Query         psy3507
Match_columns 134
No_of_seqs    294 out of 1805
Neff          10.2
Searched_HMMs 46136
Date          Fri Aug 16 18:26:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3507.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3507hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 1.3E-28 2.7E-33  164.0   5.8  114   18-131   129-264 (279)
  2 KOG2462|consensus               99.9 1.2E-27 2.5E-32  159.3   6.4   98   35-134   128-239 (279)
  3 KOG1074|consensus               99.8 1.2E-19 2.7E-24  135.7   2.1   81   54-134   605-692 (958)
  4 KOG3608|consensus               99.7 4.6E-19 9.9E-24  122.1   2.5  107   26-134   196-316 (467)
  5 KOG3576|consensus               99.7 1.6E-18 3.5E-23  111.4   1.8   77   54-130   117-193 (267)
  6 KOG3576|consensus               99.7 4.3E-18 9.3E-23  109.5   1.8  100   34-133   114-235 (267)
  7 KOG1074|consensus               99.7 8.7E-18 1.9E-22  126.0   2.6   52   83-134   880-931 (958)
  8 KOG3623|consensus               99.7 6.6E-18 1.4E-22  125.2   1.2   82   50-131   890-971 (1007)
  9 KOG3623|consensus               99.6 3.8E-17 8.3E-22  121.2   0.8   94   38-131   211-330 (1007)
 10 KOG3608|consensus               99.5 1.8E-14   4E-19   99.6   2.8   81   49-130   287-372 (467)
 11 PHA00733 hypothetical protein   99.3 8.3E-13 1.8E-17   81.2   3.2   79   52-132    38-121 (128)
 12 PLN03086 PRLI-interacting fact  99.3 7.4E-12 1.6E-16   92.8   7.8   73   43-120   441-514 (567)
 13 PLN03086 PRLI-interacting fact  99.2 6.4E-11 1.4E-15   87.9   8.5  102   25-130   441-560 (567)
 14 PHA02768 hypothetical protein;  99.2 5.6E-12 1.2E-16   65.3   1.0   43   54-98      5-47  (55)
 15 PHA00733 hypothetical protein   99.1 5.3E-11 1.1E-15   73.2   3.4   72   34-107    37-124 (128)
 16 PHA02768 hypothetical protein;  99.1 4.5E-11 9.8E-16   61.9   2.2   43   82-126     5-47  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.8E-10 3.8E-15   51.3   1.8   24   98-121     2-25  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.9E-09 4.1E-14   48.0   2.8   26   69-94      1-26  (26)
 19 KOG3993|consensus               98.8 7.6E-10 1.6E-14   78.6   0.1   24  110-133   356-379 (500)
 20 PHA00732 hypothetical protein   98.7 6.2E-09 1.3E-13   58.6   2.2   48   54-107     1-49  (79)
 21 KOG3993|consensus               98.7 7.4E-09 1.6E-13   73.7   1.0  120   12-131   260-479 (500)
 22 PHA00616 hypothetical protein   98.6 8.9E-09 1.9E-13   50.9   0.9   32   55-86      2-33  (44)
 23 PHA00616 hypothetical protein   98.6 2.8E-08   6E-13   49.2   1.6   34   82-115     1-34  (44)
 24 PHA00732 hypothetical protein   98.5 9.2E-08   2E-12   53.9   3.1   46   82-133     1-47  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  98.5   6E-08 1.3E-12   41.8   1.8   23  111-133     1-23  (23)
 26 PF05605 zf-Di19:  Drought indu  98.3 9.3E-07   2E-11   46.3   3.8   47   83-132     3-51  (54)
 27 PF12756 zf-C2H2_2:  C2H2 type   98.3 4.8E-07   1E-11   53.1   2.6   73   56-133     1-73  (100)
 28 PF05605 zf-Di19:  Drought indu  98.3 1.7E-06 3.6E-11   45.3   4.1   50   54-106     2-53  (54)
 29 PF00096 zf-C2H2:  Zinc finger,  98.3   1E-06 2.2E-11   37.8   2.4   22   55-76      1-22  (23)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.2 6.7E-07 1.4E-11   39.9   1.6   24  110-133     1-24  (27)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.1E-06 2.5E-11   37.8   2.1   23  111-133     1-23  (24)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.3E-05 2.8E-10   34.3   2.7   23   55-77      1-23  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.9 7.9E-06 1.7E-10   36.4   1.7   24   82-105     1-24  (27)
 34 COG5189 SFP1 Putative transcri  97.9 3.4E-06 7.4E-11   58.5   0.6   52   80-131   347-419 (423)
 35 smart00355 ZnF_C2H2 zinc finge  97.8 1.6E-05 3.4E-10   34.6   2.2   23  111-133     1-23  (26)
 36 PF12874 zf-met:  Zinc-finger o  97.6 4.9E-05 1.1E-09   33.0   1.5   23  111-133     1-23  (25)
 37 COG5189 SFP1 Putative transcri  97.6 2.8E-05 6.2E-10   54.1   1.0   54   50-103   345-419 (423)
 38 PRK04860 hypothetical protein;  97.4 0.00013 2.9E-09   46.5   2.5   38   82-123   119-156 (160)
 39 PF09237 GAGA:  GAGA factor;  I  97.4 0.00018 3.8E-09   36.5   2.3   27   81-107    23-49  (54)
 40 smart00355 ZnF_C2H2 zinc finge  97.4 0.00025 5.5E-09   30.6   2.6   22   56-77      2-23  (26)
 41 PF12874 zf-met:  Zinc-finger o  97.2 0.00022 4.7E-09   30.9   1.3   21   83-103     1-21  (25)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  97.1 0.00012 2.5E-09   32.5  -0.1   21  111-131     2-22  (27)
 43 PF09237 GAGA:  GAGA factor;  I  97.1  0.0012 2.5E-08   33.6   3.3   33   50-82     20-52  (54)
 44 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00061 1.3E-08   29.2   1.9   22  111-133     1-22  (24)
 45 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00095 2.1E-08   28.6   2.3   22   55-77      1-22  (24)
 46 PRK04860 hypothetical protein;  96.9 0.00086 1.9E-08   42.9   2.4   39   53-95    118-156 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00066 1.4E-08   30.0   0.9   22   83-104     2-23  (27)
 48 TIGR00622 ssl1 transcription f  96.7  0.0037 7.9E-08   37.4   4.1   89   38-133     2-104 (112)
 49 PF13913 zf-C2HC_2:  zinc-finge  96.7  0.0015 3.2E-08   28.4   1.8   21  111-132     3-23  (25)
 50 PF12756 zf-C2H2_2:  C2H2 type   96.6   0.003 6.6E-08   36.6   3.3   23   82-104    50-72  (100)
 51 smart00451 ZnF_U1 U1-like zinc  96.1  0.0053 1.2E-07   28.6   1.9   22  110-131     3-24  (35)
 52 KOG2893|consensus               96.0  0.0027 5.8E-08   42.9   0.9   48   55-106    11-59  (341)
 53 PRK14890 putative Zn-ribbon RN  95.9   0.012 2.7E-07   30.9   2.8   10   81-90     47-56  (59)
 54 COG2888 Predicted Zn-ribbon RN  95.2   0.018 3.8E-07   30.3   2.0   47   39-90     11-58  (61)
 55 smart00451 ZnF_U1 U1-like zinc  95.1   0.021 4.6E-07   26.5   2.0   22   54-75      3-24  (35)
 56 PRK00398 rpoP DNA-directed RNA  95.0    0.02 4.4E-07   28.6   1.9   28   37-64      3-31  (46)
 57 KOG2231|consensus               94.9   0.063 1.4E-06   41.7   5.0   91   38-133   100-205 (669)
 58 COG5236 Uncharacterized conser  94.8  0.0058 1.3E-07   43.4  -0.7   76   54-131   151-241 (493)
 59 cd00350 rubredoxin_like Rubred  94.7   0.024 5.3E-07   26.3   1.6    9  109-117    16-24  (33)
 60 COG4049 Uncharacterized protei  94.6   0.026 5.7E-07   29.2   1.6   25   79-103    14-38  (65)
 61 PF09538 FYDLN_acid:  Protein o  94.5   0.029 6.3E-07   33.5   2.0   30   38-67     10-39  (108)
 62 COG5048 FOG: Zn-finger [Genera  94.3   0.012 2.6E-07   42.7  -0.0   63   53-115   288-356 (467)
 63 COG5048 FOG: Zn-finger [Genera  94.2  0.0087 1.9E-07   43.4  -0.9   54   81-134   288-347 (467)
 64 smart00659 RPOLCX RNA polymera  94.2   0.045 9.7E-07   27.2   1.9   26   38-63      3-28  (44)
 65 PF13717 zinc_ribbon_4:  zinc-r  94.1   0.052 1.1E-06   25.7   2.0   10   39-48      4-13  (36)
 66 PF03604 DNA_RNApol_7kD:  DNA d  94.0    0.05 1.1E-06   25.1   1.7   26   38-63      1-26  (32)
 67 KOG2893|consensus               94.0   0.011 2.4E-07   39.9  -0.6   42   84-129    12-53  (341)
 68 COG2888 Predicted Zn-ribbon RN  93.9    0.13 2.7E-06   27.1   3.3   41   21-61     11-57  (61)
 69 TIGR02098 MJ0042_CXXC MJ0042 f  93.9   0.054 1.2E-06   25.8   1.9   10   39-48      4-13  (38)
 70 PRK14890 putative Zn-ribbon RN  93.9    0.14 3.1E-06   27.0   3.5   10   37-46     25-34  (59)
 71 KOG1146|consensus               93.7    0.02 4.3E-07   47.2   0.1   70   53-132   464-540 (1406)
 72 PF13719 zinc_ribbon_5:  zinc-r  93.5   0.068 1.5E-06   25.5   1.8   10   83-92     26-35  (37)
 73 cd00729 rubredoxin_SM Rubredox  92.9   0.082 1.8E-06   24.7   1.5   24   38-62      3-26  (34)
 74 KOG2186|consensus               92.8   0.084 1.8E-06   36.1   2.0   51   54-107     3-53  (276)
 75 PF10571 UPF0547:  Uncharacteri  92.6    0.11 2.4E-06   22.7   1.6    9   56-64     16-24  (26)
 76 PF09723 Zn-ribbon_8:  Zinc rib  92.5   0.093   2E-06   25.7   1.5   25   38-62      6-34  (42)
 77 KOG1146|consensus               92.4   0.038 8.2E-07   45.7   0.0   19  113-131  1331-1349(1406)
 78 PF07754 DUF1610:  Domain of un  92.4    0.15 3.2E-06   21.8   1.8    8   54-61     16-23  (24)
 79 smart00834 CxxC_CXXC_SSSS Puta  92.4    0.11 2.4E-06   25.0   1.7   25   38-62      6-34  (41)
 80 TIGR02300 FYDLN_acid conserved  92.3    0.11 2.5E-06   31.7   1.9   34   38-71     10-43  (129)
 81 KOG2907|consensus               92.0    0.13 2.8E-06   30.7   1.9   30   19-48      7-36  (116)
 82 KOG2482|consensus               91.7     0.2 4.3E-06   35.9   2.8   79   54-132   195-356 (423)
 83 PRK00464 nrdR transcriptional   91.5    0.12 2.6E-06   32.9   1.5   13   55-67     29-41  (154)
 84 TIGR00622 ssl1 transcription f  91.2    0.42 9.1E-06   28.7   3.5   49   56-106    57-105 (112)
 85 KOG2231|consensus               91.1    0.29 6.2E-06   38.2   3.5   71   55-133   183-262 (669)
 86 PF09986 DUF2225:  Uncharacteri  91.1   0.079 1.7E-06   35.6   0.4   12  111-122    49-60  (214)
 87 PF08274 PhnA_Zn_Ribbon:  PhnA   90.7    0.16 3.5E-06   23.0   1.1   24   39-62      4-27  (30)
 88 TIGR02605 CxxC_CxxC_SSSS putat  90.6    0.18 3.9E-06   25.7   1.5   11   38-48      6-16  (52)
 89 PF09986 DUF2225:  Uncharacteri  90.4    0.27 5.8E-06   33.1   2.5   14   35-48      3-16  (214)
 90 KOG4173|consensus               90.1    0.11 2.5E-06   34.4   0.5   73   55-130    80-166 (253)
 91 PF02892 zf-BED:  BED zinc fing  90.1    0.31 6.7E-06   23.9   2.0   22  109-130    15-40  (45)
 92 COG4049 Uncharacterized protei  90.0    0.19 4.1E-06   26.1   1.2   29   49-77     12-40  (65)
 93 PF14353 CpXC:  CpXC protein     89.6    0.28 6.1E-06   30.1   2.0   10   39-48      3-12  (128)
 94 PHA00626 hypothetical protein   89.5    0.42 9.1E-06   24.9   2.2   11   54-64     23-33  (59)
 95 COG5151 SSL1 RNA polymerase II  89.3     0.4 8.7E-06   33.9   2.7   91   38-133   309-411 (421)
 96 COG1592 Rubrerythrin [Energy p  89.0    0.28 6.2E-06   31.6   1.7   24   37-62    134-157 (166)
 97 TIGR00373 conserved hypothetic  88.9    0.52 1.1E-05   30.2   2.9   31   80-119   107-137 (158)
 98 smart00531 TFIIE Transcription  88.4    0.48   1E-05   29.9   2.4   36   53-92     98-133 (147)
 99 PF00301 Rubredoxin:  Rubredoxi  87.8    0.34 7.3E-06   24.4   1.2   11   38-48      2-12  (47)
100 smart00614 ZnF_BED BED zinc fi  87.1    0.38 8.3E-06   24.4   1.2   21  111-131    19-44  (50)
101 cd00730 rubredoxin Rubredoxin;  86.8    0.42   9E-06   24.4   1.2   11   38-48      2-12  (50)
102 COG1996 RPC10 DNA-directed RNA  86.7    0.48   1E-05   24.1   1.4   28   36-63      5-33  (49)
103 COG1198 PriA Primosomal protei  86.7     0.5 1.1E-05   37.5   2.1   40   20-63    445-484 (730)
104 COG1997 RPL43A Ribosomal prote  86.7    0.39 8.4E-06   27.4   1.1   30   37-66     35-65  (89)
105 PRK00432 30S ribosomal protein  86.4    0.62 1.4E-05   23.8   1.7   24   40-63     23-46  (50)
106 TIGR00373 conserved hypothetic  86.2    0.61 1.3E-05   29.9   2.0   32   52-92    107-138 (158)
107 PRK06266 transcription initiat  85.7    0.83 1.8E-05   29.9   2.5   30   81-119   116-145 (178)
108 PF05443 ROS_MUCR:  ROS/MUCR tr  85.7    0.56 1.2E-05   29.1   1.6   23  108-133    70-92  (132)
109 TIGR00595 priA primosomal prot  85.6    0.61 1.3E-05   35.5   2.1   39   21-63    224-262 (505)
110 KOG2785|consensus               85.5       1 2.2E-05   32.8   3.0   78   54-131     3-89  (390)
111 PF02176 zf-TRAF:  TRAF-type zi  85.5    0.88 1.9E-05   23.7   2.1   40   81-121     8-53  (60)
112 PRK06266 transcription initiat  85.2    0.56 1.2E-05   30.7   1.5   31   53-92    116-146 (178)
113 COG1773 Rubredoxin [Energy pro  84.9    0.58 1.3E-05   24.3   1.2   12   37-48      3-14  (55)
114 smart00531 TFIIE Transcription  84.8     2.4 5.3E-05   26.7   4.2   38   79-120    96-133 (147)
115 TIGR00686 phnA alkylphosphonat  83.7     0.8 1.7E-05   27.2   1.6   30   39-68      4-33  (109)
116 PRK03824 hypA hydrogenase nick  83.5    0.78 1.7E-05   28.6   1.5   11   38-48     71-81  (135)
117 KOG4167|consensus               83.4    0.37 8.1E-06   37.9   0.1   24  110-133   792-815 (907)
118 KOG2807|consensus               83.4     2.1 4.6E-05   30.6   3.8   34   37-73    276-309 (378)
119 PRK09678 DNA-binding transcrip  83.3    0.34 7.3E-06   26.8  -0.1   41   55-97      2-44  (72)
120 smart00734 ZnF_Rad18 Rad18-lik  83.0     1.3 2.9E-05   19.2   1.8   19  112-131     3-21  (26)
121 PRK10220 hypothetical protein;  82.9     1.1 2.5E-05   26.6   2.0   30   39-68      5-34  (111)
122 TIGR01206 lysW lysine biosynth  82.9     1.1 2.4E-05   23.3   1.7   11   38-48      3-13  (54)
123 KOG2186|consensus               82.9    0.87 1.9E-05   31.3   1.7   21   54-75     29-49  (276)
124 COG4530 Uncharacterized protei  82.8    0.86 1.9E-05   27.2   1.4   28   39-66     11-38  (129)
125 PF08271 TF_Zn_Ribbon:  TFIIB z  81.9     1.3 2.9E-05   21.6   1.8    8   55-62     20-27  (43)
126 PF14369 zf-RING_3:  zinc-finge  81.7     1.4 3.1E-05   20.6   1.7    8   40-47     24-31  (35)
127 PF06524 NOA36:  NOA36 protein;  81.6     1.2 2.6E-05   30.8   2.0   88   39-128   127-227 (314)
128 COG1198 PriA Primosomal protei  81.2     1.8 3.9E-05   34.5   3.1    8   39-46    437-444 (730)
129 PRK03681 hypA hydrogenase nick  81.1    0.97 2.1E-05   27.3   1.3   27   36-62     69-95  (114)
130 PF05191 ADK_lid:  Adenylate ki  81.0    0.39 8.6E-06   22.7  -0.3   10   39-48      3-12  (36)
131 COG4957 Predicted transcriptio  80.1    0.85 1.9E-05   28.3   0.8   20  111-133    77-96  (148)
132 PRK04023 DNA polymerase II lar  80.1     2.5 5.3E-05   34.9   3.5    8   83-90    664-671 (1121)
133 PRK14873 primosome assembly pr  79.9     1.5 3.2E-05   34.7   2.2   39   20-63    393-431 (665)
134 PF09845 DUF2072:  Zn-ribbon co  79.7    0.92   2E-05   28.0   0.9   26   37-62      1-27  (131)
135 COG3357 Predicted transcriptio  79.6     1.3 2.8E-05   25.5   1.4   26   36-61     57-83  (97)
136 PF08792 A2L_zn_ribbon:  A2L zi  79.5     1.1 2.3E-05   20.8   0.9   27   21-47      5-31  (33)
137 COG5236 Uncharacterized conser  79.5     1.2 2.6E-05   32.2   1.5   68   55-130   221-301 (493)
138 PF12760 Zn_Tnp_IS1595:  Transp  79.1     1.2 2.5E-05   22.2   1.0   25   38-62     19-45  (46)
139 PF11781 RRN7:  RNA polymerase   78.9     1.4   3E-05   20.8   1.2   25   38-62      9-33  (36)
140 PF01363 FYVE:  FYVE zinc finge  78.5     1.5 3.2E-05   23.6   1.4   25   38-63     10-34  (69)
141 PF07282 OrfB_Zn_ribbon:  Putat  78.3     1.6 3.5E-05   23.5   1.5   27   39-65     30-57  (69)
142 PRK00564 hypA hydrogenase nick  77.8     1.4   3E-05   26.8   1.2   26   37-62     71-96  (117)
143 KOG1280|consensus               77.8     6.6 0.00014   28.5   4.7   42   49-90     74-117 (381)
144 smart00440 ZnF_C2C2 C2C2 Zinc   77.3     2.5 5.5E-05   20.3   1.9    9   55-63     29-37  (40)
145 PRK14873 primosome assembly pr  76.3     2.5 5.3E-05   33.5   2.5    8   39-46    385-392 (665)
146 PF01780 Ribosomal_L37ae:  Ribo  76.2     1.1 2.4E-05   25.9   0.5   29   37-65     35-64  (90)
147 PRK05580 primosome assembly pr  75.9     2.2 4.8E-05   33.8   2.2   39   21-63    392-430 (679)
148 PF01155 HypA:  Hydrogenase exp  75.3     0.8 1.7E-05   27.6  -0.2   25   38-63     71-95  (113)
149 smart00661 RPOL9 RNA polymeras  75.3     2.4 5.2E-05   21.3   1.6   10   54-63     20-29  (52)
150 PF07649 C1_3:  C1-like domain;  75.3       2 4.4E-05   19.1   1.2    9   53-61     14-22  (30)
151 PF13240 zinc_ribbon_2:  zinc-r  75.2     2.5 5.4E-05   17.7   1.3    7   40-46      2-8   (23)
152 PF03107 C1_2:  C1 domain;  Int  74.8     3.1 6.8E-05   18.5   1.7   21   39-61      2-22  (30)
153 COG0068 HypF Hydrogenase matur  74.7    0.19 4.2E-06   39.3  -3.7   68   16-90     98-181 (750)
154 smart00154 ZnF_AN1 AN1-like Zi  74.6     3.2 6.8E-05   19.9   1.8    7   39-45     14-20  (39)
155 PTZ00255 60S ribosomal protein  74.6     1.4 3.1E-05   25.4   0.7   30   37-66     36-66  (90)
156 TIGR00280 L37a ribosomal prote  73.3     1.4 2.9E-05   25.5   0.4   30   37-66     35-65  (91)
157 PF09297 zf-NADH-PPase:  NADH p  73.2     1.8 3.8E-05   19.7   0.7   24   22-45      6-29  (32)
158 KOG2785|consensus               73.0     6.5 0.00014   28.8   3.7   26   54-79    166-191 (390)
159 COG1571 Predicted DNA-binding   72.9     2.6 5.6E-05   31.4   1.8   31   38-68    351-381 (421)
160 PF04959 ARS2:  Arsenite-resist  72.9     2.5 5.4E-05   28.6   1.6   24  108-131    75-98  (214)
161 PF01096 TFIIS_C:  Transcriptio  72.8     1.9 4.1E-05   20.6   0.8    9   55-63     29-37  (39)
162 PF04959 ARS2:  Arsenite-resist  72.3       2 4.4E-05   29.0   1.1   29   50-78     73-101 (214)
163 PF10013 DUF2256:  Uncharacteri  72.1     2.7 5.8E-05   20.6   1.2   15  112-126    10-24  (42)
164 COG3364 Zn-ribbon containing p  72.1     1.2 2.5E-05   26.3  -0.1   26   37-62      2-28  (112)
165 KOG4173|consensus               72.0     1.4   3E-05   29.5   0.2   53   55-107   107-172 (253)
166 PF12013 DUF3505:  Protein of u  71.9     3.4 7.4E-05   24.5   1.9   23  111-133    81-107 (109)
167 PF12013 DUF3505:  Protein of u  71.9     4.8  0.0001   23.9   2.5   26   54-79     80-109 (109)
168 PF05290 Baculo_IE-1:  Baculovi  71.4     2.7 5.8E-05   26.1   1.3   58   33-97     76-136 (140)
169 smart00249 PHD PHD zinc finger  71.3     6.3 0.00014   18.7   2.6   11   37-47     14-24  (47)
170 PF15269 zf-C2H2_7:  Zinc-finge  71.3     3.3 7.2E-05   20.5   1.4   21  111-131    21-41  (54)
171 cd00065 FYVE FYVE domain; Zinc  71.0     3.6 7.7E-05   21.1   1.7   26   40-66      5-30  (57)
172 PRK12380 hydrogenase nickel in  70.2     2.7   6E-05   25.3   1.2   25   37-62     70-94  (113)
173 PF06524 NOA36:  NOA36 protein;  70.0     2.6 5.7E-05   29.2   1.2   96    8-105   114-232 (314)
174 KOG2593|consensus               70.0     6.1 0.00013   29.4   3.1   35   80-117   126-160 (436)
175 PF13453 zf-TFIIB:  Transcripti  69.8     5.4 0.00012   19.2   2.0   16   55-70     20-35  (41)
176 PRK03976 rpl37ae 50S ribosomal  69.2     1.8 3.9E-05   25.0   0.3   30   37-66     36-66  (90)
177 KOG4167|consensus               69.2    0.95 2.1E-05   35.8  -1.1   27   53-79    791-817 (907)
178 PRK14714 DNA polymerase II lar  68.6       6 0.00013   33.6   3.1   21   39-63    681-701 (1337)
179 PF13878 zf-C2H2_3:  zinc-finge  68.3     7.2 0.00016   18.9   2.3   24   55-78     14-39  (41)
180 KOG2807|consensus               68.2       8 0.00017   27.9   3.3   25   81-105   344-368 (378)
181 PF14446 Prok-RING_1:  Prokaryo  68.1     5.1 0.00011   20.8   1.8   25   38-63      6-30  (54)
182 KOG2593|consensus               67.0     4.1 8.9E-05   30.3   1.8   31   33-63    124-162 (436)
183 PF14803 Nudix_N_2:  Nudix N-te  66.8     5.3 0.00011   18.6   1.5    7   55-61     23-29  (34)
184 PRK04023 DNA polymerase II lar  66.7       7 0.00015   32.5   3.1    9   55-63    664-672 (1121)
185 KOG3507|consensus               66.5     4.9 0.00011   21.2   1.5   27   37-63     20-46  (62)
186 PF00130 C1_1:  Phorbol esters/  65.9     5.5 0.00012   20.0   1.7   26   37-62     11-36  (53)
187 KOG3408|consensus               65.6       6 0.00013   24.2   2.0   23  110-132    57-79  (129)
188 COG0068 HypF Hydrogenase matur  65.6     1.6 3.4E-05   34.5  -0.6   75   38-119   102-182 (750)
189 TIGR00244 transcriptional regu  65.2     4.4 9.6E-05   25.6   1.4   14   55-68     29-42  (147)
190 PF08790 zf-LYAR:  LYAR-type C2  64.4     2.2 4.7E-05   19.0  -0.0   10   83-92      1-10  (28)
191 PF04810 zf-Sec23_Sec24:  Sec23  63.9     6.3 0.00014   18.9   1.6    7   55-61     25-31  (40)
