CpXC:  CpXC protein
Probab=65.03  E-value=6.7  Score=22.28  Aligned_cols=17  Identities=29%  Similarity=0.716  Sum_probs=11.3

Q ss_pred             eeeccchhhhccCchHH
Q psy3491          49 LFMCESCHKTYKAKGSL   65 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l   65 (108)
                      .+.|+.||..+.-...+
T Consensus        38 ~~~CP~Cg~~~~~~~p~   54 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPL   54 (128)
T ss_pred             EEECCCCCCceecCCCE
Confidence            57788888777655443


No 96 
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=64.82  E-value=2.7  Score=20.60  Aligned_cols=36  Identities=17%  Similarity=0.285  Sum_probs=18.2

Q ss_pred             eccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          51 MCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        51 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      .|..|++.+........-.+.-......|.|+.|..
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~   39 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKE   39 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHH
Confidence            466777766544322222232222222388888853


No 97 
>KOG4173|consensus
Probab=64.47  E-value=4.9  Score=25.22  Aligned_cols=51  Identities=25%  Similarity=0.496  Sum_probs=37.9

Q ss_pred             ceeeccc--hhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHhc
Q psy3491          48 ALFMCES--CHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIRH  102 (108)
Q Consensus        48 ~~~~C~~--c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h~  102 (108)
                      ..+.|..  |-..|....+...|-...++    -.|.+|.+.|.+...|..|+...|
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~H  130 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWH  130 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHH
Confidence            3477865  77778777777766655444    579999999999999998886544


No 98 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=63.57  E-value=7  Score=25.49  Aligned_cols=71  Identities=15%  Similarity=0.255  Sum_probs=38.6

Q ss_pred             cCCCCCCCcChhHHHHHhhhcCCCCCccccc---------cCCCceeeccchhhhccCchHHHHHHhHH--hcCCCCccC
Q psy3491          13 VDPVCPAFVDAPWLYFLLYSFSSGASFSSFK---------PLQSALFMCESCHKTYKAKGSLERHKKFE--CGKEAGLQC   81 (108)
Q Consensus        13 ~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~C~~c~~~f~~~~~l~~h~~~~--~~~~~~~~c   81 (108)
                      +|.+|++|..-+  +.++.++....++....         ..|.+.|.|..|...+ ...+--.|+.+-  ..... |+|
T Consensus        99 iCDfCEawvCHg--rkCl~~HaC~Cpl~da~C~EC~R~vw~hGGrif~CsfC~~fl-CEDDQFEHQAsCQvLe~E~-~KC  174 (314)
T PF06524_consen   99 ICDFCEAWVCHG--RKCLSTHACTCPLQDAVCIECERGVWDHGGRIFKCSFCDNFL-CEDDQFEHQASCQVLESET-FKC  174 (314)
T ss_pred             hhccchhheecc--ccccccccccCcCCCcEeeeeecccccCCCeEEEeecCCCee-eccchhhhhhhhhhhhccc-ccc
Confidence            777788776432  23444454444444221         1266789999997544 333333454421  12244 888


Q ss_pred             CCCccc
Q psy3491          82 PFCPYK   87 (108)
Q Consensus        82 ~~C~~~   87 (108)
                      ..|.+.
T Consensus       175 ~SCNrl  180 (314)
T PF06524_consen  175 QSCNRL  180 (314)
T ss_pred             cccccc
Confidence            777654


No 99 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=61.61  E-value=3.6  Score=23.94  Aligned_cols=24  Identities=25%  Similarity=0.181  Sum_probs=14.8

Q ss_pred             ccCCCCccccCCchhHHHHHHHhcCCC
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRHQNG  105 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~~~k  105 (108)
                      ..|-++|+.|.   +|++|..+|++.-
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmT  100 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLT  100 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCC
Confidence            45666666654   4577777776643


No 100
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=61.23  E-value=4.3  Score=28.19  Aligned_cols=15  Identities=20%  Similarity=0.443  Sum_probs=11.4

Q ss_pred             eeeccchhhhccCch
Q psy3491          49 LFMCESCHKTYKAKG   63 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~   63 (108)
                      -|.|..||..+....
T Consensus       367 g~rC~kCg~~~~~~~  381 (421)
T COG1571         367 GFRCKKCGTRARETL  381 (421)
T ss_pred             CcccccccccCCccc
Confidence            588998988876653


No 101
>KOG2593|consensus
Probab=60.88  E-value=4.4  Score=28.15  Aligned_cols=39  Identities=21%  Similarity=0.524  Sum_probs=25.6

Q ss_pred             CCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          45 LQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        45 ~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      +..+-|.|+.|.+.|.....+   +..-...-. |.|..|+..
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~---~L~~~~~~~-F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEAL---QLLDNETGE-FHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHH---HhhcccCce-EEEecCCCc
Confidence            445679999999988776544   233332234 899888754


No 102
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=60.85  E-value=4.2  Score=27.18  Aligned_cols=48  Identities=13%  Similarity=0.280  Sum_probs=27.5

Q ss_pred             eccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccCCchhHHHHHHHh
Q psy3491          51 MCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSKHKSNLKTHMAIR  101 (108)
Q Consensus        51 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~h  101 (108)
                      .|-.|.-.|.....-.--..  ..... |.|+.|...|...-+.-.|...|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~~~~--~ss~r-Y~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPFDES--TSSGR-YQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCccccc--ccccc-eechhhhhhhhhhhHHHHHHHHh
Confidence            36666666654321110011  11234 89999988888877777776655


No 103
>PHA00626 hypothetical protein
Probab=60.09  E-value=4.5  Score=19.80  Aligned_cols=17  Identities=18%  Similarity=0.393  Sum_probs=13.2

Q ss_pred             CceeeccchhhhccCch
Q psy3491          47 SALFMCESCHKTYKAKG   63 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~   63 (108)
                      ...|.|+.||..|+...
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            34699999998887643


No 104
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=59.81  E-value=7  Score=26.19  Aligned_cols=58  Identities=22%  Similarity=0.480  Sum_probs=45.9