192 TIGR00100 hypA hydrogenase nic  63.2     4.8  0.0001   24.3   1.3   25   37-62     70-94  (115)
193 PF15616 TerY-C:  TerY-C metal   63.1     6.9 0.00015   24.3   2.0   15   49-63    100-114 (131)
194 PRK00420 hypothetical protein;  63.0     7.5 0.00016   23.5   2.1   28   38-65     24-51  (112)
195 PF07975 C1_4:  TFIIH C1-like d  62.9     1.2 2.7E-05   22.8  -1.1   15   55-69     22-36  (51)
196 PF01286 XPA_N:  XPA protein N-  62.3     6.2 0.00013   18.4   1.3   10   39-48      5-14  (34)
197 PF07295 DUF1451:  Protein of u  61.6       7 0.00015   24.7   1.9   27   37-64    112-140 (146)
198 COG2331 Uncharacterized protei  61.4     1.9 4.1E-05   24.0  -0.6    8   55-62     13-20  (82)
199 COG5216 Uncharacterized conser  61.2     5.9 0.00013   20.9   1.2   11   79-89     41-51  (67)
200 COG4888 Uncharacterized Zn rib  61.1     6.2 0.00013   23.3   1.4   30   35-64     20-56  (104)
201 PF10058 DUF2296:  Predicted in  60.8      11 0.00023   19.6   2.2   30   16-45     19-52  (54)
202 COG1327 Predicted transcriptio  60.7     5.4 0.00012   25.4   1.2   10   39-48     30-39  (156)
203 PF12773 DZR:  Double zinc ribb  59.8      15 0.00033   18.2   2.7    9   38-46     30-38  (50)
204 COG1571 Predicted DNA-binding   59.7     5.9 0.00013   29.5   1.5   28   21-49    352-379 (421)
205 PF03563 Bunya_G2:  Bunyavirus   59.4      12 0.00026   26.2   2.8   36   39-75    236-271 (285)
206 COG3677 Transposase and inacti  59.3     7.2 0.00016   24.1   1.6   11   38-48     54-64  (129)
207 PRK12722 transcriptional activ  59.0       7 0.00015   25.8   1.6   27   18-44    133-161 (187)
208 COG3091 SprT Zn-dependent meta  58.8     6.4 0.00014   25.1   1.3   34   81-119   116-149 (156)
209 PF15135 UPF0515:  Uncharacteri  58.3     9.5 0.00021   26.4   2.2   49   19-67    112-168 (278)
210 COG1998 RPS31 Ribosomal protei  57.8     9.4  0.0002   19.4   1.6    9   54-62     37-45  (51)
211 PF09082 DUF1922:  Domain of un  57.8     3.2 6.8E-05   22.6  -0.1   27   20-48      4-30  (68)
212 TIGR01053 LSD1 zinc finger dom  57.8     9.2  0.0002   17.3   1.5   23   22-44      4-26  (31)
213 PRK12496 hypothetical protein;  56.7     8.4 0.00018   24.9   1.7   26   38-64    128-153 (164)
214 PRK04351 hypothetical protein;  56.6     9.4  0.0002   24.2   1.9   33   54-94    112-144 (149)
215 PF13824 zf-Mss51:  Zinc-finger  56.1      10 0.00022   19.8   1.6   11   53-63     13-23  (55)
216 KOG2071|consensus               56.1     6.9 0.00015   30.3   1.4   26  108-133   416-441 (579)
217 PF00628 PHD:  PHD-finger;  Int  56.0      13 0.00029   18.4   2.1   11   37-47     14-24  (51)
218 smart00064 FYVE Protein presen  55.8     9.7 0.00021   20.3   1.6   26   39-65     12-37  (68)
219 PRK00762 hypA hydrogenase nick  54.9     7.2 0.00016   23.9   1.1    9   38-47     71-79  (124)
220 PF14634 zf-RING_5:  zinc-RING   54.4      19 0.00041   17.4   2.4    8   82-89     36-43  (44)
221 KOG0717|consensus               53.7     8.1 0.00018   29.2   1.4   21  111-131   293-313 (508)
222 PRK12860 transcriptional activ  52.6      10 0.00023   25.1   1.6   28   17-44    132-161 (189)
223 PRK11032 hypothetical protein;  52.4      10 0.00022   24.4   1.5   26   38-63    125-151 (160)
224 cd00029 C1 Protein kinase C co  52.4      11 0.00023   18.5   1.4   22   40-61     14-35  (50)
225 PF01428 zf-AN1:  AN1-like Zinc  51.8     4.3 9.3E-05   19.8  -0.2   13  109-121    12-24  (43)
226 PF02318 FYVE_2:  FYVE-type zin  51.8     3.7   8E-05   24.9  -0.5   24   38-61     55-78  (118)
227 PF01927 Mut7-C:  Mut7-C RNAse   51.5      18 0.00038   22.8   2.5   17   82-98    124-140 (147)
228 KOG3408|consensus               51.2       9  0.0002   23.4   1.1   23   82-104    57-79  (129)
229 PF05495 zf-CHY:  CHY zinc fing  51.0     6.3 0.00014   21.6   0.4   27   37-63     41-70  (71)
230 KOG2906|consensus               51.0      11 0.00024   22.1   1.4   34   83-120    66-103 (105)
231 PF13248 zf-ribbon_3:  zinc-rib  50.9      12 0.00027   15.9   1.2    6   40-45      5-10  (26)
232 PF09416 UPF1_Zn_bind:  RNA hel  49.8      28 0.00061   22.2   3.2   21   55-75     15-41  (152)
233 COG2824 PhnA Uncharacterized Z  49.8      11 0.00024   22.4   1.3   29   39-67      5-33  (112)
234 KOG2482|consensus               49.1     9.7 0.00021   27.7   1.1   51   82-132   144-217 (423)
235 PRK05452 anaerobic nitric oxid  48.6      11 0.00024   28.7   1.5   13   36-48    424-436 (479)
236 PF10263 SprT-like:  SprT-like   48.4      12 0.00025   23.6   1.4    9   83-91    144-152 (157)
237 PF11793 FANCL_C:  FANCL C-term  47.9      15 0.00033   20.0   1.6    8   84-91     57-64  (70)
238 KOG0978|consensus               47.5     4.1 8.8E-05   32.3  -1.0   16   83-98    679-694 (698)
239 cd02249 ZZ Zinc finger, ZZ typ  47.5      20 0.00042   17.6   1.8   21   38-61      1-21  (46)
240 PF05129 Elf1:  Transcription e  47.1      12 0.00026   21.1   1.1    9   36-44     21-29  (81)
241 cd02337 ZZ_CBP Zinc finger, ZZ  46.9      21 0.00046   17.2   1.9    9   53-61     12-20  (41)
242 PF09332 Mcm10:  Mcm10 replicat  46.6     6.2 0.00013   28.7  -0.1   27   36-62    284-311 (344)
243 PF04216 FdhE:  Protein involve  46.3     4.6 9.9E-05   28.5  -0.8   26   35-63    195-220 (290)
244 PF13451 zf-trcl:  Probable zin  46.3     7.7 0.00017   19.7   0.2   15  108-122     2-16  (49)
245 PF02150 RNA_POL_M_15KD:  RNA p  46.0      15 0.00032   17.1   1.2    8   56-63     22-29  (35)
246 KOG2636|consensus               46.0      14 0.00031   27.8   1.6   28  103-130   394-422 (497)
247 PF11672 DUF3268:  Protein of u  46.0      20 0.00042   21.3   1.9    7   55-61     32-38  (102)
248 TIGR01384 TFS_arch transcripti  45.6      19 0.00042   21.0   1.9   38   82-121    62-101 (104)
249 PF10276 zf-CHCC:  Zinc-finger   45.5     9.2  0.0002   18.5   0.4   12   36-47     28-39  (40)
250 cd00924 Cyt_c_Oxidase_Vb Cytoc  44.6      11 0.00023   22.1   0.7   12   36-47     78-89  (97)
251 PF12907 zf-met2:  Zinc-binding  44.5     9.5 0.00021   18.5   0.4   20   84-103     3-25  (40)
252 PTZ00448 hypothetical protein;  44.4      17 0.00037   26.7   1.8   23  110-132   314-336 (373)
253 smart00731 SprT SprT homologue  44.3      16 0.00035   22.8   1.5   29   36-64    111-143 (146)
254 KOG0957|consensus               43.9      20 0.00044   27.6   2.1   48   16-66    541-601 (707)
255 COG1675 TFA1 Transcription ini  43.6      37 0.00081   22.3   3.1   32   79-119   110-141 (176)
256 cd02341 ZZ_ZZZ3 Zinc finger, Z  43.3      24 0.00052   17.7   1.8    8   54-61     15-22  (48)
257 PRK03564 formate dehydrogenase  43.2      23  0.0005   25.4   2.3   26   34-62    209-234 (309)
258 PF06397 Desulfoferrod_N:  Desu  42.6      13 0.00028   17.6   0.7   12   37-48      6-17  (36)
259 cd04476 RPA1_DBD_C RPA1_DBD_C:  42.4      21 0.00045   22.8   1.9   12   36-47     50-61  (166)
260 PF04780 DUF629:  Protein of un  42.1      19 0.00042   27.3   1.8   21  111-131    58-78  (466)
261 COG1656 Uncharacterized conser  41.9      28 0.00062   22.5   2.3   13   83-95    131-143 (165)
262 PF04780 DUF629:  Protein of un  41.5      19 0.00041   27.4   1.7   26   82-107    57-83  (466)
263 smart00586 ZnF_DBF Zinc finger  41.2      22 0.00048   18.0   1.4   20  108-130     3-22  (49)
264 KOG2272|consensus               41.1      36 0.00077   23.8   2.8   14   81-94    220-233 (332)
265 COG5415 Predicted integral mem  41.0      17 0.00036   24.6   1.2   41    6-46    179-223 (251)
266 PRK11823 DNA repair protein Ra  40.9      22 0.00047   26.9   2.0   25   37-64      7-31  (446)
267 KOG2636|consensus               40.8      22 0.00048   26.9   1.9   28   76-103   395-423 (497)
268 PF04641 Rtf2:  Rtf2 RING-finge  40.6      39 0.00085   23.5   3.1   53   34-95    110-163 (260)
269 COG1655 Uncharacterized protei  40.1     9.3  0.0002   26.2  -0.0   23   81-103    18-40  (267)
270 PRK05978 hypothetical protein;  39.5      23 0.00051   22.5   1.7    6   57-62     55-60  (148)
271 KOG1280|consensus               39.5      33 0.00071   25.1   2.5   38   80-117    77-116 (381)
272 PF11023 DUF2614:  Protein of u  39.5      19 0.00041   21.7   1.2   28   38-66     70-97  (114)
273 PF11789 zf-Nse:  Zinc-finger o  39.4      48   0.001   17.2   2.6   45   35-87      9-53  (57)
274 PF06943 zf-LSD1:  LSD1 zinc fi  39.3      31 0.00068   14.8   1.6   21   24-44      3-23  (25)
275 COG4338 Uncharacterized protei  39.3      12 0.00026   18.9   0.3   16  112-127    14-29  (54)
276 KOG3002|consensus               39.2      29 0.00064   24.8   2.3   91   16-116    45-142 (299)
277 smart00109 C1 Protein kinase C  39.2      27 0.00059   16.7   1.7   23   38-61     12-34  (49)
278 PF13901 DUF4206:  Domain of un  39.1      25 0.00054   23.5   1.9   29   36-64    151-182 (202)
279 TIGR00416 sms DNA repair prote  38.9      24 0.00053   26.7   2.0   26   37-65      7-32  (454)
280 PF13005 zf-IS66:  zinc-finger   38.8      17 0.00036   17.8   0.8    9   40-48      5-13  (47)
281 COG4306 Uncharacterized protei  38.7      30 0.00065   21.3   2.0   32   37-68     39-82  (160)
282 cd01121 Sms Sms (bacterial rad  38.5      27 0.00058   25.7   2.1   24   38-64      1-24  (372)
283 PF13445 zf-RING_UBOX:  RING-ty  38.3      42  0.0009   16.4   2.2   27   40-68      1-27  (43)
284 KOG0696|consensus               38.2      12 0.00025   28.4   0.2   59   51-118    70-129 (683)
285 PRK07591 threonine synthase; V  37.5      23 0.00049   26.5   1.6   22   38-61     19-40  (421)
286 PRK11827 hypothetical protein;  37.5      25 0.00054   18.7   1.3   28   21-48     10-37  (60)
287 COG1779 C4-type Zn-finger prot  37.4      14 0.00031   24.6   0.5   11   38-48     44-54  (201)
288 PF08646 Rep_fac-A_C:  Replicat  37.4      18  0.0004   22.5   1.0   27   20-47     19-47  (146)
289 KOG0717|consensus               37.2      21 0.00046   27.1   1.4   22   83-104   293-314 (508)
290 PRK06450 threonine synthase; V  37.0      22 0.00047   25.8   1.4   23   38-62      4-26  (338)
291 PHA02942 putative transposase;  37.0      39 0.00085   25.0   2.8   11   82-92    342-352 (383)
292 PF04423 Rad50_zn_hook:  Rad50   37.0      13 0.00027   19.0   0.2   11  112-122    22-32  (54)
293 COG5112 UFD2 U1-like Zn-finger  36.8      28 0.00061   20.8   1.6   21  111-131    56-76  (126)
294 PLN02294 cytochrome c oxidase   36.8      17 0.00037   23.6   0.8   19  102-121   134-152 (174)
295 TIGR00627 tfb4 transcription f  36.3      28  0.0006   24.6   1.8   24   38-64    256-279 (279)
296 KOG3799|consensus               36.3      17 0.00037   22.7   0.7   42   19-62     65-115 (169)
297 PF14311 DUF4379:  Domain of un  36.2      34 0.00073   17.4   1.7   12   83-94     29-40  (55)
298 TIGR03830 CxxCG_CxxCG_HTH puta  36.1      30 0.00066   20.7   1.8   31   42-73     20-50  (127)
299 PF07503 zf-HYPF:  HypF finger;  35.6     3.5 7.5E-05   19.3  -1.9   11  110-120    21-31  (35)
300 cd02335 ZZ_ADA2 Zinc finger, Z  35.5      41 0.00088   16.8   1.9    8   53-60     14-21  (49)
301 PLN02748 tRNA dimethylallyltra  35.3      27 0.00059   26.6   1.7   24  109-132   417-441 (468)
302 PHA02998 RNA polymerase subuni  35.3      35 0.00076   22.5   2.0   11   83-93    172-182 (195)
303 PLN03238 probable histone acet  35.3      37  0.0008   24.1   2.3   24  108-131    46-69  (290)
304 PRK14559 putative protein seri  35.2      56  0.0012   26.1   3.4   52    3-67      3-54  (645)
305 KOG2923|consensus               35.0      25 0.00053   18.9   1.1   11   79-89     41-51  (67)
306 PRK14892 putative transcriptio  34.9      39 0.00084   19.9   2.0   12   54-65     42-53  (99)
307 PF06220 zf-U1:  U1 zinc finger  34.6      35 0.00076   16.1   1.5   11   54-64      3-13  (38)
308 PF07191 zinc-ribbons_6:  zinc-  34.2      22 0.00048   19.5   0.9   12   37-48     17-28  (70)
309 PF09963 DUF2197:  Uncharacteri  34.2      16 0.00035   19.1   0.3   10   81-90     30-39  (56)
310 PRK12286 rpmF 50S ribosomal pr  33.1      34 0.00074   17.9   1.4   20   38-61     28-47  (57)
311 PF01485 IBR:  IBR domain;  Int  32.6      34 0.00074   17.5   1.5   27   21-47     20-50  (64)
312 COG1594 RPB9 DNA-directed RNA   32.5      34 0.00074   20.6   1.6    9   19-27     22-30  (113)
313 PRK12775 putative trifunctiona  32.5      28 0.00061   29.2   1.6   45   19-63    796-847 (1006)
314 PF10122 Mu-like_Com:  Mu-like   32.3      25 0.00054   18.0   0.8   30   19-48      4-35  (51)
315 PF07535 zf-DBF:  DBF zinc fing  31.8      36 0.00078   17.2   1.3   19  109-130     4-22  (49)
316 TIGR01562 FdhE formate dehydro  31.4      40 0.00086   24.2   2.0   26   34-62    207-232 (305)
317 PF10083 DUF2321:  Uncharacteri  30.9      45 0.00097   21.4   1.9   20   49-68     63-82  (158)
318 COG5188 PRP9 Splicing factor 3  30.9      37  0.0008   25.0   1.7   28  103-130   367-395 (470)
319 TIGR01031 rpmF_bact ribosomal   30.8      36 0.00079   17.6   1.3    8   38-45     27-34  (55)
320 PF08209 Sgf11:  Sgf11 (transcr  30.4      50  0.0011   15.2   1.6   21   82-103     4-24  (33)
321 COG1645 Uncharacterized Zn-fin  30.0      30 0.00066   21.5   1.0   23   21-45     30-52  (131)
322 COG1439 Predicted nucleic acid  29.9      28 0.00062   22.8   1.0   23   38-63    140-162 (177)
323 PF09855 DUF2082:  Nucleic-acid  29.7      36 0.00078   18.3   1.2    7   38-44      1-7   (64)
324 PRK00415 rps27e 30S ribosomal   29.7      49  0.0011   17.5   1.7    9   55-63     31-39  (59)
325 COG5151 SSL1 RNA polymerase II  29.5      68  0.0015   23.2   2.8   25   81-105   387-411 (421)
326 PF13639 zf-RING_2:  Ring finge  29.4      74  0.0016   15.1   2.5    8   40-47      3-10  (44)
327 TIGR03831 YgiT_finger YgiT-typ  29.2      25 0.00055   16.7   0.5   12   36-47     31-42  (46)
328 KOG1842|consensus               29.0      26 0.00057   26.5   0.8   24   54-77     15-38  (505)
329 PF05180 zf-DNL:  DNL zinc fing  28.9     7.8 0.00017   21.0  -1.5   12   78-89     25-36  (66)
330 PRK00418 DNA gyrase inhibitor;  28.8      45 0.00098   17.8   1.5   11   38-48      7-17  (62)
331 KOG2071|consensus               28.8      42 0.00091   26.3   1.8   26   53-78    417-442 (579)
332 PF02591 DUF164:  Putative zinc  28.7      21 0.00046   18.3   0.2   12   34-45     43-54  (56)
333 PF02748 PyrI_C:  Aspartate car  28.3      26 0.00055   18.0   0.5   16   33-48     31-46  (52)
334 PRK06260 threonine synthase; V  28.3      40 0.00088   24.9   1.7   25   38-63      4-28  (397)
335 PF05741 zf-nanos:  Nanos RNA b  28.2      52  0.0011   17.2   1.6   10   37-46     33-42  (55)
336 KOG0402|consensus               28.2      21 0.00045   20.3   0.1   29   38-66     37-66  (92)
337 TIGR03844 cysteate_syn cysteat  28.0      39 0.00085   25.1   1.5   22   38-61      3-24  (398)
338 PF07227 DUF1423:  Protein of u  27.8      34 0.00074   25.8   1.2   53   38-91    129-192 (446)
339 PF14255 Cys_rich_CPXG:  Cystei  27.7      30 0.00065   17.8   0.7   10   39-48      2-11  (52)
340 TIGR03826 YvyF flagellar opero  27.2      42 0.00091   21.1   1.4   21    2-25      4-24  (137)
341 KOG3362|consensus               27.1      20 0.00044   22.6  -0.1   20   54-73    129-148 (156)
342 KOG4727|consensus               27.1      57  0.0012   21.4   1.9   27   49-75     70-96  (193)
343 PLN00104 MYST -like histone ac  26.9      51  0.0011   25.1   2.0   23  109-131   197-219 (450)
344 smart00291 ZnF_ZZ Zinc-binding  26.7      77  0.0017   15.3   2.0   21   38-61      5-25  (44)
345 PF01783 Ribosomal_L32p:  Ribos  26.7      67  0.0015   16.6   1.9   15   18-32     25-39  (56)
346 COG4357 Zinc finger domain con  26.7      19 0.00042   21.0  -0.2   33   36-68     61-94  (105)
347 TIGR00319 desulf_FeS4 desulfof  26.7      31 0.00068   15.6   0.6   13   36-48      6-18  (34)
348 PLN03239 histone acetyltransfe  26.7      57  0.0012   23.9   2.1   24  108-131   104-127 (351)
349 cd00974 DSRD Desulforedoxin (D  26.5      32  0.0007   15.6   0.6   13   36-48      3-15  (34)
350 COG4640 Predicted membrane pro  26.5      61  0.0013   24.3   2.2   16   56-71     17-32  (465)
351 TIGR00515 accD acetyl-CoA carb  26.3      24 0.00052   25.0   0.2   30   38-67     27-58  (285)
352 PF00569 ZZ:  Zinc finger, ZZ t  26.2      52  0.0011   16.1   1.4   23   37-61      4-26  (46)
353 COG3809 Uncharacterized protei  26.2      92   0.002   17.6   2.4   38   39-76      3-43  (88)
354 cd02340 ZZ_NBR1_like Zinc fing  26.1      75  0.0016   15.4   1.9    7   54-60     14-20  (43)
355 COG1326 Uncharacterized archae  25.8      71  0.0015   21.4   2.2   11   82-92     30-40  (201)
356 PF05280 FlhC:  Flagellar trans  25.7      33 0.00072   22.5   0.7   28   17-44    132-161 (175)
357 PRK08222 hydrogenase 4 subunit  25.5      48   0.001   21.7   1.5   19  109-127   113-131 (181)
358 CHL00174 accD acetyl-CoA carbo  25.5      25 0.00055   25.1   0.2   30   38-67     39-70  (296)
359 PTZ00448 hypothetical protein;  25.3      56  0.0012   24.1   1.9   23   54-76    314-336 (373)
360 PF14206 Cys_rich_CPCC:  Cystei  25.1      67  0.0014   18.1   1.8    9   38-46      2-10  (78)
361 PTZ00064 histone acetyltransfe  25.1      63  0.0014   25.0   2.1   24  108-131   278-301 (552)
362 KOG0782|consensus               24.9      14 0.00029   29.0  -1.3   51   68-124   239-290 (1004)
363 PF11931 DUF3449:  Domain of un  24.8      24 0.00053   23.5   0.0   21   81-101   100-121 (196)
364 COG2816 NPY1 NTP pyrophosphohy  24.5      52  0.0011   23.3   1.5   28   21-48    113-140 (279)
365 smart00504 Ubox Modified RING   24.1 1.1E+02  0.0025   15.5   4.1   45   38-93      2-46  (63)
366 COG4896 Uncharacterized protei  23.8      58  0.0013   17.4   1.3   39   56-94      4-43  (68)
367 COG2051 RPS27A Ribosomal prote  23.6      55  0.0012   17.8   1.2    8   56-63     40-47  (67)
368 COG4391 Uncharacterized protei  23.2      86  0.0019   16.7   1.9   20   28-47     15-34  (62)
369 PF11494 Ta0938:  Ta0938;  Inte  23.2      77  0.0017   18.6   1.8   34   34-67     11-50  (105)
370 COG1545 Predicted nucleic-acid  22.8      59  0.0013   20.3   1.4   23   38-63     30-52  (140)
371 PRK05654 acetyl-CoA carboxylas  22.7      29 0.00063   24.7   0.1   30   38-67     28-59  (292)
372 KOG2747|consensus               22.4      59  0.0013   24.3   1.5   25  108-132   156-180 (396)
373 smart00647 IBR In Between Ring  22.3      74  0.0016   16.2   1.6    8   38-45     41-48  (64)
374 PF04438 zf-HIT:  HIT zinc fing  22.3      38 0.00082   15.1   0.4   11   36-46     12-22  (30)
375 cd00122 MBD MeCP2, MBD1, MBD2,  21.5      90  0.0019   16.3   1.8   23  111-133    28-50  (62)
376 PRK08359 transcription factor;  21.2      32  0.0007   22.6   0.0   27   38-64      7-40  (176)
377 COG0675 Transposase and inacti  21.0      60  0.0013   22.8   1.4   24   39-66    311-334 (364)
378 PRK14811 formamidopyrimidine-D  20.8      74  0.0016   22.3   1.8   26   39-64    237-265 (269)
379 KOG4124|consensus               20.8      14 0.00031   26.9  -1.8   47   81-127   348-415 (442)
380 PF02891 zf-MIZ:  MIZ/SP-RING z  20.7      57  0.0012   16.4   0.9    8   83-90     42-49  (50)
381 PF14319 Zn_Tnp_IS91:  Transpos  20.6      97  0.0021   18.5   2.0   62   34-101    39-101 (111)
382 KOG1729|consensus               20.2      12 0.00026   26.5  -2.2   28   38-66    169-197 (288)
383 PLN03238 probable histone acet  20.1 1.1E+02  0.0024   21.9   2.4   25   51-75     45-69  (290)
384 KOG0320|consensus               20.1      22 0.00049   23.3  -0.8   51   35-94    129-179 (187)
385 PRK00241 nudC NADH pyrophospha  20.0      69  0.0015   22.3   1.4   28   21-48    101-128 (256)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=1.3e-28  Score=163.95  Aligned_cols=114  Identities=23%  Similarity=0.448  Sum_probs=100.1

Q ss_pred             ceecCccccc----------ccccCCC---CccccCCCCCCccc---------CCCCcceeeCCCCCccCChHHHHHHHH
Q psy3507          18 TLATCIHCRL----------LLVPTAE---ELMYHCKTCSTVSH---------PNISYKYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        18 ~~~~C~~C~~----------h~~~h~~---~~~~~C~~C~~~f~---------~~~~~~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      ..++|+.|++          |..+|..   .+.+.|++||+.|.         .+...+++|.+||+.|...-.|..|++
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccc
Confidence            3577888844          4444432   67799999999998         445578999999999999999999999


Q ss_pred             HhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHH
Q psy3507          76 KHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus        76 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +|+||+||.|+.|+++|..+++|+.|+++|.+.|+|+|..|+|+|...+.|.+|..
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999975


No 2  
>KOG2462|consensus
Probab=99.94  E-value=1.2e-27  Score=159.34  Aligned_cols=98  Identities=28%  Similarity=0.604  Sum_probs=91.3

Q ss_pred             CccccCCCCCCcccCCC--------------CcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHH
Q psy3507          35 ELMYHCKTCSTVSHPNI--------------SYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKI  100 (134)
Q Consensus        35 ~~~~~C~~C~~~f~~~~--------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  100 (134)
                      ...|+|++||+.+....              .+.+.|++|++.|.+-..|++|+++|.  .+++|.+||+.|.++.-|+.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            45699999999998433              567999999999999999999999997  67999999999999999999


Q ss_pred             HhhhcCCCCCeecCcChhhhcCHHHHHHHHHhcC
Q psy3507         101 HERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG  134 (134)
Q Consensus       101 H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~~H~  134 (134)
                      |+|+|+|||||.|+.|+|+|..+++|+.||+||+
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhc
Confidence            9999999999999999999999999999999995


No 3  
>KOG1074|consensus
Probab=99.76  E-value=1.2e-19  Score=135.65  Aligned_cols=81  Identities=26%  Similarity=0.565  Sum_probs=73.3

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCCCC----CeecC---cChhhhcCHHHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDK----PYICQ---QCRDTFSSLYLF  126 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----~~~C~---~C~~~F~~~~~l  126 (134)
                      +-+|-+|.++..-++.|+.|.++|+|++||+|.+||++|.++.+|+.|+.+|...-    +|.|+   +|-+.|...-.|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            47899999999999999999999999999999999999999999999999887643    48899   899999999999