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhcCCCCccCCC--CccccCCchhHHHHHHHhcCCC
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPF--CPYKSKHKSNLKTHMAIRHQNG  105 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~--C~~~f~~~~~l~~H~~~h~~~k  105 (108)
                      ..++.|..|...|........|.+.+.+..+ ..|..  |...+.....+.+|.+.++...
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   90 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKP-SQCSYSGCDKSFSRPLELSRHLRTHHNNP   90 (467)
T ss_pred             CchhhcccccccccccchhhhhcccccccCC-ccccccccccccCCcchhhhhcccccccc
Confidence            4568899999999999889999999988776 88854  5567777778888887776643


No 105
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=58.70  E-value=6  Score=16.04  Aligned_cols=11  Identities=36%  Similarity=0.936  Sum_probs=6.0

Q ss_pred             ccCCCCccccC
Q psy3491          79 LQCPFCPYKSK   89 (108)
Q Consensus        79 ~~c~~C~~~f~   89 (108)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            34566665553


No 106
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.65  E-value=5.2  Score=20.87  Aligned_cols=31  Identities=13%  Similarity=0.464  Sum_probs=19.0

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      .|.|..||+.|    ++.+++.   . .+.-.|+.|+-.
T Consensus        12 ~Y~c~~cg~~~----dvvq~~~---d-dplt~ce~c~a~   42 (82)
T COG2331          12 SYECTECGNRF----DVVQAMT---D-DPLTTCEECGAR   42 (82)
T ss_pred             EEeecccchHH----HHHHhcc---c-CccccChhhChH
Confidence            48899998776    3333332   2 333678888753


No 107
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=56.53  E-value=5  Score=19.32  Aligned_cols=39  Identities=26%  Similarity=0.701  Sum_probs=21.3

Q ss_pred             eeeccc--hhhhccCchHHHHHHhHHhcCCCCccCCC----CccccC
Q psy3491          49 LFMCES--CHKTYKAKGSLERHKKFECGKEAGLQCPF----CPYKSK   89 (108)
Q Consensus        49 ~~~C~~--c~~~f~~~~~l~~h~~~~~~~~~~~~c~~----C~~~f~   89 (108)
                      +-.|+.  |...+. ...|..|....-.... ..|..    |+..+.
T Consensus         9 ~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIP-RKELDDHLENECPKRP-VPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEE-CCCHHHHHHTTSTTSE-EE-SS----S--EEE
T ss_pred             EeeCCCCCccccee-HHHHHHHHHccCCCCc-EECCCCCCCCCCccc
Confidence            567776  444344 4458888886666555 77877    766543


No 108
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=54.67  E-value=4.8  Score=23.37  Aligned_cols=15  Identities=27%  Similarity=0.769  Sum_probs=11.9

Q ss_pred             ceeeccchhhhccCc
Q psy3491          48 ALFMCESCHKTYKAK   62 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~   62 (108)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458999999887654


No 109
>KOG2071|consensus
Probab=54.04  E-value=7.5  Score=28.17  Aligned_cols=28  Identities=14%  Similarity=0.320  Sum_probs=19.7

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhc
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      ..|..|..||.+|........|+..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            4567788888888877766666666543


No 110
>KOG4167|consensus
Probab=53.98  E-value=2.6  Score=31.32  Aligned_cols=25  Identities=20%  Similarity=0.274  Sum_probs=21.8

Q ss_pred             ccCCCCccccCCchhHHHHHHHhcC
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      |.|.+|+|+|..-.+++.|+++|-.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            8999999999888888899988754


No 111
>KOG2231|consensus
Probab=52.67  E-value=14  Score=27.48  Aligned_cols=48  Identities=27%  Similarity=0.596  Sum_probs=32.1

Q ss_pred             eccchhhhccCchHHHHHHhHHhcCCCCccCCCC------ccccCCchhHHHHHHHhcC
Q psy3491          51 MCESCHKTYKAKGSLERHKKFECGKEAGLQCPFC------PYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        51 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C------~~~f~~~~~l~~H~~~h~~  103 (108)
                      .|..|...|.....|..|++.++     |.|..|      +.-|.....|..|-+..|-
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcCc
Confidence            57788888888888887777544     444444      2346677777777776653


No 112
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=51.75  E-value=22  Score=19.69  Aligned_cols=38  Identities=5%  Similarity=0.080  Sum_probs=27.9

Q ss_pred             ceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      ..|.|+.-|..|.........+..... .. +.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~-~v-wtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQ-RV-WTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhC-Ce-eEEecCCCC
Confidence            357788888888888777777666654 44 888887775


No 113
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=51.09  E-value=6  Score=16.71  Aligned_cols=7  Identities=57%  Similarity=1.312  Sum_probs=4.1

Q ss_pred             ccCCCCc
Q psy3491          79 LQCPFCP   85 (108)
Q Consensus        79 ~~c~~C~   85 (108)
                      +.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            5666654


No 114
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.66  E-value=7.2  Score=17.42  Aligned_cols=13  Identities=23%  Similarity=0.649  Sum_probs=10.4

Q ss_pred             eeeccchhhhccC
Q psy3491          49 LFMCESCHKTYKA   61 (108)
Q Consensus        49 ~~~C~~c~~~f~~   61 (108)
                      |+.|..|++.|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7899999888754


No 115
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=50.61  E-value=6.3  Score=22.82  Aligned_cols=15  Identities=13%  Similarity=0.583  Sum_probs=12.8

Q ss_pred             eeeccchhhhccCch
Q psy3491          49 LFMCESCHKTYKAKG   63 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~   63 (108)
                      |+.|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            689999999998765


No 116
>KOG3408|consensus
Probab=50.61  E-value=14  Score=21.12  Aligned_cols=26  Identities=23%  Similarity=0.470  Sum_probs=22.4

Q ss_pred             CCceeeccchhhhccCchHHHHHHhH
Q psy3491          46 QSALFMCESCHKTYKAKGSLERHKKF   71 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h~~~   71 (108)
                      |.-.|-|-.|.+-|.....|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            55579999999999999999988764


No 117
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=47.10  E-value=12  Score=17.10  Aligned_cols=14  Identities=21%  Similarity=0.524  Sum_probs=8.6

Q ss_pred             ccCCCCccccCCch
Q psy3491          79 LQCPFCPYKSKHKS   92 (108)
Q Consensus        79 ~~c~~C~~~f~~~~   92 (108)
                      -.|.+|++.|...-
T Consensus         9 K~C~~C~rpf~WRK   22 (42)
T PF10013_consen    9 KICPVCGRPFTWRK   22 (42)
T ss_pred             CcCcccCCcchHHH
Confidence            34677777776543