Q ss_pred             HHHHHhcC
Q psy3507         127 RNRLQSHG  134 (134)
Q Consensus       127 ~~H~~~H~  134 (134)
                      ..|+++|+
T Consensus       685 pQhIriH~  692 (958)
T KOG1074|consen  685 PQHIRIHL  692 (958)
T ss_pred             cceEEeec
Confidence            99999884


No 4  
>KOG3608|consensus
Probab=99.75  E-value=4.6e-19  Score=122.08  Aligned_cols=107  Identities=24%  Similarity=0.512  Sum_probs=96.3

Q ss_pred             ccccccCCCCccccCCCCCCccc-------------CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccc
Q psy3507          26 RLLLVPTAEELMYHCKTCSTVSH-------------PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSC   92 (134)
Q Consensus        26 ~~h~~~h~~~~~~~C~~C~~~f~-------------~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   92 (134)
                      +.|.++|+++|...|+.||..|.             .....+|.|..|.+.|.+...|..|+..|..  .|+|+.|+.+.
T Consensus       196 reH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmtc  273 (467)
T KOG3608|consen  196 REHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMTC  273 (467)
T ss_pred             HHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccccCC
Confidence            66999999999999999999998             2223479999999999999999999998874  59999999999


Q ss_pred             cCchhHHHHhhh-cCCCCCeecCcChhhhcCHHHHHHHHHhcC
Q psy3507          93 TQSSALKIHERK-HTGDKPYICQQCRDTFSSLYLFRNRLQSHG  134 (134)
Q Consensus        93 ~~~~~l~~H~~~-h~~~~~~~C~~C~~~F~~~~~l~~H~~~H~  134 (134)
                      ..+++|..|++. |..++||+|..|++.|.+.+.|.+|+.+|+
T Consensus       274 ~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  274 SSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             CChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            999999999885 888999999999999999999999999885


No 5  
>KOG3576|consensus
Probab=99.72  E-value=1.6e-18  Score=111.43  Aligned_cols=77  Identities=27%  Similarity=0.626  Sum_probs=44.0

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRL  130 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~  130 (134)
                      .|.|.+|++.|.....|.+|++.|...+.+-|..||+.|...-.|++|+++|+|.+||+|..|+++|..+-+|..|+
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            35555555555555555555555555555555555555555555555555555555555555555555555555554


No 6  
>KOG3576|consensus
Probab=99.70  E-value=4.3e-18  Score=109.49  Aligned_cols=100  Identities=29%  Similarity=0.545  Sum_probs=89.5

Q ss_pred             CCccccCCCCCCccc-----------CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHh
Q psy3507          34 EELMYHCKTCSTVSH-----------PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHE  102 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~-----------~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  102 (134)
                      +...|.|.+|++.|.           +...+.+.|..||+.|.+.-+|++|+++|+|.+||+|..|+++|.++-+|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            345699999999998           667778999999999999999999999999999999999999999999999997


Q ss_pred             hh-cC----------CCCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507         103 RK-HT----------GDKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       103 ~~-h~----------~~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      +. |.          .++.|.|+.||.+-.....+..|++.|
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~  235 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLH  235 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhc
Confidence            75 43          245699999999999999999998876


No 7  
>KOG1074|consensus
Probab=99.69  E-value=8.7e-18  Score=125.95  Aligned_cols=52  Identities=33%  Similarity=0.695  Sum_probs=49.8

Q ss_pred             eeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHHhcC
Q psy3507          83 YKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG  134 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~~H~  134 (134)
                      ..|.+|++.|...+.|..|+++|++++||.|..|++.|..+.+|+.||.+|.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~  931 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHM  931 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcccc
Confidence            3699999999999999999999999999999999999999999999999984


No 8  
>KOG3623|consensus
Probab=99.68  E-value=6.6e-18  Score=125.22  Aligned_cols=82  Identities=27%  Similarity=0.639  Sum_probs=77.9

Q ss_pred             CCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHH
Q psy3507          50 NISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNR  129 (134)
Q Consensus        50 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H  129 (134)
                      ..+.+|.|+.|++.|...+.|.+|.--|+|.+||+|.+|.++|..+-.|..|+|.|.|+|||+|..|+|+|....++..|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhh
Confidence            33457999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HH
Q psy3507         130 LQ  131 (134)
Q Consensus       130 ~~  131 (134)
                      |.
T Consensus       970 MN  971 (1007)
T KOG3623|consen  970 MN  971 (1007)
T ss_pred             hc
Confidence            84


No 9  
>KOG3623|consensus
Probab=99.63  E-value=3.8e-17  Score=121.23  Aligned_cols=94  Identities=24%  Similarity=0.594  Sum_probs=83.3

Q ss_pred             ccCCCCCCccc-------------CCCCcceeeCCCCCccCChHHHHHHHHHhcCC-------------CceeccccCcc
Q psy3507          38 YHCKTCSTVSH-------------PNISYKYTCYACDYHTLMSEDMKKHMRKHTGE-------------KPYKCEYCAYS   91 (134)
Q Consensus        38 ~~C~~C~~~f~-------------~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-------------~~~~C~~C~~~   91 (134)
                      .+|++|.+.+.             ...+..|.|..|..+|..+..|.+||.+|...             +.|+|.+||++
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            67888888776             33445689999999999999999999988532             44999999999


Q ss_pred             ccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHH
Q psy3507          92 CTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus        92 f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      |..+-.|+.|+|+|.|+|||.|+.|+|+|....++..||.
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            9999999999999999999999999999999999999874


No 10 
>KOG3608|consensus
Probab=99.48  E-value=1.8e-14  Score=99.64  Aligned_cols=81  Identities=27%  Similarity=0.576  Sum_probs=44.6

Q ss_pred             CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccc--cCccccCchhHHHHhhh-cCCC--CCeecCcChhhhcCH
Q psy3507          49 PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEY--CAYSCTQSSALKIHERK-HTGD--KPYICQQCRDTFSSL  123 (134)
Q Consensus        49 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~-h~~~--~~~~C~~C~~~F~~~  123 (134)
                      +...++|+|+.|++.+.+.+.|.+|..+|+ +..|.|+.  |...+.+...+..|++. |.|.  .+|.|..|++.|++-
T Consensus       287 Hs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G  365 (467)
T KOG3608|consen  287 HSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSG  365 (467)
T ss_pred             hccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccc
Confidence            444455555555555555555555555554 33455544  55555555555555443 2232  336777777777777


Q ss_pred             HHHHHHH
Q psy3507         124 YLFRNRL  130 (134)
Q Consensus       124 ~~l~~H~  130 (134)
                      .+|.+|+
T Consensus       366 ~~L~~HL  372 (467)
T KOG3608|consen  366 KSLSAHL  372 (467)
T ss_pred             hhHHHHH
Confidence            7777775


No 11 
>PHA00733 hypothetical protein
Probab=99.34  E-value=8.3e-13  Score=81.17  Aligned_cols=79  Identities=15%  Similarity=0.280  Sum_probs=62.9

Q ss_pred             CcceeeCCCCCccCChHHHHHH--HH---HhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHH
Q psy3507          52 SYKYTCYACDYHTLMSEDMKKH--MR---KHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLF  126 (134)
Q Consensus        52 ~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l  126 (134)
                      .+++.|.+|...|..+..|..+  +.   .+.+.+||.|+.|++.|.+...|..|++.+  +.+|.|..|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            4456777777777666665554  11   234578999999999999999999999876  4579999999999999999


Q ss_pred             HHHHHh
Q psy3507         127 RNRLQS  132 (134)
Q Consensus       127 ~~H~~~  132 (134)
                      .+|+..
T Consensus       116 ~~H~~~  121 (128)
T PHA00733        116 LDHVCK  121 (128)
T ss_pred             HHHHHH
Confidence            999854


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.32  E-value=7.4e-12  Score=92.76  Aligned_cols=73  Identities=21%  Similarity=0.466  Sum_probs=32.8

Q ss_pred             CCCccc-CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhh
Q psy3507          43 CSTVSH-PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTF  120 (134)
Q Consensus        43 C~~~f~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F  120 (134)
                      ||..|. ...+..+.|+.|++.|. ...|..|+..++  .++.|+ |+..+ .+..|..|+.+|.+++++.|..|++.|
T Consensus       441 Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        441 CGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             ccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            444444 22223344555554443 344445544432  344454 54332 334444454444444555555555444


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.22  E-value=6.4e-11  Score=87.88  Aligned_cols=102  Identities=17%  Similarity=0.342  Sum_probs=82.1

Q ss_pred             cccccccCCCCccccCCCCCCcccC--------CCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccC--
Q psy3507          25 CRLLLVPTAEELMYHCKTCSTVSHP--------NISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQ--   94 (134)
Q Consensus        25 C~~h~~~h~~~~~~~C~~C~~~f~~--------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~--   94 (134)
                      |+..++....++.+.|+.|++.|..        .-..++.|+ |++.+ .+..|..|+.+|.+.+++.|+.|++.+..  
T Consensus       441 Cg~v~~r~el~~H~~C~~Cgk~f~~s~LekH~~~~Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~  518 (567)
T PLN03086        441 CGIVLRVEEAKNHVHCEKCGQAFQQGEMEKHMKVFHEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGG  518 (567)
T ss_pred             ccceeeccccccCccCCCCCCccchHHHHHHHHhcCCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCc
Confidence            5666666666778999999999871        113678999 99755 67999999999999999999999999852  


Q ss_pred             --------chhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHH
Q psy3507          95 --------SSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRL  130 (134)
Q Consensus        95 --------~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~  130 (134)
                              .+.|..|.... |.+++.|..||+.|..+ .|..|+
T Consensus       519 ~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~  560 (567)
T PLN03086        519 SAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQ  560 (567)
T ss_pred             cccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHH
Confidence                    35799998885 89999999999998754 566665


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.19  E-value=5.6e-12  Score=65.27  Aligned_cols=43  Identities=23%  Similarity=0.441  Sum_probs=24.6

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSAL   98 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l   98 (134)
                      .|+|+.||+.|...++|..|+++|.  ++++|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            3556666666666666666666655  455566666655554443


No 15 
>PHA00733 hypothetical protein
Probab=99.12  E-value=5.3e-11  Score=73.21  Aligned_cols=72  Identities=19%  Similarity=0.237  Sum_probs=61.2

Q ss_pred             CCccccCCCCCCccc----------------CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchh
Q psy3507          34 EELMYHCKTCSTVSH----------------PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSA   97 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~----------------~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~   97 (134)
                      ..+++.|.+|.+.|.                ..+..+|.|+.|++.|.....|..|++.+  +.+|.|+.|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            356788999987776                34467899999999999999999999876  357999999999999999


Q ss_pred             HHHHhhhcCC
Q psy3507          98 LKIHERKHTG  107 (134)
Q Consensus        98 l~~H~~~h~~  107 (134)
                      |..|+...++
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999886543


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.10  E-value=4.5e-11  Score=61.91  Aligned_cols=43  Identities=19%  Similarity=0.358  Sum_probs=39.5

Q ss_pred             ceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHH
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLF  126 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l  126 (134)
                      -|.|+.||+.|...++|..|+++|+  ++|+|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            3899999999999999999999998  699999999999977665


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.01  E-value=1.8e-10  Score=51.33  Aligned_cols=24  Identities=54%  Similarity=1.092  Sum_probs=14.9

Q ss_pred             HHHHhhhcCCCCCeecCcChhhhc
Q psy3507          98 LKIHERKHTGDKPYICQQCRDTFS  121 (134)
Q Consensus        98 l~~H~~~h~~~~~~~C~~C~~~F~  121 (134)
                      |..|+++|++++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            556666666666666666666654


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=1.9e-09  Score=47.96  Aligned_cols=26  Identities=58%  Similarity=1.258  Sum_probs=23.9

Q ss_pred             HHHHHHHHhcCCCceeccccCccccC
Q psy3507          69 DMKKHMRKHTGEKPYKCEYCAYSCTQ   94 (134)
Q Consensus        69 ~l~~H~~~h~~~~~~~C~~C~~~f~~   94 (134)
                      +|..|+++|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58899999999999999999999863


No 19 
>KOG3993|consensus
Probab=98.81  E-value=7.6e-10  Score=78.58  Aligned_cols=24  Identities=21%  Similarity=0.552  Sum_probs=22.2

Q ss_pred             CeecCcChhhhcCHHHHHHHHHhc
Q psy3507         110 PYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       110 ~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      .|.|..|++.|.+...|+.|+.+|
T Consensus       356 i~~C~~C~KkFrRqAYLrKHqlth  379 (500)
T KOG3993|consen  356 IFSCHTCGKKFRRQAYLRKHQLTH  379 (500)
T ss_pred             eeecHHhhhhhHHHHHHHHhHHhh
Confidence            499999999999999999998877


No 20 
>PHA00732 hypothetical protein
Probab=98.73  E-value=6.2e-09  Score=58.62  Aligned_cols=48  Identities=29%  Similarity=0.525  Sum_probs=37.3

Q ss_pred             ceeeCCCCCccCChHHHHHHHHH-hcCCCceeccccCccccCchhHHHHhhhcCC
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRK-HTGEKPYKCEYCAYSCTQSSALKIHERKHTG  107 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  107 (134)
                      +|.|+.|++.|.....|..|++. |.   ++.|+.|++.|.   .+..|.++...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCC
Confidence            47899999999999999999874 54   357999999887   47788765443


No 21 
>KOG3993|consensus
Probab=98.65  E-value=7.4e-09  Score=73.68  Aligned_cols=120  Identities=19%  Similarity=0.295  Sum_probs=76.1

Q ss_pred             ccCCccceecCccccc----------ccccCCCCccccCCCCCCccc----------------------------C----
Q psy3507          12 GLKNPFTLATCIHCRL----------LLVPTAEELMYHCKTCSTVSH----------------------------P----   49 (134)
Q Consensus        12 ~~~~~~~~~~C~~C~~----------h~~~h~~~~~~~C~~C~~~f~----------------------------~----   49 (134)
                      +..|+...++|..|+.          |.-.-....-|+|++|+++|+                            .    
T Consensus       260 ~i~n~iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~r  339 (500)
T KOG3993|consen  260 GIPNVIGDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETR  339 (500)
T ss_pred             cCcccHHHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhh
Confidence            5567777788888833          222222223488888888887                            0    


Q ss_pred             ------------CCCcceeeCCCCCccCChHHHHHHHHHhcCCC------------------------------------
Q psy3507          50 ------------NISYKYTCYACDYHTLMSEDMKKHMRKHTGEK------------------------------------   81 (134)
Q Consensus        50 ------------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~------------------------------------   81 (134)
                                  ..+..|.|.+|++.|.....|+.|+.+|....                                    
T Consensus       340 ae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~  419 (500)
T KOG3993|consen  340 AEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGD  419 (500)
T ss_pred             hhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhccccccccccccccccccccccc
Confidence                        11224888888888888888888876654210                                    


Q ss_pred             ----------ceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHH
Q psy3507          82 ----------PYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus        82 ----------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                                .-.++.++..+.++..-..+.+.-..+.-|.|..|..+|.+...|.+|+.
T Consensus       420 ~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin  479 (500)
T KOG3993|consen  420 EVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHIN  479 (500)
T ss_pred             ceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhh
Confidence                      01234444444444443344444344556899999999999999999974


No 22 
>PHA00616 hypothetical protein
Probab=98.65  E-value=8.9e-09  Score=50.91  Aligned_cols=32  Identities=16%  Similarity=0.318  Sum_probs=16.2

Q ss_pred             eeeCCCCCccCChHHHHHHHHHhcCCCceecc
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCE   86 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~   86 (134)
                      |+|+.||+.|...+.|..|++.|++++++.|+
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            44555555555555555555555555544443


No 23 
>PHA00616 hypothetical protein
Probab=98.58  E-value=2.8e-08  Score=49.17  Aligned_cols=34  Identities=12%  Similarity=0.143  Sum_probs=31.8

Q ss_pred             ceeccccCccccCchhHHHHhhhcCCCCCeecCc
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQ  115 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  115 (134)
                      ||+|+.||+.|...++|..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999998864


No 24 
>PHA00732 hypothetical protein
Probab=98.53  E-value=9.2e-08  Score=53.87  Aligned_cols=46  Identities=28%  Similarity=0.640  Sum_probs=39.2

Q ss_pred             ceeccccCccccCchhHHHHhhh-cCCCCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERK-HTGDKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      ||.|+.|++.|.+...|..|++. |.   ++.|+.||+.|.+   |..|+++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhccc
Confidence            58899999999999999999985 65   3689999999984   88887654


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.52  E-value=6e-08  Score=41.77  Aligned_cols=23  Identities=30%  Similarity=0.691  Sum_probs=17.9

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |.|+.|++.|.+...|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57788888888888888887765


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.34  E-value=9.3e-07  Score=46.28  Aligned_cols=47  Identities=26%  Similarity=0.528  Sum_probs=22.6

Q ss_pred             eeccccCccccCchhHHHHhhh-cCCC-CCeecCcChhhhcCHHHHHHHHHh
Q psy3507          83 YKCEYCAYSCTQSSALKIHERK-HTGD-KPYICQQCRDTFSSLYLFRNRLQS  132 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~-h~~~-~~~~C~~C~~~F~~~~~l~~H~~~  132 (134)
                      |.|+.|++ ..+...|..|... |..+ +.+.|++|...+.  .+|..|+..
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHH
Confidence            45555555 2334455555333 3332 3355555555433  255555543


No 27 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.31  E-value=4.8e-07  Score=53.06  Aligned_cols=73  Identities=23%  Similarity=0.373  Sum_probs=20.5

Q ss_pred             eeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507          56 TCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus        56 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      +|..|+..|.+...|..|+...++...   + ....+.....+..+++.-. ...+.|..|++.|.+...|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~-~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---P-DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccc---c-ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            488999999999999999975443211   1 1112223334444433222 23689999999999999999999764