No 118
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.79  E-value=5.1  Score=23.06  Aligned_cols=15  Identities=13%  Similarity=0.459  Sum_probs=9.8

Q ss_pred             ceeeccchhhhccCc
Q psy3491          48 ALFMCESCHKTYKAK   62 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~   62 (108)
                      .|.-|..||+.|...
T Consensus        67 ~psfchncgs~fpwt   81 (160)
T COG4306          67 PPSFCHNCGSRFPWT   81 (160)
T ss_pred             CcchhhcCCCCCCcH
Confidence            355677777777654


No 119
>KOG2636|consensus
Probab=46.70  E-value=15  Score=25.91  Aligned_cols=29  Identities=21%  Similarity=0.434  Sum_probs=21.6

Q ss_pred             hHHhcCCCCccCCCCc-cccCCchhHHHHHH
Q psy3491          70 KFECGKEAGLQCPFCP-YKSKHKSNLKTHMA   99 (108)
Q Consensus        70 ~~~~~~~~~~~c~~C~-~~f~~~~~l~~H~~   99 (108)
                      +.|.-+.. |.|.+|| .++.-+..+.+|-.
T Consensus       394 KLHGL~~e-y~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIE-YNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcc-cceeeccCccccCcHHHHHHhH
Confidence            34444565 9999999 88888888888853


No 120
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=46.69  E-value=11  Score=21.20  Aligned_cols=25  Identities=24%  Similarity=0.553  Sum_probs=17.8

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      ...|..||..|.....            . +.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------L-YRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCCc------------C-ccCcCCcC
Confidence            4889999977755421            3 77999974


No 121
>KOG2807|consensus
Probab=46.48  E-value=25  Score=23.87  Aligned_cols=16  Identities=31%  Similarity=0.636  Sum_probs=12.2

Q ss_pred             cCCCCC-CCcChhHHHH
Q psy3491          13 VDPVCP-AFVDAPWLYF   28 (108)
Q Consensus        13 ~~~~c~-~~~~~~~~~~   28 (108)
                      +||+|. .+..+++|..
T Consensus       292 eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  292 ECPICSLTLVSSPHLAR  308 (378)
T ss_pred             cCCccceeEecchHHHH
Confidence            788888 7887777743


No 122
>KOG0717|consensus
Probab=46.37  E-value=11  Score=26.63  Aligned_cols=21  Identities=33%  Similarity=0.545  Sum_probs=18.6

Q ss_pred             ccCCCCccccCCchhHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMA   99 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~   99 (108)
                      +.|.+|.++|.+.-.+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999988888865


No 123
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=45.47  E-value=10  Score=20.97  Aligned_cols=15  Identities=13%  Similarity=0.527  Sum_probs=12.6

Q ss_pred             eeeccchhhhccCch
Q psy3491          49 LFMCESCHKTYKAKG   63 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~   63 (108)
                      |+.|..||..|..-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            689999999998754


No 124
>KOG2231|consensus
Probab=45.45  E-value=42  Score=25.10  Aligned_cols=52  Identities=25%  Similarity=0.382  Sum_probs=32.0

Q ss_pred             CccCCCCC-CCcChhHHHHHhhhcCCCCCccccccCCCceeeccch------hhhccCchHHHHHHhHHhcCCCCccCC
Q psy3491          11 NIVDPVCP-AFVDAPWLYFLLYSFSSGASFSSFKPLQSALFMCESC------HKTYKAKGSLERHKKFECGKEAGLQCP   82 (108)
Q Consensus        11 ~~~~~~c~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~c------~~~f~~~~~l~~h~~~~~~~~~~~~c~   82 (108)
                      .++|..|. .|.+...+..|+...               -+.|..|      +..|....+|..|-+..+     |.|.
T Consensus       182 hp~C~~C~~~fld~~el~rH~~~~---------------h~~chfC~~~~~~neyy~~~~dLe~HfR~~H-----flCE  240 (669)
T KOG2231|consen  182 HPLCKFCHERFLDDDELYRHLRFD---------------HEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH-----FLCE  240 (669)
T ss_pred             CccchhhhhhhccHHHHHHhhccc---------------eeheeecCcccccchhcccchHHHHHhhhcC-----cccc
Confidence            35777777 677766666666532               1334433      456667778888876543     6665


No 125
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=44.91  E-value=18  Score=25.69  Aligned_cols=22  Identities=27%  Similarity=0.471  Sum_probs=11.9

Q ss_pred             ccCCCCccccCCchhHHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAI  100 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~  100 (108)
                      +.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            4455555555555555555543


No 126
>KOG0978|consensus
Probab=43.84  E-value=2.1  Score=31.52  Aligned_cols=15  Identities=20%  Similarity=0.390  Sum_probs=9.4

Q ss_pred             ccCCCCccccCCchh
Q psy3491          79 LQCPFCPYKSKHKSN   93 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~   93 (108)
                      -.||.|+..|...+.
T Consensus       679 RKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDV  693 (698)
T ss_pred             CCCCCCCCCCCcccc
Confidence            567777777665543


No 127
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=43.81  E-value=15  Score=20.66  Aligned_cols=25  Identities=24%  Similarity=0.554  Sum_probs=17.3

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      ...|..||..|....            .. +.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------HD-AQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------cC-ccCcCCCC
Confidence            478999997665432            22 67999984


No 128
>KOG2071|consensus
Probab=42.68  E-value=19  Score=26.25  Aligned_cols=27  Identities=22%  Similarity=0.422  Sum_probs=21.6

Q ss_pred             CCCccCCCCccccCCchhHHHHHHHhcC
Q psy3491          76 EAGLQCPFCPYKSKHKSNLKTHMAIRHQ  103 (108)
Q Consensus        76 ~~~~~c~~C~~~f~~~~~l~~H~~~h~~  103 (108)
                      .+ -.|..||..|.......+|+.+|-.
T Consensus       417 ~p-nqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  417 SP-NQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             Cc-chhcccccccccchhhhhHhhhhhh
Confidence            44 8999999999988888877776643


No 129
>KOG2482|consensus
Probab=42.62  E-value=16  Score=24.92  Aligned_cols=51  Identities=25%  Similarity=0.441  Sum_probs=35.7