No 28 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.29  E-value=1.7e-06  Score=45.30  Aligned_cols=50  Identities=24%  Similarity=0.460  Sum_probs=39.2

Q ss_pred             ceeeCCCCCccCChHHHHHHHHH-hcCC-CceeccccCccccCchhHHHHhhhcC
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRK-HTGE-KPYKCEYCAYSCTQSSALKIHERKHT  106 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~-~~~~C~~C~~~f~~~~~l~~H~~~h~  106 (134)
                      .|.|+.|++ ..+...|..|... |..+ +.+.|++|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            488999999 5677899999775 5543 5699999998654  48999988654


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.26  E-value=1e-06  Score=37.81  Aligned_cols=22  Identities=32%  Similarity=0.727  Sum_probs=13.5

Q ss_pred             eeeCCCCCccCChHHHHHHHHH
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRK   76 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~   76 (134)
                      |+|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.23  E-value=6.7e-07  Score=39.95  Aligned_cols=24  Identities=46%  Similarity=0.912  Sum_probs=19.8

Q ss_pred             CeecCcChhhhcCHHHHHHHHHhc
Q psy3507         110 PYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       110 ~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      ||+|..|++.|.+..+|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            578888888888888888888776


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.21  E-value=1.1e-06  Score=37.80  Aligned_cols=23  Identities=26%  Similarity=0.683  Sum_probs=15.9

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |.|+.|++.|.+...|+.|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777777777777777777765


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.93  E-value=1.3e-05  Score=34.34  Aligned_cols=23  Identities=26%  Similarity=0.686  Sum_probs=12.2

Q ss_pred             eeeCCCCCccCChHHHHHHHHHh
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKH   77 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h   77 (134)
                      |.|+.|++.|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45566666666666666665544


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.90  E-value=7.9e-06  Score=36.35  Aligned_cols=24  Identities=38%  Similarity=0.863  Sum_probs=13.5

Q ss_pred             ceeccccCccccCchhHHHHhhhc
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERKH  105 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~h  105 (134)
                      +|.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355555555555555555555544


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.89  E-value=3.4e-06  Score=58.49  Aligned_cols=52  Identities=33%  Similarity=0.692  Sum_probs=36.5

Q ss_pred             CCceeccc--cCccccCchhHHHHhhh-c------------------CCCCCeecCcChhhhcCHHHHHHHHH
Q psy3507          80 EKPYKCEY--CAYSCTQSSALKIHERK-H------------------TGDKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus        80 ~~~~~C~~--C~~~f~~~~~l~~H~~~-h------------------~~~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      ++||+|++  |++.+.....|+.|+.- |                  ...|||.|++|+|.|+....|+-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            36666655  66666666666666542 2                  23589999999999999888887753


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.84  E-value=1.6e-05  Score=34.62  Aligned_cols=23  Identities=26%  Similarity=0.746  Sum_probs=18.0

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46788888888888888888765


No 36 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.56  E-value=4.9e-05  Score=33.05  Aligned_cols=23  Identities=35%  Similarity=0.726  Sum_probs=15.9

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |.|..|++.|.+...|+.|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56777777777777777777543


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.56  E-value=2.8e-05  Score=54.07  Aligned_cols=54  Identities=30%  Similarity=0.605  Sum_probs=44.7

Q ss_pred             CCCcceeeCC--CCCccCChHHHHHHHHH-hc------------------CCCceeccccCccccCchhHHHHhh
Q psy3507          50 NISYKYTCYA--CDYHTLMSEDMKKHMRK-HT------------------GEKPYKCEYCAYSCTQSSALKIHER  103 (134)
Q Consensus        50 ~~~~~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~~~~~C~~C~~~f~~~~~l~~H~~  103 (134)
                      .++++|+|++  |.+.+.....|+.|+.- |.                  ..+||+|++|++.+.....|+.|+.
T Consensus       345 ~d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         345 KDGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ecCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            3458899988  99999999999999862 31                  2488999999999999999998854


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.39  E-value=0.00013  Score=46.55  Aligned_cols=38  Identities=29%  Similarity=0.771  Sum_probs=30.6

Q ss_pred             ceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCH
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSL  123 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~  123 (134)
                      +|.|. |+.   ....+..|.++|+++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58887 876   566788888889888889999998887643


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.37  E-value=0.00018  Score=36.55  Aligned_cols=27  Identities=26%  Similarity=0.373  Sum_probs=10.0

Q ss_pred             CceeccccCccccCchhHHHHhhhcCC
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHERKHTG  107 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~h~~  107 (134)
                      .|-.|++|+..+.+..+|.+|+...++
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhc
Confidence            334444444444444444444444333


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.36  E-value=0.00025  Score=30.56  Aligned_cols=22  Identities=32%  Similarity=0.581  Sum_probs=12.9

Q ss_pred             eeCCCCCccCChHHHHHHHHHh
Q psy3507          56 TCYACDYHTLMSEDMKKHMRKH   77 (134)
Q Consensus        56 ~C~~C~~~f~~~~~l~~H~~~h   77 (134)
                      .|+.|++.|.....|..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4556666666666666665544


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.19  E-value=0.00022  Score=30.93  Aligned_cols=21  Identities=29%  Similarity=0.692  Sum_probs=11.9

Q ss_pred             eeccccCccccCchhHHHHhh
Q psy3507          83 YKCEYCAYSCTQSSALKIHER  103 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~  103 (134)
                      |.|++|+..|.+...|..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345555555555555555554


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.09  E-value=0.00012  Score=32.54  Aligned_cols=21  Identities=24%  Similarity=0.672  Sum_probs=11.2

Q ss_pred             eecCcChhhhcCHHHHHHHHH
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            445555555555555555543


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.06  E-value=0.0012  Score=33.62  Aligned_cols=33  Identities=21%  Similarity=0.360  Sum_probs=23.2

Q ss_pred             CCCcceeeCCCCCccCChHHHHHHHHHhcCCCc
Q psy3507          50 NISYKYTCYACDYHTLMSEDMKKHMRKHTGEKP   82 (134)
Q Consensus        50 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   82 (134)
                      ..+.+-.|++|+..+....+|.+|+...++.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            345678999999999999999999988777665


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.01  E-value=0.00061  Score=29.20  Aligned_cols=22  Identities=27%  Similarity=0.578  Sum_probs=15.1

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |+|+.|+.... ...|.+|++.|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            67888887776 77888888764


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.97  E-value=0.00095  Score=28.59  Aligned_cols=22  Identities=36%  Similarity=1.013  Sum_probs=12.6

Q ss_pred             eeeCCCCCccCChHHHHHHHHHh
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKH   77 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h   77 (134)
                      |.|+.|+.... +..|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666666665 66666666654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.87  E-value=0.00086  Score=42.89  Aligned_cols=39  Identities=26%  Similarity=0.635  Sum_probs=33.8

Q ss_pred             cceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCc
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQS   95 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   95 (134)
                      .+|.|. |+.   ....+..|.++|.++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            469998 987   667889999999999999999999987654


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.75  E-value=0.00066  Score=30.05  Aligned_cols=22  Identities=23%  Similarity=0.548  Sum_probs=16.7

Q ss_pred             eeccccCccccCchhHHHHhhh
Q psy3507          83 YKCEYCAYSCTQSSALKIHERK  104 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (134)
                      |.|+.|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5678888888888888777664


No 48 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=96.71  E-value=0.0037  Score=37.42  Aligned_cols=89  Identities=18%  Similarity=0.399  Sum_probs=55.7

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHHhc-------CCCc-------eeccccCccccCchhHHHHhh
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHT-------GEKP-------YKCEYCAYSCTQSSALKIHER  103 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-------~~~~-------~~C~~C~~~f~~~~~l~~H~~  103 (134)
                      |.|+.|+...   -+.|-.|+.|+-.......|.+.-  |+       .+.+       -.|-.|...|........  .
T Consensus         2 Y~CPrC~skv---C~LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~   74 (112)
T TIGR00622         2 YFCPQCRAKV---CELPVECPICGLTLILSTHLARSY--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--D   74 (112)
T ss_pred             ccCCCCCCCc---cCCCCcCCcCCCEEeccchHHHhh--hccCCCcccccccccccCCCCcccCcCCCCCCcccccc--c
Confidence            7788887653   456778888888888877777532  21       0111       137778888876431110  0


Q ss_pred             hcCCCCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507         104 KHTGDKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       104 ~h~~~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      .-.....|+|+.|...|-..-+.-.|...|
T Consensus        75 ~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        75 ELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ccccccceeCCCCCCccccccchhhhhhcc
Confidence            012234688999988887777777776666


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.68  E-value=0.0015  Score=28.43  Aligned_cols=21  Identities=14%  Similarity=0.276  Sum_probs=14.0

Q ss_pred             eecCcChhhhcCHHHHHHHHHh
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQS  132 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~  132 (134)
                      ..|+.||+.| ..+.|.+|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577777777 56677777653


No 50 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.59  E-value=0.003  Score=36.64  Aligned_cols=23  Identities=30%  Similarity=0.736  Sum_probs=17.5

Q ss_pred             ceeccccCccccCchhHHHHhhh
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERK  104 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~  104 (134)
                      .+.|..|++.|.+...|..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            57888888888888888888775


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.08  E-value=0.0053  Score=28.65  Aligned_cols=22  Identities=23%  Similarity=0.535  Sum_probs=14.7

Q ss_pred             CeecCcChhhhcCHHHHHHHHH
Q psy3507         110 PYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       110 ~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +|.|..|++.|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777776667766663


No 52 
>KOG2893|consensus
Probab=96.00  E-value=0.0027  Score=42.85  Aligned_cols=48  Identities=23%  Similarity=0.439  Sum_probs=39.8

Q ss_pred             eeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHH-hhhcC
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIH-ERKHT  106 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~  106 (134)
                      -+|-+|++.|....-|.+|++.    +.|+|.+|.+.+.+.-.|..| +.+|.
T Consensus        11 pwcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             ceeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            4688999999999999998875    349999999988888888888 66553


No 53 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=95.87  E-value=0.012  Score=30.89  Aligned_cols=10  Identities=40%  Similarity=1.408  Sum_probs=6.5

Q ss_pred             CceeccccCc
Q psy3507          81 KPYKCEYCAY   90 (134)
Q Consensus        81 ~~~~C~~C~~   90 (134)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4577777764


No 54 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=95.21  E-value=0.018  Score=30.28  Aligned_cols=47  Identities=19%  Similarity=0.537  Sum_probs=22.8

Q ss_pred             cCCCCCCccc-CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCc
Q psy3507          39 HCKTCSTVSH-PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAY   90 (134)
Q Consensus        39 ~C~~C~~~f~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   90 (134)
                      .|.-||.... ......|.|+.||..--.+...-     .....+|.|+.||.
T Consensus        11 ~CtSCg~~i~p~e~~v~F~CPnCGe~~I~Rc~~C-----Rk~g~~Y~Cp~CGF   58 (61)
T COG2888          11 VCTSCGREIAPGETAVKFPCPNCGEVEIYRCAKC-----RKLGNPYRCPKCGF   58 (61)
T ss_pred             eeccCCCEeccCCceeEeeCCCCCceeeehhhhH-----HHcCCceECCCcCc
Confidence            4555555552 33334566666664333322211     11235677777774


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.11  E-value=0.021  Score=26.51  Aligned_cols=22  Identities=14%  Similarity=0.425  Sum_probs=15.0

Q ss_pred             ceeeCCCCCccCChHHHHHHHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      +|.|+.|++.|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777777777766654


No 56 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=95.01  E-value=0.02  Score=28.63  Aligned_cols=28  Identities=21%  Similarity=0.489  Sum_probs=15.9

Q ss_pred             cccCCCCCCcccCCCCc-ceeeCCCCCcc
Q psy3507          37 MYHCKTCSTVSHPNISY-KYTCYACDYHT   64 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~-~~~C~~C~~~f   64 (134)
                      .|.|+.||..|...... ...|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCCeE
Confidence            46677777766522221 56677776543


No 57 
>KOG2231|consensus
Probab=94.93  E-value=0.063  Score=41.69  Aligned_cols=91  Identities=22%  Similarity=0.400  Sum_probs=54.6

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHH-HhcCCCceeccccC---------ccccCchhHHHHhhhcC-
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMR-KHTGEKPYKCEYCA---------YSCTQSSALKIHERKHT-  106 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~---------~~f~~~~~l~~H~~~h~-  106 (134)
                      +.|.+|+..|...-. .-.|..| -.|.+...|+.|+. .|..   +.|.+|-         ...-+...|..|+..-- 
T Consensus       100 ~~C~~C~~~~~~~~~-~~~~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~  174 (669)
T KOG2231|consen  100 HSCHICDRRFRALYN-KKECLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDP  174 (669)
T ss_pred             hhcCccccchhhhcc-cCCCccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCC
Confidence            668888887742111 2357777 67778889999985 4432   3333322         12234466777765421 


Q ss_pred             CCCC----eecCcChhhhcCHHHHHHHHHhc
Q psy3507         107 GDKP----YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       107 ~~~~----~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      +++.    -.|..|...|.....|.+|++.+
T Consensus       175 d~~s~rGhp~C~~C~~~fld~~el~rH~~~~  205 (669)
T KOG2231|consen  175 DDESCRGHPLCKFCHERFLDDDELYRHLRFD  205 (669)
T ss_pred             ccccccCCccchhhhhhhccHHHHHHhhccc
Confidence            1222    35777888888888888887643


No 58 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.80  E-value=0.0058  Score=43.44  Aligned_cols=76  Identities=21%  Similarity=0.398  Sum_probs=40.3

Q ss_pred             ceeeCC--CCCccCChHHHHHHHHHhcCCCceeccccCc---------cccCchhHHHHhhhcCCCCCe----ecCcChh
Q psy3507          54 KYTCYA--CDYHTLMSEDMKKHMRKHTGEKPYKCEYCAY---------SCTQSSALKIHERKHTGDKPY----ICQQCRD  118 (134)
Q Consensus        54 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~---------~f~~~~~l~~H~~~h~~~~~~----~C~~C~~  118 (134)
                      .|.|+.  |.........|..|.++.++.  +.|.+|-.         ...++..|..|......+.-|    .|..|..
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            366665  555555667777787764432  44554432         122334455554432222122    4666666


Q ss_pred             hhcCHHHHHHHHH
Q psy3507         119 TFSSLYLFRNRLQ  131 (134)
Q Consensus       119 ~F~~~~~l~~H~~  131 (134)
                      .|..-..|.+|++
T Consensus       229 ~FYdDDEL~~HcR  241 (493)
T COG5236         229 YFYDDDELRRHCR  241 (493)
T ss_pred             eecChHHHHHHHH
Confidence            6666666666654


No 59 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.71  E-value=0.024  Score=26.26  Aligned_cols=9  Identities=33%  Similarity=1.283  Sum_probs=4.6

Q ss_pred             CCeecCcCh
Q psy3507         109 KPYICQQCR  117 (134)
Q Consensus       109 ~~~~C~~C~  117 (134)
                      .++.|+.||
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            345555554


No 60 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.56  E-value=0.026  Score=29.23  Aligned_cols=25  Identities=20%  Similarity=0.405  Sum_probs=13.0

Q ss_pred             CCCceeccccCccccCchhHHHHhh
Q psy3507          79 GEKPYKCEYCAYSCTQSSALKIHER  103 (134)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~  103 (134)
                      |+..+.|+.|+..|....++..|..
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhh
Confidence            4444555555555555555555543


No 61 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.53  E-value=0.029  Score=33.52  Aligned_cols=30  Identities=13%  Similarity=0.191  Sum_probs=22.9

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCCh
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMS   67 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~   67 (134)
                      ..|+.||++|.--+..|-.|+.||..|...
T Consensus        10 R~Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCCCCCccCCCCCCccCcc
Confidence            568888888886666777788888877665


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.30  E-value=0.012  Score=42.65  Aligned_cols=63  Identities=29%  Similarity=0.491  Sum_probs=51.9

Q ss_pred             cceeeCCCCCccCChHHHHHHHH--HhcCC--Cceecc--ccCccccCchhHHHHhhhcCCCCCeecCc
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMR--KHTGE--KPYKCE--YCAYSCTQSSALKIHERKHTGDKPYICQQ  115 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  115 (134)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.....+..|...|.+..++.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            46788888888888888888888  78888  888888  78888888888888888888777665543


No 63 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.23  E-value=0.0087  Score=43.39  Aligned_cols=54  Identities=33%  Similarity=0.615  Sum_probs=49.6

Q ss_pred             CceeccccCccccCchhHHHHhh--hcCCC--CCeecC--cChhhhcCHHHHHHHHHhcC
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHER--KHTGD--KPYICQ--QCRDTFSSLYLFRNRLQSHG  134 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~F~~~~~l~~H~~~H~  134 (134)
                      .++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.+...+..|..+|+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc
Confidence            36889999999999999999999  89999  999999  79999999999999988774


No 64 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=94.18  E-value=0.045  Score=27.21  Aligned_cols=26  Identities=23%  Similarity=0.608  Sum_probs=15.1

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      |.|..||..|.-....+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCce
Confidence            56666666665444445666666643


No 65 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=94.12  E-value=0.052  Score=25.70  Aligned_cols=10  Identities=20%  Similarity=0.673  Sum_probs=5.0

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      .|+.|+..|.
T Consensus         4 ~Cp~C~~~y~   13 (36)
T PF13717_consen    4 TCPNCQAKYE   13 (36)
T ss_pred             ECCCCCCEEe
Confidence            4555555544


No 66 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=94.00  E-value=0.05  Score=25.07  Aligned_cols=26  Identities=19%  Similarity=0.466  Sum_probs=13.5

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      |.|..||..+.-....+..|+.||..
T Consensus         1 Y~C~~Cg~~~~~~~~~~irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVELKPGDPIRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-BSTSSTSSBSSSS-S
T ss_pred             CCCCcCCCeeEcCCCCcEECCcCCCe
Confidence            45666666665444445566666643


No 67 
>KOG2893|consensus
Probab=93.99  E-value=0.011  Score=39.93  Aligned_cols=42  Identities=21%  Similarity=0.386  Sum_probs=34.1

Q ss_pred             eccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHH
Q psy3507          84 KCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNR  129 (134)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H  129 (134)
                      -|-.|++.|.....|.+|++    .+-|+|.+|-+...+-..|..|
T Consensus        12 wcwycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            47889999999999999987    4569999998877666666555


No 68 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.94  E-value=0.13  Score=27.12  Aligned_cols=41  Identities=22%  Similarity=0.673  Sum_probs=18.0

Q ss_pred             cCcccccccccCCCCccccCCCCCCccc------CCCCcceeeCCCC
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSH------PNISYKYTCYACD   61 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~------~~~~~~~~C~~C~   61 (134)
                      .|..|+.-+..-..--.|.|+.||+.--      .....+|+|+.||
T Consensus        11 ~CtSCg~~i~p~e~~v~F~CPnCGe~~I~Rc~~CRk~g~~Y~Cp~CG   57 (61)
T COG2888          11 VCTSCGREIAPGETAVKFPCPNCGEVEIYRCAKCRKLGNPYRCPKCG   57 (61)
T ss_pred             eeccCCCEeccCCceeEeeCCCCCceeeehhhhHHHcCCceECCCcC
Confidence            3444444333333333455666653322      2223355666555


No 69 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=93.93  E-value=0.054  Score=25.79  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=4.6

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      .|+.|+..|.
T Consensus         4 ~CP~C~~~~~   13 (38)
T TIGR02098         4 QCPNCKTSFR   13 (38)
T ss_pred             ECCCCCCEEE
Confidence            4444444443


No 70 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=93.87  E-value=0.14  Score=26.95  Aligned_cols=10  Identities=30%  Similarity=0.946  Sum_probs=4.6

Q ss_pred             cccCCCCCCc
Q psy3507          37 MYHCKTCSTV   46 (134)
Q Consensus        37 ~~~C~~C~~~   46 (134)
                      .|.|+.||+.
T Consensus        25 ~F~CPnCG~~   34 (59)
T PRK14890         25 KFLCPNCGEV   34 (59)
T ss_pred             EeeCCCCCCe
Confidence            3445555443


No 71 
>KOG1146|consensus
Probab=93.68  E-value=0.02  Score=47.18  Aligned_cols=70  Identities=29%  Similarity=0.548  Sum_probs=43.8

Q ss_pred             cceeeCCCCCccCChHHHHHHHHH-hcCCCceeccccCccccCchhHHHHhhh------cCCCCCeecCcChhhhcCHHH
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMRK-HTGEKPYKCEYCAYSCTQSSALKIHERK------HTGDKPYICQQCRDTFSSLYL  125 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~------h~~~~~~~C~~C~~~F~~~~~  125 (134)
                      +.+.|+.|+..|.....|..||+. |.....   .+|.       ..+.|.+.      -.+.++|.|..|...+....+
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~-------~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~  533 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCK-------AGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGN  533 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccch---hHhH-------hccccccccccccccCCCCcccceeeeeeeecchH
Confidence            557777777777777777777775 322111   1221       11112111      123468999999999999999


Q ss_pred             HHHHHHh
Q psy3507         126 FRNRLQS  132 (134)
Q Consensus       126 l~~H~~~  132 (134)
                      |.+|++.
T Consensus       534 LsihlqS  540 (1406)
T KOG1146|consen  534 LSIHLQS  540 (1406)
T ss_pred             HHHHHHH
Confidence            9999863


No 72 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.55  E-value=0.068  Score=25.45  Aligned_cols=10  Identities=20%  Similarity=0.617  Sum_probs=4.3

Q ss_pred             eeccccCccc
Q psy3507          83 YKCEYCAYSC   92 (134)
Q Consensus        83 ~~C~~C~~~f   92 (134)
                      ..|+.|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4444444433


No 73 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.92  E-value=0.082  Score=24.67  Aligned_cols=24  Identities=17%  Similarity=0.470  Sum_probs=11.8

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      |.|..||..+.- .+.+..|++|+.
T Consensus         3 ~~C~~CG~i~~g-~~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEG-EEAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeEC-CcCCCcCcCCCC
Confidence            556666655431 123445655554


No 74 
>KOG2186|consensus
Probab=92.80  E-value=0.084  Score=36.07  Aligned_cols=51  Identities=22%  Similarity=0.415  Sum_probs=35.7

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCC
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTG  107 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  107 (134)
                      .|.|..||....- ..+.+|+..=.+ ..|.|..|++.|.. .++..|..--+.
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITE   53 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITE   53 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcch
Confidence            4788888876654 445668775544 56889999998888 567777664443


No 75 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=92.56  E-value=0.11  Score=22.68  Aligned_cols=9  Identities=33%  Similarity=0.851  Sum_probs=4.6

Q ss_pred             eeCCCCCcc
Q psy3507          56 TCYACDYHT   64 (134)
Q Consensus        56 ~C~~C~~~f   64 (134)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            355555554


No 76 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=92.52  E-value=0.093  Score=25.71  Aligned_cols=25  Identities=20%  Similarity=0.509  Sum_probs=13.5

Q ss_pred             ccCCCCCCccc----CCCCcceeeCCCCC
Q psy3507          38 YHCKTCSTVSH----PNISYKYTCYACDY   62 (134)
Q Consensus        38 ~~C~~C~~~f~----~~~~~~~~C~~C~~   62 (134)
                      |.|..||..|.    -.....-.|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            56666666665    11134455666654


No 77 
>KOG1146|consensus
Probab=92.42  E-value=0.038  Score=45.67  Aligned_cols=19  Identities=16%  Similarity=0.378  Sum_probs=12.4

Q ss_pred             cCcChhhhcCHHHHHHHHH
Q psy3507         113 CQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       113 C~~C~~~F~~~~~l~~H~~  131 (134)
                      |..|...|.....|+.||+
T Consensus      1331 c~~c~~~~~~~~alqihm~ 1349 (1406)
T KOG1146|consen 1331 CLACEVLLSGREALQIHMR 1349 (1406)
T ss_pred             chHHHhhcchhHHHHHHHH
Confidence            6666666666666666664


No 78 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=92.38  E-value=0.15  Score=21.85  Aligned_cols=8  Identities=25%  Similarity=1.011  Sum_probs=3.2

Q ss_pred             ceeeCCCC
Q psy3507          54 KYTCYACD   61 (134)
Q Consensus        54 ~~~C~~C~   61 (134)
                      .|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            34444443


No 79 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=92.36  E-value=0.11  Score=25.01  Aligned_cols=25  Identities=24%  Similarity=0.486  Sum_probs=12.7

Q ss_pred             ccCCCCCCccc----CCCCcceeeCCCCC
Q psy3507          38 YHCKTCSTVSH----PNISYKYTCYACDY   62 (134)
Q Consensus        38 ~~C~~C~~~f~----~~~~~~~~C~~C~~   62 (134)
                      |.|..||..|.    ......-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKISDDPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecCCCCCCCCCCCCC
Confidence            56666666655    11123345666654


No 80 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.28  E-value=0.11  Score=31.72  Aligned_cols=34  Identities=9%  Similarity=-0.131  Sum_probs=25.8

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCChHHHH
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMK   71 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~   71 (134)
                      ..|+.||++|.--+..|..|+.||..|.....++
T Consensus        10 r~Cp~cg~kFYDLnk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300        10 RICPNTGSKFYDLNRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             ccCCCcCccccccCCCCccCCCcCCccCcchhhc
Confidence            5688889888877777888888888876654433


No 81 
>KOG2907|consensus
Probab=91.96  E-value=0.13  Score=30.70  Aligned_cols=30  Identities=23%  Similarity=0.424  Sum_probs=21.6

Q ss_pred             eecCcccccccccCCCCccccCCCCCCccc
Q psy3507          19 LATCIHCRLLLVPTAEELMYHCKTCSTVSH   48 (134)
Q Consensus        19 ~~~C~~C~~h~~~h~~~~~~~C~~C~~~f~   48 (134)
                      ..-|..|+..+..........|..|+..+.
T Consensus         7 ~~FC~~CG~ll~~~~~~~~~~C~~Ck~~~~   36 (116)
T KOG2907|consen    7 LDFCSDCGSLLEEPSAQSTVLCIRCKIEYP   36 (116)
T ss_pred             cchhhhhhhhcccccccCceEeccccccCC
Confidence            456777877666666666677888888776


No 82 
>KOG2482|consensus
Probab=91.66  E-value=0.2  Score=35.86  Aligned_cols=79  Identities=22%  Similarity=0.325  Sum_probs=55.8

Q ss_pred             ceeeCCCCCccCChHHHHHHHHH--hcCC---------------------------------------------------
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRK--HTGE---------------------------------------------------   80 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~--h~~~---------------------------------------------------   80 (134)
                      .+.|-.|.+.|..+..|+.||+.  |..-                                                   
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            48899999999999999999973  3210                                                   


Q ss_pred             -Cc--eeccccCccccCchhHHHHhhh-cCC--------------------------CCCeecCcChhhhcCHHHHHHHH
Q psy3507          81 -KP--YKCEYCAYSCTQSSALKIHERK-HTG--------------------------DKPYICQQCRDTFSSLYLFRNRL  130 (134)
Q Consensus        81 -~~--~~C~~C~~~f~~~~~l~~H~~~-h~~--------------------------~~~~~C~~C~~~F~~~~~l~~H~  130 (134)
                       .+  ..|-.|.....+...|..|+.. |.-                          ...-.|-.|.-.|.....|..||
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence             11  3677788877778888888774 310                          11235777888888888888887


Q ss_pred             Hh
Q psy3507         131 QS  132 (134)
Q Consensus       131 ~~  132 (134)
                      ..
T Consensus       355 ~e  356 (423)
T KOG2482|consen  355 VE  356 (423)
T ss_pred             cc
Confidence            53


No 83 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=91.47  E-value=0.12  Score=32.93  Aligned_cols=13  Identities=23%  Similarity=0.391  Sum_probs=6.7

Q ss_pred             eeeCCCCCccCCh
Q psy3507          55 YTCYACDYHTLMS   67 (134)
Q Consensus        55 ~~C~~C~~~f~~~   67 (134)
                      ++|+.||.+|.+.
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            5555555555443


No 84 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.20  E-value=0.42  Score=28.73  Aligned_cols=49  Identities=16%  Similarity=0.307  Sum_probs=30.5

Q ss_pred             eeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcC
Q psy3507          56 TCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHT  106 (134)
Q Consensus        56 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  106 (134)
                      .|--|...|........-  .-.....|+|+.|...|--.-++..|...|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCccccccc--ccccccceeCCCCCCccccccchhhhhhccC
Confidence            477888877654311100  0122346888888888888888888865553


No 85 
>KOG2231|consensus
Probab=91.13  E-value=0.29  Score=38.23  Aligned_cols=71  Identities=24%  Similarity=0.525  Sum_probs=47.7

Q ss_pred             eeeCCCCCccCChHHHHHHHHHhcCCCceeccccC------ccccCchhHHHHhhhcCCCCCeecC--cCh-hhhcCHHH
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCA------YSCTQSSALKIHERKHTGDKPYICQ--QCR-DTFSSLYL  125 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~------~~f~~~~~l~~H~~~h~~~~~~~C~--~C~-~~F~~~~~  125 (134)
                      -.|..|...|.....|..|++.++    |.|..|+      .-|.....|..|.+.++    |.|+  .|. +.|.....
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~  254 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFE  254 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhH
Confidence            568899999999999999888654    5666663      45667788888877544    5666  453 34444445


Q ss_pred             HHHHHHhc
Q psy3507         126 FRNRLQSH  133 (134)
Q Consensus       126 l~~H~~~H  133 (134)
                      +..+++.|
T Consensus       255 ~ei~lk~~  262 (669)
T KOG2231|consen  255 LEIELKAH  262 (669)
T ss_pred             HHHHHHhh
Confidence            55665543


No 86 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=91.06  E-value=0.079  Score=35.62  Aligned_cols=12  Identities=17%  Similarity=0.642  Sum_probs=8.9

Q ss_pred             eecCcChhhhcC
Q psy3507         111 YICQQCRDTFSS  122 (134)
Q Consensus       111 ~~C~~C~~~F~~  122 (134)
                      ..|+.||.+|..
T Consensus        49 ~vCP~CgyA~~~   60 (214)
T PF09986_consen   49 WVCPHCGYAAFE   60 (214)
T ss_pred             EECCCCCCcccc
Confidence            478888887754


No 87 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=90.74  E-value=0.16  Score=23.00  Aligned_cols=24  Identities=17%  Similarity=0.375  Sum_probs=9.6

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCC
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      +|+.|+..+.......+.|+.|+.
T Consensus         4 ~Cp~C~se~~y~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTYEDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----EE-SSSEEETTTTE
T ss_pred             CCCCCCCcceeccCCEEeCCcccc
Confidence            466666666655555566666654


No 88 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=90.63  E-value=0.18  Score=25.73  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=5.4

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            44555555444


No 89 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.39  E-value=0.27  Score=33.11  Aligned_cols=14  Identities=14%  Similarity=0.406  Sum_probs=10.1

Q ss_pred             CccccCCCCCCccc
Q psy3507          35 ELMYHCKTCSTVSH   48 (134)
Q Consensus        35 ~~~~~C~~C~~~f~   48 (134)
                      ++.+.|+.|+..|.
T Consensus         3 ~k~~~CPvC~~~F~   16 (214)
T PF09986_consen    3 DKKITCPVCGKEFK   16 (214)
T ss_pred             CCceECCCCCCeee
Confidence            35577888888777


No 90 
>KOG4173|consensus
Probab=90.15  E-value=0.11  Score=34.42  Aligned_cols=73  Identities=21%  Similarity=0.489  Sum_probs=40.7

Q ss_pred             eeeCC--CCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHHhhh-c---------CCCCCeecCc--Chhhh
Q psy3507          55 YTCYA--CDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERK-H---------TGDKPYICQQ--CRDTF  120 (134)
Q Consensus        55 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h---------~~~~~~~C~~--C~~~F  120 (134)
                      +.|++  |...|........|-.+-++   -.|..|.+.|.+...|..|+.. |         .|..-|+|-+  |+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            44554  44556555555555443222   2566677777766666666542 2         2333366643  77777


Q ss_pred             cCHHHHHHHH
Q psy3507         121 SSLYLFRNRL  130 (134)
Q Consensus       121 ~~~~~l~~H~  130 (134)
                      .+...-..|+
T Consensus       157 kT~r~RkdH~  166 (253)
T KOG4173|consen  157 KTSRDRKDHM  166 (253)
T ss_pred             hhhhhhhhHH
Confidence            6666666664


No 91 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.09  E-value=0.31  Score=23.94  Aligned_cols=22  Identities=18%  Similarity=0.341  Sum_probs=10.8

Q ss_pred             CCeecCcChhhhcCH----HHHHHHH
Q psy3507         109 KPYICQQCRDTFSSL----YLFRNRL  130 (134)
Q Consensus       109 ~~~~C~~C~~~F~~~----~~l~~H~  130 (134)
                      ....|..|++.+...    +.|.+|+
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            345666666665543    5666666


No 92 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.96  E-value=0.19  Score=26.10  Aligned_cols=29  Identities=17%  Similarity=0.212  Sum_probs=24.7

Q ss_pred             CCCCcceeeCCCCCccCChHHHHHHHHHh
Q psy3507          49 PNISYKYTCYACDYHTLMSEDMKKHMRKH   77 (134)
Q Consensus        49 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h   77 (134)
                      ..++..+.|+-|+..|....++.+|...-
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            45677799999999999999999998743


No 93 
>PF14353 CpXC:  CpXC protein
Probab=89.63  E-value=0.28  Score=30.08  Aligned_cols=10  Identities=20%  Similarity=0.587  Sum_probs=5.8

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      +|+.|+..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            4666666555


No 94 
>PHA00626 hypothetical protein
Probab=89.51  E-value=0.42  Score=24.87  Aligned_cols=11  Identities=36%  Similarity=1.198  Sum_probs=5.2

Q ss_pred             ceeeCCCCCcc
Q psy3507          54 KYTCYACDYHT   64 (134)
Q Consensus        54 ~~~C~~C~~~f   64 (134)
                      .|+|+.|+..|
T Consensus        23 rYkCkdCGY~f   33 (59)
T PHA00626         23 DYVCCDCGYND   33 (59)
T ss_pred             ceEcCCCCCee
Confidence            34444444444


No 95 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=89.31  E-value=0.4  Score=33.95  Aligned_cols=91  Identities=22%  Similarity=0.413  Sum_probs=55.8

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHHhc-----CCC-------ceeccccCccccCchhHHHHhhhc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHT-----GEK-------PYKCEYCAYSCTQSSALKIHERKH  105 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-----~~~-------~~~C~~C~~~f~~~~~l~~H~~~h  105 (134)
                      |.|+.|....   -..|..|+.|+-.......|.+-..--.     .++       .-.|-.|...|.....-..-  .-
T Consensus       309 y~CP~CktkV---CsLPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~--~~  383 (421)
T COG5151         309 YECPVCKTKV---CSLPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFD--ES  383 (421)
T ss_pred             eeCCccccee---ecCCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCccc--cc
Confidence            8888887653   4567889999877666666654321100     111       12377777777664321111  11


Q ss_pred             CCCCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507         106 TGDKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       106 ~~~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      +..-.|+|+.|...|-.--+.-.|...|
T Consensus       384 ~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         384 TSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccccceechhhhhhhhhhhHHHHHHHHh
Confidence            2234599999999998887777777665


No 96 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.96  E-value=0.28  Score=31.60  Aligned_cols=24  Identities=17%  Similarity=0.445  Sum_probs=15.4