Q ss_pred             eeeccchhhhccC-chHHHHHHhHHhc----------------------CCCCccCCCCccccCCchhHHHHHHH
Q psy3491          49 LFMCESCHKTYKA-KGSLERHKKFECG----------------------KEAGLQCPFCPYKSKHKSNLKTHMAI  100 (108)
Q Consensus        49 ~~~C~~c~~~f~~-~~~l~~h~~~~~~----------------------~~~~~~c~~C~~~f~~~~~l~~H~~~  100 (108)
                      ..+|-.|+..+.. .+....|+-.-++                      -.. +.|-.|.+.|.-+..|+.|+|.
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r-~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLER-LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhh-heeeeeccccCCcHHHHHHHHh
Confidence            4578888766653 4555556433222                      123 8899999999999999999984


No 130
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=42.11  E-value=9.4  Score=17.31  Aligned_cols=14  Identities=29%  Similarity=0.726  Sum_probs=8.8

Q ss_pred             ceeeccchhhhccC
Q psy3491          48 ALFMCESCHKTYKA   61 (108)
Q Consensus        48 ~~~~C~~c~~~f~~   61 (108)
                      -|+.|..|+..|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            47899999988854


No 131
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=41.09  E-value=10  Score=18.05  Aligned_cols=12  Identities=25%  Similarity=0.728  Sum_probs=6.3

Q ss_pred             cCCCCccccCCc
Q psy3491          80 QCPFCPYKSKHK   91 (108)
Q Consensus        80 ~c~~C~~~f~~~   91 (108)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999988643


No 132
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=40.89  E-value=23  Score=16.49  Aligned_cols=16  Identities=31%  Similarity=0.600  Sum_probs=6.2

Q ss_pred             eeccchhhhccCchHH
Q psy3491          50 FMCESCHKTYKAKGSL   65 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l   65 (108)
                      |.|-.|.......+.|
T Consensus        21 ykcfqcpftc~~kshl   36 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHL   36 (54)
T ss_pred             ceeecCCcccchHHHH
Confidence            3444443333333333


No 133
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=40.12  E-value=25  Score=16.72  Aligned_cols=14  Identities=29%  Similarity=0.786  Sum_probs=10.6

Q ss_pred             eeeccchhhhccCc
Q psy3491          49 LFMCESCHKTYKAK   62 (108)
Q Consensus        49 ~~~C~~c~~~f~~~   62 (108)
                      -+.|..||..|...
T Consensus        28 ~W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   28 WWKCPKCGHEWKAS   41 (55)
T ss_pred             EEECCCCCCeeEcc
Confidence            48899998777654


No 134
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=40.11  E-value=26  Score=15.12  Aligned_cols=21  Identities=19%  Similarity=0.475  Sum_probs=11.5

Q ss_pred             eeeccchhhhccCchHHHHHHh
Q psy3491          49 LFMCESCHKTYKAKGSLERHKK   70 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~   70 (108)
                      -+.|+.|++..... .+..|+.
T Consensus         4 ~~~C~nC~R~v~a~-RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAAS-RFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEGG-GHHHHHH
T ss_pred             eEECCCCcCCcchh-hhHHHHH
Confidence            36777777655443 3555544


No 135
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=39.51  E-value=33  Score=23.55  Aligned_cols=24  Identities=21%  Similarity=0.497  Sum_probs=19.1

Q ss_pred             eccchhhhccCchHHHHHHhHHhc
Q psy3491          51 MCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        51 ~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      .|..|...|-....|..|.+..+.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE  245 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE  245 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh
Confidence            488888888888888888876553


No 136
>PF12907 zf-met2:  Zinc-binding
Probab=38.71  E-value=7.9  Score=17.55  Aligned_cols=24  Identities=21%  Similarity=0.562  Sum_probs=11.6

Q ss_pred             eccchhhhccC---chHHHHHHhHHhc
Q psy3491          51 MCESCHKTYKA---KGSLERHKKFECG   74 (108)
Q Consensus        51 ~C~~c~~~f~~---~~~l~~h~~~~~~   74 (108)
                      .|..|...|..   ...|..|...-+.
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~enKHp   29 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAENKHP   29 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHHccCC
Confidence            46666644432   3345555544433


No 137
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.12  E-value=19  Score=20.34  Aligned_cols=27  Identities=22%  Similarity=0.477  Sum_probs=17.0

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      .+.|..||..|....            .....|+.||..
T Consensus        71 ~~~C~~Cg~~~~~~~------------~~~~~CP~Cgs~   97 (117)
T PRK00564         71 ELECKDCSHVFKPNA------------LDYGVCEKCHSK   97 (117)
T ss_pred             EEEhhhCCCccccCC------------ccCCcCcCCCCC
Confidence            488999996665432            121349989843


No 138
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=36.45  E-value=20  Score=17.83  Aligned_cols=12  Identities=25%  Similarity=0.941  Sum_probs=8.2

Q ss_pred             ccCCCCccccCC
Q psy3491          79 LQCPFCPYKSKH   90 (108)
Q Consensus        79 ~~c~~C~~~f~~   90 (108)
                      +.|+.||.....
T Consensus        47 ~~C~~Cg~~~~r   58 (69)
T PF07282_consen   47 FTCPNCGFEMDR   58 (69)
T ss_pred             EEcCCCCCEECc
Confidence            778778766543


No 139
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=36.07  E-value=16  Score=18.16  Aligned_cols=11  Identities=27%  Similarity=0.646  Sum_probs=3.8

Q ss_pred             eeccchhhhcc
Q psy3491          50 FMCESCHKTYK   60 (108)
Q Consensus        50 ~~C~~c~~~f~   60 (108)
                      -.|..|++.|.
T Consensus        10 ~~C~~C~~~F~   20 (69)
T PF01363_consen   10 SNCMICGKKFS   20 (69)
T ss_dssp             SB-TTT--B-B
T ss_pred             CcCcCcCCcCC
Confidence            35666666663


No 140
>PLN02294 cytochrome c oxidase subunit Vb
Probab=35.96  E-value=16  Score=22.24  Aligned_cols=17  Identities=18%  Similarity=0.618  Sum_probs=13.2

Q ss_pred             CCceeeccchhhhccCc
Q psy3491          46 QSALFMCESCHKTYKAK   62 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~   62 (108)
                      ..+|..|+.||..|.-.
T Consensus       138 kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        138 KGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCCceeCCCCCCEEEEE
Confidence            35688999999888654