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      .|.|+.||..+.  ++.|-+||+|+-
T Consensus       134 ~~vC~vCGy~~~--ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTHE--GEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCccc--CCCCCcCCCCCC
Confidence            477777776643  356667777763


No 97 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.91  E-value=0.52  Score=30.16  Aligned_cols=31  Identities=16%  Similarity=0.400  Sum_probs=20.8

Q ss_pred             CCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhh
Q psy3507          80 EKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDT  119 (134)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  119 (134)
                      ..-|.|+.|+..|+...++.         .-|.|+.||..
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            34577887877777666653         25788888764


No 98 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=88.41  E-value=0.48  Score=29.91  Aligned_cols=36  Identities=17%  Similarity=0.384  Sum_probs=19.0

Q ss_pred             cceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccc
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSC   92 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   92 (134)
                      .-|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            34667777666665443321   011 2337777777654


No 99 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=87.78  E-value=0.34  Score=24.42  Aligned_cols=11  Identities=36%  Similarity=0.963  Sum_probs=6.5

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      |+|..||.++.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            55666665555


No 100
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=87.08  E-value=0.38  Score=24.36  Aligned_cols=21  Identities=24%  Similarity=0.448  Sum_probs=12.7

Q ss_pred             eecCcChhhhcCH-----HHHHHHHH
Q psy3507         111 YICQQCRDTFSSL-----YLFRNRLQ  131 (134)
Q Consensus       111 ~~C~~C~~~F~~~-----~~l~~H~~  131 (134)
                      -.|..|++.+...     +.|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666655443     56777776


No 101
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=86.82  E-value=0.42  Score=24.41  Aligned_cols=11  Identities=27%  Similarity=1.011  Sum_probs=7.2

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      |+|..||..|.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56666666665


No 102
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=86.70  E-value=0.48  Score=24.05  Aligned_cols=28  Identities=18%  Similarity=0.487  Sum_probs=15.9

Q ss_pred             ccccCCCCCCccc-CCCCcceeeCCCCCc
Q psy3507          36 LMYHCKTCSTVSH-PNISYKYTCYACDYH   63 (134)
Q Consensus        36 ~~~~C~~C~~~f~-~~~~~~~~C~~C~~~   63 (134)
                      ..|.|..||+.|. ........|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELDQETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehhhccCceeCCCCCcE
Confidence            3466666666665 233344666666643


No 103
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=86.67  E-value=0.5  Score=37.51  Aligned_cols=40  Identities=20%  Similarity=0.407  Sum_probs=29.8

Q ss_pred             ecCcccccccccCCCCccccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          20 ATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        20 ~~C~~C~~h~~~h~~~~~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      .+|..|..-+..|.......|..||..    ...+..|+.||..
T Consensus       445 ~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~----~~~p~~Cp~Cgs~  484 (730)
T COG1198         445 AECPNCDSPLTLHKATGQLRCHYCGYQ----EPIPQSCPECGSE  484 (730)
T ss_pred             ccCCCCCcceEEecCCCeeEeCCCCCC----CCCCCCCCCCCCC
Confidence            456667777777777778888888875    4567788888865


No 104
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=86.65  E-value=0.39  Score=27.40  Aligned_cols=30  Identities=13%  Similarity=0.244  Sum_probs=16.2

Q ss_pred             cccCCCCCCccc-CCCCcceeeCCCCCccCC
Q psy3507          37 MYHCKTCSTVSH-PNISYKYTCYACDYHTLM   66 (134)
Q Consensus        37 ~~~C~~C~~~f~-~~~~~~~~C~~C~~~f~~   66 (134)
                      .|.|+.|++.-. ......+.|..|+..|..
T Consensus        35 ~~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          35 KHVCPFCGRTTVKRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CCcCCCCCCcceeeeccCeEEcCCCCCeecc
Confidence            366666665522 233334666666666654


No 105
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=86.40  E-value=0.62  Score=23.76  Aligned_cols=24  Identities=21%  Similarity=0.605  Sum_probs=10.1

Q ss_pred             CCCCCCcccCCCCcceeeCCCCCc
Q psy3507          40 CKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        40 C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      |+.||..|.......+.|..|+..
T Consensus        23 CP~Cg~~~m~~~~~r~~C~~Cgyt   46 (50)
T PRK00432         23 CPRCGSGFMAEHLDRWHCGKCGYT   46 (50)
T ss_pred             CcCCCcchheccCCcEECCCcCCE
Confidence            455544333222234445555443


No 106
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=86.21  E-value=0.61  Score=29.86  Aligned_cols=32  Identities=16%  Similarity=0.329  Sum_probs=22.0

Q ss_pred             CcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccc
Q psy3507          52 SYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSC   92 (134)
Q Consensus        52 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   92 (134)
                      ..-|.|+.|+..|+...++.         .-|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            34577888887777777664         147888888643


No 107
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=85.70  E-value=0.83  Score=29.88  Aligned_cols=30  Identities=23%  Similarity=0.532  Sum_probs=17.6

Q ss_pred             CceeccccCccccCchhHHHHhhhcCCCCCeecCcChhh
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDT  119 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  119 (134)
                      .-|.|+.|+..|+...++.         .-|.|+.||..
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            3466777776666554432         24677777654


No 108
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=85.68  E-value=0.56  Score=29.10  Aligned_cols=23  Identities=26%  Similarity=0.723  Sum_probs=15.7

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      +....|-+||+.|..   |.+|+++|
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~   92 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTH   92 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHT
T ss_pred             cCeeEEccCCcccch---HHHHHHHc
Confidence            344789999999987   69999888


No 109
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=85.60  E-value=0.61  Score=35.49  Aligned_cols=39  Identities=23%  Similarity=0.488  Sum_probs=30.6

Q ss_pred             cCcccccccccCCCCccccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      .|..|...+..|.......|..||...    ..+..|+.|+..
T Consensus       224 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~----~~~~~Cp~C~s~  262 (505)
T TIGR00595       224 CCPNCDVSLTYHKKEGKLRCHYCGYQE----PIPKTCPQCGSE  262 (505)
T ss_pred             CCCCCCCceEEecCCCeEEcCCCcCcC----CCCCCCCCCCCC
Confidence            577777788888888889999999763    346789999864


No 110
>KOG2785|consensus
Probab=85.52  E-value=1  Score=32.81  Aligned_cols=78  Identities=17%  Similarity=0.303  Sum_probs=42.0

Q ss_pred             ceeeCCCCCccCChHHHHHHHHH--hcC---CCceec-cccCccccCchhHHHH-hh--hcCCCCCeecCcChhhhcCHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRK--HTG---EKPYKC-EYCAYSCTQSSALKIH-ER--KHTGDKPYICQQCRDTFSSLY  124 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~--h~~---~~~~~C-~~C~~~f~~~~~l~~H-~~--~h~~~~~~~C~~C~~~F~~~~  124 (134)
                      .|.|..|...|.+....+.|+++  |.-   .+...= ++-...|..+..-..- ..  .-.++-++.|..|.+.|.+..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            47899999999999888889873  421   000000 1111222221111000 00  122344577777777777777


Q ss_pred             HHHHHHH
Q psy3507         125 LFRNRLQ  131 (134)
Q Consensus       125 ~l~~H~~  131 (134)
                      ....|+.
T Consensus        83 a~~~hl~   89 (390)
T KOG2785|consen   83 AHENHLK   89 (390)
T ss_pred             hHHHHHH
Confidence            7777764


No 111
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=85.48  E-value=0.88  Score=23.72  Aligned_cols=40  Identities=20%  Similarity=0.513  Sum_probs=22.2

Q ss_pred             Cceeccc--cCccccCchhHHHHhhhcCCCCCeecCc----Chhhhc
Q psy3507          81 KPYKCEY--CAYSCTQSSALKIHERKHTGDKPYICQQ----CRDTFS  121 (134)
Q Consensus        81 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~F~  121 (134)
                      .+..|+.  |...+. +..|..|+..--..++..|+.    |+..+.
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            4566766  444343 456778877655566777887    777665


No 112
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=85.21  E-value=0.56  Score=30.65  Aligned_cols=31  Identities=19%  Similarity=0.501  Sum_probs=19.2

Q ss_pred             cceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccc
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSC   92 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   92 (134)
                      .-|.|+.|+..|....++.         .-|.|+.||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            3467777777766665542         247777777643


No 113
>COG1773 Rubredoxin [Energy production and conversion]
Probab=84.91  E-value=0.58  Score=24.35  Aligned_cols=12  Identities=25%  Similarity=0.736  Sum_probs=9.1

Q ss_pred             cccCCCCCCccc
Q psy3507          37 MYHCKTCSTVSH   48 (134)
Q Consensus        37 ~~~C~~C~~~f~   48 (134)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            477888888776


No 114
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.81  E-value=2.4  Score=26.71  Aligned_cols=38  Identities=24%  Similarity=0.552  Sum_probs=25.7

Q ss_pred             CCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhh
Q psy3507          79 GEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTF  120 (134)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F  120 (134)
                      +...|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            3456999999999886544332   011 3349999999765


No 115
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=83.73  E-value=0.8  Score=27.25  Aligned_cols=30  Identities=20%  Similarity=0.386  Sum_probs=24.2

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCChH
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLMSE   68 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~   68 (134)
                      .|+.|+..|.......|.|+.|+..+....
T Consensus         4 ~CP~C~seytY~dg~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686         4 PCPKCNSEYTYHDGTQLICPSCLYEWNENE   33 (109)
T ss_pred             cCCcCCCcceEecCCeeECccccccccccc
Confidence            588999988877777899999998876553


No 116
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=83.49  E-value=0.78  Score=28.58  Aligned_cols=11  Identities=18%  Similarity=0.676  Sum_probs=5.8

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      +.|..||..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            55555555544


No 117
>KOG4167|consensus
Probab=83.38  E-value=0.37  Score=37.89  Aligned_cols=24  Identities=17%  Similarity=0.524  Sum_probs=22.3

Q ss_pred             CeecCcChhhhcCHHHHHHHHHhc
Q psy3507         110 PYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       110 ~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      -|.|..|+|.|..-.++..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            399999999999999999999998


No 118
>KOG2807|consensus
Probab=83.38  E-value=2.1  Score=30.63  Aligned_cols=34  Identities=21%  Similarity=0.488  Sum_probs=27.4

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHH
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKH   73 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H   73 (134)
                      -|.|+.|+...   -+.|-+|+.|+-.......|.+-
T Consensus       276 Gy~CP~Ckakv---CsLP~eCpiC~ltLVss~hLARS  309 (378)
T KOG2807|consen  276 GYFCPQCKAKV---CSLPIECPICSLTLVSSPHLARS  309 (378)
T ss_pred             ceeCCcccCee---ecCCccCCccceeEecchHHHHH
Confidence            38899998764   55788999999998888888754


No 119
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=83.26  E-value=0.34  Score=26.77  Aligned_cols=41  Identities=15%  Similarity=0.292  Sum_probs=20.1

Q ss_pred             eeeCCCCCccCChHHHHHHHHHhcCCCceecc--ccCccccCchh
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCE--YCAYSCTQSSA   97 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~~   97 (134)
                      +.|+.|+........-....  -..+..++|.  .||..|.....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~--~~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD--TTKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh--hhheeeeecCCCCCCCEEEEEEE
Confidence            45777775543222221111  1233456676  67777766543


No 120
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=83.00  E-value=1.3  Score=19.17  Aligned_cols=19  Identities=21%  Similarity=0.419  Sum_probs=10.6

Q ss_pred             ecCcChhhhcCHHHHHHHHH
Q psy3507         112 ICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       112 ~C~~C~~~F~~~~~l~~H~~  131 (134)
                      .|+.|++.+ ....+.+|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666665 4455555553


No 121
>PRK10220 hypothetical protein; Provisional
Probab=82.90  E-value=1.1  Score=26.64  Aligned_cols=30  Identities=23%  Similarity=0.407  Sum_probs=24.3

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCChH
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLMSE   68 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~   68 (134)
                      .|+.|+..|.......|.|+.|+..+...+
T Consensus         5 ~CP~C~seytY~d~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220          5 HCPKCNSEYTYEDNGMYICPECAHEWNDAE   34 (111)
T ss_pred             cCCCCCCcceEcCCCeEECCcccCcCCccc
Confidence            588999888877777899999998776654


No 122
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=82.90  E-value=1.1  Score=23.27  Aligned_cols=11  Identities=18%  Similarity=0.776  Sum_probs=4.9

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      ++|+.||..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            34444444443


No 123
>KOG2186|consensus
Probab=82.85  E-value=0.87  Score=31.32  Aligned_cols=21  Identities=19%  Similarity=0.445  Sum_probs=11.4

Q ss_pred             ceeeCCCCCccCChHHHHHHHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      .|.|-.|++.|.. ..+..|..
T Consensus        29 ~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen   29 YFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             eeEEeeccccccc-chhhhhhh
Confidence            3556666666655 44455544


No 124
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=82.80  E-value=0.86  Score=27.19  Aligned_cols=28  Identities=0%  Similarity=-0.441  Sum_probs=22.7

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCC
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~   66 (134)
                      .|+.||+.|.--...|..|++||++|..
T Consensus        11 idPetg~KFYDLNrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYDLNRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhccCCCccccCcccccchH
Confidence            4788888888777788889999988843


No 125
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=81.86  E-value=1.3  Score=21.57  Aligned_cols=8  Identities=25%  Similarity=0.820  Sum_probs=3.3

Q ss_pred             eeeCCCCC
Q psy3507          55 YTCYACDY   62 (134)
Q Consensus        55 ~~C~~C~~   62 (134)
                      +.|..||.
T Consensus        20 ~vC~~CG~   27 (43)
T PF08271_consen   20 LVCPNCGL   27 (43)
T ss_dssp             EEETTT-B
T ss_pred             EECCCCCC
Confidence            44555543


No 126
>PF14369 zf-RING_3:  zinc-finger
Probab=81.71  E-value=1.4  Score=20.62  Aligned_cols=8  Identities=25%  Similarity=0.617  Sum_probs=4.4

Q ss_pred             CCCCCCcc
Q psy3507          40 CKTCSTVS   47 (134)
Q Consensus        40 C~~C~~~f   47 (134)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555544


No 127
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=81.56  E-value=1.2  Score=30.80  Aligned_cols=88  Identities=19%  Similarity=0.336  Sum_probs=46.8

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHH--hcCCCceeccccCccccCchh-------HHHHhhh----c
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRK--HTGEKPYKCEYCAYSCTQSSA-------LKIHERK----H  105 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~--h~~~~~~~C~~C~~~f~~~~~-------l~~H~~~----h  105 (134)
                      .|-+|.+..-..+.+.|.|..|....-....+ .|+..  -.....|+|..|++. .+.+-       -..|.+.    .
T Consensus       127 ~C~EC~R~vw~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrl-Gq~sCLRCK~cfCddHvrrKg~ky  204 (314)
T PF06524_consen  127 VCIECERGVWDHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRL-GQYSCLRCKICFCDDHVRRKGFKY  204 (314)
T ss_pred             EeeeeecccccCCCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccc-cchhhhheeeeehhhhhhhccccc
Confidence            45556555556667788888887654443333 34431  222344677666642 11111       2244432    2


Q ss_pred             CCCCCeecCcChhhhcCHHHHHH
Q psy3507         106 TGDKPYICQQCRDTFSSLYLFRN  128 (134)
Q Consensus       106 ~~~~~~~C~~C~~~F~~~~~l~~  128 (134)
                      ...+++.|+.||..-.....|..
T Consensus       205 ~k~k~~PCPKCg~et~eTkdLSm  227 (314)
T PF06524_consen  205 EKGKPIPCPKCGYETQETKDLSM  227 (314)
T ss_pred             ccCCCCCCCCCCCccccccccee
Confidence            23467889999876555444443


No 128
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=81.21  E-value=1.8  Score=34.55  Aligned_cols=8  Identities=25%  Similarity=1.057  Sum_probs=4.4

Q ss_pred             cCCCCCCc
Q psy3507          39 HCKTCSTV   46 (134)
Q Consensus        39 ~C~~C~~~   46 (134)
                      .|..||..
T Consensus       437 ~C~~Cg~v  444 (730)
T COG1198         437 LCRDCGYI  444 (730)
T ss_pred             ecccCCCc
Confidence            45556554


No 129
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=81.07  E-value=0.97  Score=27.28  Aligned_cols=27  Identities=19%  Similarity=0.309  Sum_probs=16.2

Q ss_pred             ccccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          36 LMYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        36 ~~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      -...|..||..|.......+.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~~CP~Cgs   95 (114)
T PRK03681         69 AECWCETCQQYVTLLTQRVRRCPQCHG   95 (114)
T ss_pred             cEEEcccCCCeeecCCccCCcCcCcCC
Confidence            346677777766544333356777774


No 130
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=80.97  E-value=0.39  Score=22.69  Aligned_cols=10  Identities=30%  Similarity=0.923  Sum_probs=5.0

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      .|+.||++|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            3555555554


No 131
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=80.11  E-value=0.85  Score=28.26  Aligned_cols=20  Identities=30%  Similarity=0.629  Sum_probs=17.1

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      ..|-++|+.|.+   |++|+.+|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~   96 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTH   96 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcc
Confidence            679999999875   89999886


No 132
>PRK04023 DNA polymerase II large subunit; Validated
Probab=80.09  E-value=2.5  Score=34.90  Aligned_cols=8  Identities=38%  Similarity=0.899  Sum_probs=3.9

Q ss_pred             eeccccCc
Q psy3507          83 YKCEYCAY   90 (134)
Q Consensus        83 ~~C~~C~~   90 (134)
                      +.|+.|+.
T Consensus       664 y~CPKCG~  671 (1121)
T PRK04023        664 DECEKCGR  671 (1121)
T ss_pred             CcCCCCCC
Confidence            34555554


No 133
>PRK14873 primosome assembly protein PriA; Provisional
Probab=79.87  E-value=1.5  Score=34.71  Aligned_cols=39  Identities=23%  Similarity=0.463  Sum_probs=29.1