No 141
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=34.80  E-value=13  Score=23.18  Aligned_cols=21  Identities=19%  Similarity=0.502  Sum_probs=0.0

Q ss_pred             CCCccCCCCc-cccCCchhHHHH
Q psy3491          76 EAGLQCPFCP-YKSKHKSNLKTH   97 (108)
Q Consensus        76 ~~~~~c~~C~-~~f~~~~~l~~H   97 (108)
                      .. |.|.+|| .+|.-+..+.+|
T Consensus       100 ~e-y~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen  100 VE-YKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             -----------------------
T ss_pred             Ce-eeeEeCCCcceecHHHHHHh
Confidence            44 7777776 344445555555


No 142
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=33.77  E-value=19  Score=19.75  Aligned_cols=15  Identities=20%  Similarity=0.483  Sum_probs=12.3

Q ss_pred             CceeeccchhhhccC
Q psy3491          47 SALFMCESCHKTYKA   61 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~   61 (108)
                      .++..|..||..|.-
T Consensus        77 g~~~rC~eCG~~fkL   91 (97)
T cd00924          77 GKPKRCPECGHVFKL   91 (97)
T ss_pred             CCceeCCCCCcEEEE
Confidence            368999999988864


No 143
>KOG1842|consensus
Probab=32.80  E-value=32  Score=24.37  Aligned_cols=26  Identities=23%  Similarity=0.345  Sum_probs=17.9

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECG   74 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~   74 (108)
                      -|.|+.|..-|...+.|..|....++
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcc
Confidence            47777777777777777777655443


No 144
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=31.51  E-value=40  Score=24.07  Aligned_cols=26  Identities=23%  Similarity=0.511  Sum_probs=21.9

Q ss_pred             ceeeccchhhhccCchHHHHHHhHHh
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKKFEC   73 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~~~~   73 (108)
                      +=+.|+.|.+.|.....+..|+...+
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhh
Confidence            35789999999999999999987543


No 145
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=31.43  E-value=23  Score=19.83  Aligned_cols=26  Identities=19%  Similarity=0.570  Sum_probs=16.4

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      ...|..||..|....            .. +.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDE------------FD-FSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHH------------CC-HH-SSSSSS
T ss_pred             cEECCCCCCEEecCC------------CC-CCCcCCcCC
Confidence            478999998886543            12 558888754


No 146
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=31.37  E-value=38  Score=15.92  Aligned_cols=8  Identities=38%  Similarity=1.182  Sum_probs=3.2

Q ss_pred             ccchhhhc
Q psy3491          52 CESCHKTY   59 (108)
Q Consensus        52 C~~c~~~f   59 (108)
                      |..|++.|
T Consensus         5 C~~C~~~F   12 (57)
T cd00065           5 CMGCGKPF   12 (57)
T ss_pred             CcccCccc
Confidence            33444333


No 147
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.24  E-value=17  Score=17.21  Aligned_cols=12  Identities=25%  Similarity=0.706  Sum_probs=7.0

Q ss_pred             cCCCCccccCCc
Q psy3491          80 QCPFCPYKSKHK   91 (108)
Q Consensus        80 ~c~~C~~~f~~~   91 (108)
                      -|++|++.|...
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            356666666544


No 148
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=30.61  E-value=18  Score=16.38  Aligned_cols=10  Identities=20%  Similarity=0.617  Sum_probs=4.9

Q ss_pred             eeeccchhhh
Q psy3491          49 LFMCESCHKT   58 (108)
Q Consensus        49 ~~~C~~c~~~   58 (108)
                      +-.|+.|+..
T Consensus        29 ~~~CpYCg~~   38 (40)
T PF10276_consen   29 PVVCPYCGTR   38 (40)
T ss_dssp             EEEETTTTEE
T ss_pred             eEECCCCCCE
Confidence            3455555543


No 149
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.58  E-value=6.9  Score=23.37  Aligned_cols=15  Identities=33%  Similarity=0.600  Sum_probs=10.3

Q ss_pred             ceeeccchhhhccCc
Q psy3491          48 ALFMCESCHKTYKAK   62 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~   62 (108)
                      .|.-|..||+.|++.
T Consensus        67 ~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   67 APSYCHNCGKPYPWT   81 (158)
T ss_pred             CChhHHhCCCCCchH
Confidence            466677777777764


No 150
>KOG3014|consensus
Probab=30.50  E-value=45  Score=21.73  Aligned_cols=32  Identities=22%  Similarity=0.368  Sum_probs=23.4

Q ss_pred             ccCCCcee---eccchhhhccC--chHHHHHHhHHhc
Q psy3491          43 KPLQSALF---MCESCHKTYKA--KGSLERHKKFECG   74 (108)
Q Consensus        43 ~~~~~~~~---~C~~c~~~f~~--~~~l~~h~~~~~~   74 (108)
                      ...|.+-|   .|..||..|..  ..+...|.+.|+.
T Consensus        28 ld~Gqk~fg~~~C~~Cgm~Yt~~s~EDe~~H~~fH~~   64 (257)
T KOG3014|consen   28 LDAGQKDFGAVKCKECGMKYTVTSPEDEALHEKFHNR   64 (257)
T ss_pred             eecCccccCceehhhcCceecCCCHHHHHHHHHHHHh
Confidence            34566555   79999998875  4567779888874


No 151
>COG1773 Rubredoxin [Energy production and conversion]
Probab=30.06  E-value=20  Score=17.50  Aligned_cols=14  Identities=21%  Similarity=0.672  Sum_probs=11.2

Q ss_pred             eeeccchhhhccCc
Q psy3491          49 LFMCESCHKTYKAK   62 (108)
Q Consensus        49 ~~~C~~c~~~f~~~   62 (108)
                      .|+|..||..|...
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            48899999888654


No 152
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=29.83  E-value=26  Score=15.47  Aligned_cols=12  Identities=25%  Similarity=0.827  Sum_probs=6.5

Q ss_pred             ceeeccchhhhc
Q psy3491          48 ALFMCESCHKTY   59 (108)
Q Consensus        48 ~~~~C~~c~~~f   59 (108)
                      +-|.|..||+..
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            358899998764


No 153
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1842|consensus
Probab=29.51  E-value=34  Score=24.27  Aligned_cols=26  Identities=27%  Similarity=0.636  Sum_probs=22.9

Q ss_pred             ccCCCCccccCCchhHHHHHHHhcCC
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAIRHQN  104 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~h~~~  104 (108)
                      |.|+.|..-|.....|..|...-|.+
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhccc
Confidence            99999999999999999998765554


No 155
>PLN02748 tRNA dimethylallyltransferase
Probab=28.40  E-value=48  Score=23.68  Aligned_cols=23  Identities=13%  Similarity=0.264  Sum_probs=18.7

Q ss_pred             CCCccCCCCcc-ccCCchhHHHHHH
Q psy3491          76 EAGLQCPFCPY-KSKHKSNLKTHMA   99 (108)
Q Consensus        76 ~~~~~c~~C~~-~f~~~~~l~~H~~   99 (108)
                      +. |.|+.|++ ++.....+..|+.
T Consensus       417 ~~-~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQ-YVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             cc-ccccCCCCcccCCHHHHHHHhc
Confidence            44 88999997 7888888888875


No 156
>PHA02998 RNA polymerase subunit; Provisional
Probab=27.88  E-value=20  Score=22.07  Aligned_cols=38  Identities=16%  Similarity=0.238  Sum_probs=21.8

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCC---ccCCCCccccCCc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAG---LQCPFCPYKSKHK   91 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~---~~c~~C~~~f~~~   91 (108)
                      -.|+.|+..=.....    +++...++++   |.|..||..|..+
T Consensus       144 v~CPkCg~~~A~f~q----lQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPMM----IQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEEE----EeeccCCCCceEEEEcCCCCCccCCc
Confidence            578888744333322    2233334443   7899999887654


No 157
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=27.81  E-value=21  Score=25.39  Aligned_cols=41  Identities=15%  Similarity=0.360  Sum_probs=23.0

Q ss_pred             CCceeeccchhhhccCchHHHHH-Hh----HHhcCCCCccCCCCccc
Q psy3491          46 QSALFMCESCHKTYKAKGSLERH-KK----FECGKEAGLQCPFCPYK   87 (108)
Q Consensus        46 ~~~~~~C~~c~~~f~~~~~l~~h-~~----~~~~~~~~~~c~~C~~~   87 (108)
                      ....|.|..||..|.....-... ..    ...--.. +.|++|+..
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~-~~cp~c~~~  467 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDN-FLCPECSLG  467 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCC-CcCcCCCCc
Confidence            34579999999988764211110 00    1011123 899999843


No 158
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=26.71  E-value=37  Score=19.59  Aligned_cols=14  Identities=14%  Similarity=0.399  Sum_probs=11.2

Q ss_pred             CCCCccCCCCccccC
Q psy3491          75 KEAGLQCPFCPYKSK   89 (108)
Q Consensus        75 ~~~~~~c~~C~~~f~   89 (108)
                      ... |.|..|++.|.
T Consensus        51 ~qR-yrC~~C~~tf~   64 (129)
T COG3677          51 HQR-YKCKSCGSTFT   64 (129)
T ss_pred             ccc-cccCCcCccee
Confidence            455 99999999875


No 159
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=26.63  E-value=33  Score=16.31  Aligned_cols=12  Identities=25%  Similarity=0.733  Sum_probs=8.3

Q ss_pred             ccCCCCccccCC
Q psy3491          79 LQCPFCPYKSKH   90 (108)
Q Consensus        79 ~~c~~C~~~f~~   90 (108)
                      |.|..||..+..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            677778776653


No 160
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=26.25  E-value=25  Score=16.45  Aligned_cols=36  Identities=22%  Similarity=0.531  Sum_probs=17.7

Q ss_pred             eeccchhhhccCchHHHHH-----HhHHhcCCCCccCCCCcc
Q psy3491          50 FMCESCHKTYKAKGSLERH-----KKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h-----~~~~~~~~~~~~c~~C~~   86 (108)
                      |.|..||..+.....-..+     .....--.. +.|++|+.
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~-w~CP~C~a   42 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDD-WVCPVCGA   42 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS-TT--B-TTTSS
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCC-CcCcCCCC
Confidence            7899999888654321100     111111233 89999974


No 161
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=26.21  E-value=43  Score=20.55  Aligned_cols=32  Identities=28%  Similarity=0.767  Sum_probs=19.3

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcccc
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKS   88 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f   88 (108)
                      ..-|.|+.|...++...      .+..+    |.|+.||...
T Consensus       111 ~~~y~C~~~~~r~sfde------A~~~~----F~Cp~Cg~~L  142 (176)
T COG1675         111 NNYYVCPNCHVKYSFDE------AMELG----FTCPKCGEDL  142 (176)
T ss_pred             CCceeCCCCCCcccHHH------HHHhC----CCCCCCCchh
Confidence            33488887776654433      22222    8899998653


No 162
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=26.01  E-value=41  Score=23.16  Aligned_cols=28  Identities=18%  Similarity=0.438  Sum_probs=19.4

Q ss_pred             hHHhcCCCCccCCCCc-cccCCchhHHHHH
Q psy3491          70 KFECGKEAGLQCPFCP-YKSKHKSNLKTHM   98 (108)
Q Consensus        70 ~~~~~~~~~~~c~~C~-~~f~~~~~l~~H~   98 (108)
                      +.|.-++. |.|.+|| .++.-+..+.+|-
T Consensus       367 klhgLd~e-f~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         367 KLHGLDIE-FECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HhcCCCcc-eeeeecccccccchHHHHhhh
Confidence            34444566 9999998 7777777777664


No 163
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=25.14  E-value=24  Score=19.13  Aligned_cols=28  Identities=18%  Similarity=0.497  Sum_probs=19.1

Q ss_pred             CceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCc
Q psy3491          47 SALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCP   85 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~   85 (108)
                      ..|-.|..||..|....           .+.|-.|+.|.
T Consensus        56 v~Pa~CkkCGfef~~~~-----------ik~pSRCP~CK   83 (97)
T COG3357          56 VRPARCKKCGFEFRDDK-----------IKKPSRCPKCK   83 (97)
T ss_pred             ecChhhcccCccccccc-----------cCCcccCCcch
Confidence            45789999998886621           12237888774


No 164
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=25.05  E-value=29  Score=20.32  Aligned_cols=16  Identities=25%  Similarity=0.553  Sum_probs=12.9

Q ss_pred             CceeeccchhhhccCc
Q psy3491          47 SALFMCESCHKTYKAK   62 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~   62 (108)
                      .++..|..||..|.-.
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            4589999999988654


No 165
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.04  E-value=29  Score=17.35  Aligned_cols=40  Identities=18%  Similarity=0.496  Sum_probs=23.7

Q ss_pred             CCCceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccC
Q psy3491          45 LQSALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSK   89 (108)
Q Consensus        45 ~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~   89 (108)
                      .+..++.|..-+..+.....+   +.+  ++.....|++|+..|.
T Consensus        20 ~~~~~l~C~g~~~p~~HPrV~---L~m--g~~gev~CPYC~t~y~   59 (62)
T COG4391          20 IGDLPLMCPGPEPPNDHPRVF---LDM--GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             eCCeeEEcCCCCCCCCCCEEE---EEc--CCCCcEecCccccEEE
Confidence            466788887665555443222   122  2233388999998875


No 166
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=24.66  E-value=58  Score=15.27  Aligned_cols=8  Identities=38%  Similarity=1.223  Sum_probs=3.5

Q ss_pred             ccCCCCcc
Q psy3491          79 LQCPFCPY   86 (108)
Q Consensus        79 ~~c~~C~~   86 (108)
                      +.|++|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            88888865


No 167
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=24.66  E-value=71  Score=15.19  Aligned_cols=33  Identities=27%  Similarity=0.590  Sum_probs=19.3

Q ss_pred             eeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccc
Q psy3491          50 FMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYK   87 (108)
Q Consensus        50 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~   87 (108)
                      -.|..|+...+... +   .....++.. ..|+.||+.
T Consensus        23 ~~C~gC~~~l~~~~-~---~~i~~~~~i-~~Cp~CgRi   55 (56)
T PF02591_consen   23 GTCSGCHMELPPQE-L---NEIRKGDEI-VFCPNCGRI   55 (56)
T ss_pred             CccCCCCEEcCHHH-H---HHHHcCCCe-EECcCCCcc
Confidence            36777775554432 2   222333455 889999875


No 168
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=24.61  E-value=66  Score=20.16  Aligned_cols=10  Identities=20%  Similarity=0.551  Sum_probs=5.1

Q ss_pred             ccCCCCcccc
Q psy3491          79 LQCPFCPYKS   88 (108)
Q Consensus        79 ~~c~~C~~~f   88 (108)
                      +.|..||..+
T Consensus        31 vrC~eCG~V~   40 (201)
T COG1326          31 VRCEECGTVH   40 (201)
T ss_pred             EEccCCCcEe
Confidence            5555555443


No 169
>PRK04351 hypothetical protein; Provisional
Probab=23.84  E-value=44  Score=19.83  Aligned_cols=32  Identities=31%  Similarity=0.618  Sum_probs=20.9

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccC
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSK   89 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~   89 (108)
                      .|.|..||..+...       +.+ +... |.|..|+..+.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~-yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKR-YRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCc-EEeCCCCcEee
Confidence            58899898666432       222 2355 99999986654


No 170
>KOG1280|consensus
Probab=23.13  E-value=90  Score=21.51  Aligned_cols=38  Identities=18%  Similarity=0.431  Sum_probs=25.3

Q ss_pred             ceeeccchhhhccCchHHHHHHhHHhcCCC-CccCCCCc
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKKFECGKEA-GLQCPFCP   85 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~-~~~c~~C~   85 (108)
                      ..|.|+.|+..=.+...|..|....+.+-. ...|++|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            368888888877777788888665444322 25566665


No 171
>COG2879 Uncharacterized small protein [Function unknown]
Probab=23.12  E-value=1e+02  Score=15.56  Aligned_cols=18  Identities=22%  Similarity=0.272  Sum_probs=12.4

Q ss_pred             CchhHHHHHHHhcCCCCC
Q psy3491          90 HKSNLKTHMAIRHQNGLH  107 (108)
Q Consensus        90 ~~~~l~~H~~~h~~~k~~  107 (108)
                      .-++.-.|++.+|..+|.
T Consensus        24 dYdnYVehmr~~hPd~p~   41 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             cHHHHHHHHHHhCcCCCc
Confidence            345667788888877763


No 172
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=23.06  E-value=35  Score=22.15  Aligned_cols=7  Identities=43%  Similarity=1.042  Sum_probs=3.3

Q ss_pred             eeccchh
Q psy3491          50 FMCESCH   56 (108)
Q Consensus        50 ~~C~~c~   56 (108)
                      -.|.+||
T Consensus       191 ~VCeVCG  197 (254)
T PF03194_consen  191 EVCEVCG  197 (254)
T ss_pred             cchhhhh
Confidence            3444554


No 173
>PF12773 DZR:  Double zinc ribbon
Probab=22.94  E-value=60  Score=14.83  Aligned_cols=9  Identities=33%  Similarity=0.774  Sum_probs=5.2

Q ss_pred             ccCCCCccc
Q psy3491          79 LQCPFCPYK   87 (108)
Q Consensus        79 ~~c~~C~~~   87 (108)
                      ..|+.|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            556666554


No 174
>PTZ00448 hypothetical protein; Provisional
Probab=22.81  E-value=66  Score=22.28  Aligned_cols=22  Identities=23%  Similarity=0.422  Sum_probs=17.3

Q ss_pred             ccCCCCccccCCchhHHHHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTHMAI  100 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H~~~  100 (108)
                      |.|..|+-.|......+.|.++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            7899999999877777777653


No 175
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=22.65  E-value=17  Score=15.87  Aligned_cols=10  Identities=20%  Similarity=0.637  Sum_probs=4.1

Q ss_pred             ccCCCCcccc
Q psy3491          79 LQCPFCPYKS   88 (108)
Q Consensus        79 ~~c~~C~~~f   88 (108)
                      ..|..||..+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            5566666543


No 176
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=22.32  E-value=22  Score=20.77  Aligned_cols=31  Identities=23%  Similarity=0.627  Sum_probs=18.8

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcccc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKS   88 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f   88 (108)
                      .|.|..|+..+...      .+.  .... |.|..|+..|
T Consensus       123 ~~~C~~C~~~~~r~------~~~--~~~~-~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKRH------RRS--KRKR-YRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeeee------ccc--chhh-EECCCCCCEE
Confidence            57888888665332      222  2234 7888887554


No 177
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.29  E-value=39  Score=19.29  Aligned_cols=31  Identities=23%  Similarity=0.429  Sum_probs=17.8

Q ss_pred             eeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCcc
Q psy3491          49 LFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPY   86 (108)
Q Consensus        49 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~   86 (108)
                      ...| .||..|.....-..+      ..+.+.|+.||.
T Consensus        70 ~~~C-~Cg~~~~~~~~~~~~------~~~~~~CP~Cgs  100 (124)
T PRK00762         70 EIEC-ECGYEGVVDEDEIDH------YAAVIECPVCGN  100 (124)
T ss_pred             eEEe-eCcCcccccccchhc------cccCCcCcCCCC
Confidence            5889 999777654210011      011267999984


No 178
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=22.23  E-value=12  Score=17.96  Aligned_cols=23  Identities=17%  Similarity=0.456  Sum_probs=11.6

Q ss_pred             CceeeccchhhhccCchHHHHHH
Q psy3491          47 SALFMCESCHKTYKAKGSLERHK   69 (108)
Q Consensus        47 ~~~~~C~~c~~~f~~~~~l~~h~   69 (108)
                      ...|.|+.|+..|=..=++-.|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE   41 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHE   41 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTT
T ss_pred             CCeEECCCCCCccccCcChhhhc
Confidence            34699999998887766654443


No 179
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.40  E-value=42  Score=14.61  Aligned_cols=14  Identities=21%  Similarity=0.527  Sum_probs=7.1

Q ss_pred             eeccchhhhccCch
Q psy3491          50 FMCESCHKTYKAKG   63 (108)
Q Consensus        50 ~~C~~c~~~f~~~~   63 (108)
                      -.|..|++.|..+.
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            46888888887654


No 180
>KOG1994|consensus
Probab=21.39  E-value=61  Score=20.88  Aligned_cols=23  Identities=35%  Similarity=0.586  Sum_probs=18.7

Q ss_pred             cCCCCccCCCCccccCCchhHHHH
Q psy3491          74 GKEAGLQCPFCPYKSKHKSNLKTH   97 (108)
Q Consensus        74 ~~~~~~~c~~C~~~f~~~~~l~~H   97 (108)
                      .... |-|-.||-.|.....|..|
T Consensus       236 R~eh-~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  236 RSEH-YYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             hccc-eEEEEeccccCCHHHHHHh
Confidence            3455 8999999999998888776


No 181
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.18  E-value=45  Score=21.84  Aligned_cols=15  Identities=20%  Similarity=0.740  Sum_probs=9.7

Q ss_pred             CCCccCCCCccccCCc
Q psy3491          76 EAGLQCPFCPYKSKHK   91 (108)
Q Consensus        76 ~~~~~c~~C~~~f~~~   91 (108)
                      +. +.|+.||..+...
T Consensus       321 r~-~~C~~cg~~~~rD  335 (364)
T COG0675         321 RL-FKCPRCGFVHDRD  335 (364)
T ss_pred             ee-EECCCCCCeehhh
Confidence            44 7888888765443


No 182
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=20.88  E-value=29  Score=26.23  Aligned_cols=6  Identities=17%  Similarity=0.263  Sum_probs=3.1

Q ss_pred             cCCCCC
Q psy3491          13 VDPVCP   18 (108)
Q Consensus        13 ~~~~c~   18 (108)
                      .|..|.
T Consensus       437 ~C~~Cg  442 (730)
T COG1198         437 LCRDCG  442 (730)
T ss_pred             ecccCC
Confidence            455554


No 183
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=20.36  E-value=38  Score=15.00  Aligned_cols=13  Identities=23%  Similarity=0.774  Sum_probs=9.7

Q ss_pred             eeeccchhhhccC
Q psy3491          49 LFMCESCHKTYKA   61 (108)
Q Consensus        49 ~~~C~~c~~~f~~   61 (108)
                      -+.|+.||..+..
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            3689999987643


No 184
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=20.32  E-value=35  Score=18.80  Aligned_cols=34  Identities=21%  Similarity=0.438  Sum_probs=17.9

Q ss_pred             ceeeccchhhhccCchHHHHHHhHHhcCCCCccCCCCccccC
Q psy3491          48 ALFMCESCHKTYKAKGSLERHKKFECGKEAGLQCPFCPYKSK   89 (108)
Q Consensus        48 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~c~~C~~~f~   89 (108)
                      .-|.|+.|+.. ...-.+.      .+ +....|..||..+.
T Consensus        20 t~f~CP~Cge~-~v~v~~~------k~-~~h~~C~~CG~y~~   53 (99)
T PRK14892         20 KIFECPRCGKV-SISVKIK------KN-IAIITCGNCGLYTE   53 (99)
T ss_pred             cEeECCCCCCe-EeeeecC------CC-cceEECCCCCCccC
Confidence            46888888832 1111111      12 22377888876543


No 185
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=20.30  E-value=60  Score=15.86  Aligned_cols=11  Identities=36%  Similarity=0.932  Sum_probs=5.9

Q ss_pred             cCCCCccccCC
Q psy3491          80 QCPFCPYKSKH   90 (108)
Q Consensus        80 ~c~~C~~~f~~   90 (108)
                      .|+.|++.|..
T Consensus        41 gCPfC~~~~~~   51 (55)
T PF14447_consen   41 GCPFCGTPFEF   51 (55)
T ss_pred             CCCCCCCcccC
Confidence            45566655543


No 186
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=20.08  E-value=77  Score=19.33  Aligned_cols=19  Identities=11%  Similarity=0.252  Sum_probs=14.8

Q ss_pred             ccCCCCccccCCchhHHHH
Q psy3491          79 LQCPFCPYKSKHKSNLKTH   97 (108)
Q Consensus        79 ~~c~~C~~~f~~~~~l~~H   97 (108)
                      ..|..||+.|.....+..-
T Consensus       115 ~~C~~Cg~~f~~~k~i~~~  133 (181)
T PRK08222        115 QRCSRCERPFAPQKTVALA  133 (181)
T ss_pred             CcCcccCCccCcHhHHHHH
Confidence            8899999999876655443


Done!