Q ss_pred             ecCcccccccccCCCCccccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          20 ATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        20 ~~C~~C~~h~~~h~~~~~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      ..|..|...+..|.......|..||..    . .+..|+.|+..
T Consensus       393 ~~C~~C~~~L~~h~~~~~l~Ch~CG~~----~-~p~~Cp~Cgs~  431 (665)
T PRK14873        393 ARCRHCTGPLGLPSAGGTPRCRWCGRA----A-PDWRCPRCGSD  431 (665)
T ss_pred             eECCCCCCceeEecCCCeeECCCCcCC----C-cCccCCCCcCC
Confidence            356667777777877777889999974    1 36789999865


No 134
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=79.74  E-value=0.92  Score=28.01  Aligned_cols=26  Identities=19%  Similarity=0.377  Sum_probs=16.6

Q ss_pred             cccCCCCCCcccCCC-CcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPNI-SYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~-~~~~~C~~C~~   62 (134)
                      |++|..||+.|.... +..--|+.||-
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~GCP~CGg   27 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILSGCPECGG   27 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHccCcccCC
Confidence            467778888887433 34455777774


No 135
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=79.55  E-value=1.3  Score=25.49  Aligned_cols=26  Identities=23%  Similarity=0.432  Sum_probs=17.1

Q ss_pred             ccccCCCCCCcccC-CCCcceeeCCCC
Q psy3507          36 LMYHCKTCSTVSHP-NISYKYTCYACD   61 (134)
Q Consensus        36 ~~~~C~~C~~~f~~-~~~~~~~C~~C~   61 (134)
                      .|-.|..||..|.. ....|..|+.|-
T Consensus        57 ~Pa~CkkCGfef~~~~ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDDKIKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCccccccccCCcccCCcch
Confidence            45667777777774 344567777774


No 136
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=79.47  E-value=1.1  Score=20.76  Aligned_cols=27  Identities=19%  Similarity=0.306  Sum_probs=12.0

Q ss_pred             cCcccccccccCCCCccccCCCCCCcc
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVS   47 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f   47 (134)
                      .|..|+.-...-+...-+.|..||.+|
T Consensus         5 ~C~~C~~~~i~~~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    5 KCSKCGGNGIVNKEDDYEVCIFCGSSF   31 (33)
T ss_pred             EcCCCCCCeEEEecCCeEEcccCCcEe
Confidence            444453333222333345566665554


No 137
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=79.47  E-value=1.2  Score=32.17  Aligned_cols=68  Identities=22%  Similarity=0.444  Sum_probs=44.6

Q ss_pred             eeeCCCCCccCChHHHHHHHHHhcCCCceeccccCc-------cccCchhHHHHhhhcCCCCCeecCc--Ch----hhhc
Q psy3507          55 YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAY-------SCTQSSALKIHERKHTGDKPYICQQ--CR----DTFS  121 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~h~~~~~~~C~~--C~----~~F~  121 (134)
                      -.|..|...|.+...|..|++..+.    .|-+|+.       -|.+-..|..|.+.    .-|.|..  |.    ..|.
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~~~k~~vf~  292 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCRVGKCYVFP  292 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEecCcEEEec
Confidence            4688888888888888888875432    3555554       35555666666542    2355543  32    3688


Q ss_pred             CHHHHHHHH
Q psy3507         122 SLYLFRNRL  130 (134)
Q Consensus       122 ~~~~l~~H~  130 (134)
                      ....|..|+
T Consensus       293 ~~~el~~h~  301 (493)
T COG5236         293 YHTELLEHL  301 (493)
T ss_pred             cHHHHHHHH
Confidence            888888886


No 138
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=79.06  E-value=1.2  Score=22.16  Aligned_cols=25  Identities=24%  Similarity=0.676  Sum_probs=12.6

Q ss_pred             ccCCCCCCc--ccCCCCcceeeCCCCC
Q psy3507          38 YHCKTCSTV--SHPNISYKYTCYACDY   62 (134)
Q Consensus        38 ~~C~~C~~~--f~~~~~~~~~C~~C~~   62 (134)
                      +.|+.||..  +.......|.|..|++
T Consensus        19 ~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            556666643  1122334566666653


No 139
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=78.87  E-value=1.4  Score=20.80  Aligned_cols=25  Identities=20%  Similarity=0.344  Sum_probs=16.2

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      ..|++|+..+....+-.|-|..||.
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCce
Confidence            4577777776555666666766664


No 140
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=78.47  E-value=1.5  Score=23.63  Aligned_cols=25  Identities=16%  Similarity=0.404  Sum_probs=8.2

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      -.|..|++.|.. ..+.+.|..||..
T Consensus        10 ~~C~~C~~~F~~-~~rrhhCr~CG~~   34 (69)
T PF01363_consen   10 SNCMICGKKFSL-FRRRHHCRNCGRV   34 (69)
T ss_dssp             SB-TTT--B-BS-SS-EEE-TTT--E
T ss_pred             CcCcCcCCcCCC-ceeeEccCCCCCE
Confidence            345566666632 2344555555543


No 141
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=78.28  E-value=1.6  Score=23.50  Aligned_cols=27  Identities=19%  Similarity=0.550  Sum_probs=14.3

Q ss_pred             cCCCCCCcccC-CCCcceeeCCCCCccC
Q psy3507          39 HCKTCSTVSHP-NISYKYTCYACDYHTL   65 (134)
Q Consensus        39 ~C~~C~~~f~~-~~~~~~~C~~C~~~f~   65 (134)
                      .|+.||..-.. .....|.|+.||....
T Consensus        30 ~C~~CG~~~~~~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   30 TCPRCGHRNKKRRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             CccCcccccccccccceEEcCCCCCEEC
Confidence            45555555443 3344566666665543


No 142
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=77.85  E-value=1.4  Score=26.77  Aligned_cols=26  Identities=35%  Similarity=0.586  Sum_probs=13.8

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      ...|..||..|.......+.|+.|+.
T Consensus        71 ~~~C~~Cg~~~~~~~~~~~~CP~Cgs   96 (117)
T PRK00564         71 ELECKDCSHVFKPNALDYGVCEKCHS   96 (117)
T ss_pred             EEEhhhCCCccccCCccCCcCcCCCC
Confidence            35666666665543322234666664


No 143
>KOG1280|consensus
Probab=77.83  E-value=6.6  Score=28.47  Aligned_cols=42  Identities=19%  Similarity=0.368  Sum_probs=27.9

Q ss_pred             CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCc--eeccccCc
Q psy3507          49 PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKP--YKCEYCAY   90 (134)
Q Consensus        49 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~~   90 (134)
                      +.....|.|++|+..-.+...|..|....+.+-+  ..|++|+.
T Consensus        74 ~y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   74 HYDPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            3344468999999888888888888775433322  45666653


No 144
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=77.28  E-value=2.5  Score=20.35  Aligned_cols=9  Identities=33%  Similarity=0.999  Sum_probs=4.3

Q ss_pred             eeeCCCCCc
Q psy3507          55 YTCYACDYH   63 (134)
Q Consensus        55 ~~C~~C~~~   63 (134)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            445445443


No 145
>PRK14873 primosome assembly protein PriA; Provisional
Probab=76.32  E-value=2.5  Score=33.50  Aligned_cols=8  Identities=38%  Similarity=0.920  Sum_probs=4.7

Q ss_pred             cCCCCCCc
Q psy3507          39 HCKTCSTV   46 (134)
Q Consensus        39 ~C~~C~~~   46 (134)
                      .|..||..
T Consensus       385 ~C~~Cg~~  392 (665)
T PRK14873        385 ACARCRTP  392 (665)
T ss_pred             EhhhCcCe
Confidence            56666654


No 146
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=76.15  E-value=1.1  Score=25.85  Aligned_cols=29  Identities=21%  Similarity=0.442  Sum_probs=15.5

Q ss_pred             cccCCCCCCccc-CCCCcceeeCCCCCccC
Q psy3507          37 MYHCKTCSTVSH-PNISYKYTCYACDYHTL   65 (134)
Q Consensus        37 ~~~C~~C~~~f~-~~~~~~~~C~~C~~~f~   65 (134)
                      .|.|+.||+.-- ....-.+.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEEEEETTEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeEEeeeEEeecCCCCCEEe
Confidence            366777776432 22223366777766654


No 147
>PRK05580 primosome assembly protein PriA; Validated
Probab=75.87  E-value=2.2  Score=33.80  Aligned_cols=39  Identities=21%  Similarity=0.462  Sum_probs=28.5

Q ss_pred             cCcccccccccCCCCccccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      .|..|...+..|.......|..||...    ..+..|+.|+..
T Consensus       392 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~----~~~~~Cp~Cg~~  430 (679)
T PRK05580        392 ECPHCDASLTLHRFQRRLRCHHCGYQE----PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCceeEECCCCeEECCCCcCCC----CCCCCCCCCcCC
Confidence            566676677777777778899999753    345679999765


No 148
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=75.34  E-value=0.8  Score=27.57  Aligned_cols=25  Identities=20%  Similarity=0.592  Sum_probs=12.7

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      ..|..||..|...... +.|+.|+..
T Consensus        71 ~~C~~Cg~~~~~~~~~-~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFD-FSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHCC-HH-SSSSSS
T ss_pred             EECCCCCCEEecCCCC-CCCcCCcCC
Confidence            5666666666533332 556666643


No 149
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=75.27  E-value=2.4  Score=21.34  Aligned_cols=10  Identities=30%  Similarity=1.228  Sum_probs=4.9

Q ss_pred             ceeeCCCCCc
Q psy3507          54 KYTCYACDYH   63 (134)
Q Consensus        54 ~~~C~~C~~~   63 (134)
                      .+.|+.|+..
T Consensus        20 ~~vC~~Cg~~   29 (52)
T smart00661       20 RFVCRKCGYE   29 (52)
T ss_pred             EEECCcCCCe
Confidence            3455555543


No 150
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=75.26  E-value=2  Score=19.10  Aligned_cols=9  Identities=44%  Similarity=1.265  Sum_probs=2.9

Q ss_pred             cceeeCCCC
Q psy3507          53 YKYTCYACD   61 (134)
Q Consensus        53 ~~~~C~~C~   61 (134)
                      ..|.|..|+
T Consensus        14 ~~Y~C~~Cd   22 (30)
T PF07649_consen   14 WFYRCSECD   22 (30)
T ss_dssp             -EEE-TTT-
T ss_pred             ceEECccCC
Confidence            344454443


No 151
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=75.16  E-value=2.5  Score=17.74  Aligned_cols=7  Identities=29%  Similarity=1.046  Sum_probs=2.8

Q ss_pred             CCCCCCc
Q psy3507          40 CKTCSTV   46 (134)
Q Consensus        40 C~~C~~~   46 (134)
                      |+.||..
T Consensus         2 Cp~CG~~    8 (23)
T PF13240_consen    2 CPNCGAE    8 (23)
T ss_pred             CcccCCC
Confidence            3444443


No 152
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=74.80  E-value=3.1  Score=18.54  Aligned_cols=21  Identities=24%  Similarity=0.570  Sum_probs=9.0

Q ss_pred             cCCCCCCcccCCCCcceeeCCCC
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      .|+.|++......  .|.|..|.
T Consensus         2 ~C~~C~~~~~~~~--~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFY--FYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCE--eEEeCCCC
Confidence            4555554432211  45555544


No 153
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=74.67  E-value=0.19  Score=39.31  Aligned_cols=68  Identities=22%  Similarity=0.379  Sum_probs=35.2

Q ss_pred             ccceecCcccccccccCCCCccc-----cCCCCCCcccCCCC----------cc-eeeCCCCCccCChHHHHHHHHHhcC
Q psy3507          16 PFTLATCIHCRLLLVPTAEELMY-----HCKTCSTVSHPNIS----------YK-YTCYACDYHTLMSEDMKKHMRKHTG   79 (134)
Q Consensus        16 ~~~~~~C~~C~~h~~~h~~~~~~-----~C~~C~~~f~~~~~----------~~-~~C~~C~~~f~~~~~l~~H~~~h~~   79 (134)
                      |-...+|..|..-+..-. ++.|     .|..||-+|+--..          .. -.|+.|.+.|.++.+-+-    |. 
T Consensus        98 ~pD~a~C~~Cl~Ei~dp~-~rrY~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRf----HA-  171 (750)
T COG0068          98 PPDAATCEDCLEEIFDPN-SRRYLYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRF----HA-  171 (750)
T ss_pred             CCchhhhHHHHHHhcCCC-CcceeccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCcccccc----cc-
Confidence            344567888855444332 2222     37778877771111          12 236666666655554332    22 


Q ss_pred             CCceeccccCc
Q psy3507          80 EKPYKCEYCAY   90 (134)
Q Consensus        80 ~~~~~C~~C~~   90 (134)
                       +|..|+.||-
T Consensus       172 -Qp~aCp~CGP  181 (750)
T COG0068         172 -QPIACPKCGP  181 (750)
T ss_pred             -ccccCcccCC
Confidence             4556666664


No 154
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=74.64  E-value=3.2  Score=19.91  Aligned_cols=7  Identities=29%  Similarity=1.279  Sum_probs=2.5

Q ss_pred             cCCCCCC
Q psy3507          39 HCKTCST   45 (134)
Q Consensus        39 ~C~~C~~   45 (134)
                      +|..|+.
T Consensus        14 ~C~~C~~   20 (39)
T smart00154       14 KCRHCGN   20 (39)
T ss_pred             ECCccCC
Confidence            3333333


No 155
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=74.56  E-value=1.4  Score=25.39  Aligned_cols=30  Identities=17%  Similarity=0.392  Sum_probs=19.1

Q ss_pred             cccCCCCCCc-ccCCCCcceeeCCCCCccCC
Q psy3507          37 MYHCKTCSTV-SHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        37 ~~~C~~C~~~-f~~~~~~~~~C~~C~~~f~~   66 (134)
                      .|.|+.||+. +.....-.+.|..|++.|..
T Consensus        36 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         36 KYFCPFCGKHAVKRQAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CccCCCCCCCceeeeeeEEEEcCCCCCEEeC
Confidence            4778888754 22334445778888877654


No 156
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=73.25  E-value=1.4  Score=25.53  Aligned_cols=30  Identities=20%  Similarity=0.419  Sum_probs=18.5

Q ss_pred             cccCCCCCCcc-cCCCCcceeeCCCCCccCC
Q psy3507          37 MYHCKTCSTVS-HPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        37 ~~~C~~C~~~f-~~~~~~~~~C~~C~~~f~~   66 (134)
                      .|.|+.|++.- .....-.+.|..|++.|..
T Consensus        35 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        35 KYVCPFCGKKTVKRGSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             CccCCCCCCCceEEEeeEEEEcCCCCCEEeC
Confidence            47788887542 2333345778888777654


No 157
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=73.17  E-value=1.8  Score=19.65  Aligned_cols=24  Identities=21%  Similarity=0.555  Sum_probs=9.5

Q ss_pred             CcccccccccCCCCccccCCCCCC
Q psy3507          22 CIHCRLLLVPTAEELMYHCKTCST   45 (134)
Q Consensus        22 C~~C~~h~~~h~~~~~~~C~~C~~   45 (134)
                      |+.|+..+....++..-.|+.|+.
T Consensus         6 C~~CG~~t~~~~~g~~r~C~~Cg~   29 (32)
T PF09297_consen    6 CGRCGAPTKPAPGGWARRCPSCGH   29 (32)
T ss_dssp             -TTT--BEEE-SSSS-EEESSSS-
T ss_pred             cCcCCccccCCCCcCEeECCCCcC
Confidence            555555555555555555555554


No 158
>KOG2785|consensus
Probab=73.03  E-value=6.5  Score=28.84  Aligned_cols=26  Identities=35%  Similarity=0.507  Sum_probs=22.7

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHhcC
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKHTG   79 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h~~   79 (134)
                      |-.|-.|++.+.+-..-..||..+++
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccC
Confidence            46799999999999999999998775


No 159
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=72.89  E-value=2.6  Score=31.36  Aligned_cols=31  Identities=13%  Similarity=0.279  Sum_probs=22.8

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCChH
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMSE   68 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~   68 (134)
                      -.|+.||.+....+..-|+|+.|+..+....
T Consensus       351 p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         351 PVCPRCGGRMKSAGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCCccCCchhhcCCCCcccccccccCCccc
Confidence            4688888877766666788888887776644


No 160
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=72.87  E-value=2.5  Score=28.56  Aligned_cols=24  Identities=17%  Similarity=0.481  Sum_probs=18.2

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHH
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +..|.|..|+|.|.-..-+++|+.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~   98 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIF   98 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHh
Confidence            445899999999999888888874


No 161
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=72.84  E-value=1.9  Score=20.64  Aligned_cols=9  Identities=33%  Similarity=1.054  Sum_probs=4.2

Q ss_pred             eeeCCCCCc
Q psy3507          55 YTCYACDYH   63 (134)
Q Consensus        55 ~~C~~C~~~   63 (134)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            445555443


No 162
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=72.29  E-value=2  Score=28.95  Aligned_cols=29  Identities=21%  Similarity=0.254  Sum_probs=21.5

Q ss_pred             CCCcceeeCCCCCccCChHHHHHHHHHhc
Q psy3507          50 NISYKYTCYACDYHTLMSEDMKKHMRKHT   78 (134)
Q Consensus        50 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   78 (134)
                      ..+..|.|..|+|.|........|+..-+
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            44557999999999999999999987543


No 163
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=72.11  E-value=2.7  Score=20.57  Aligned_cols=15  Identities=27%  Similarity=0.589  Sum_probs=8.3

Q ss_pred             ecCcChhhhcCHHHH
Q psy3507         112 ICQQCRDTFSSLYLF  126 (134)
Q Consensus       112 ~C~~C~~~F~~~~~l  126 (134)
                      .|..||+.|+.+...
T Consensus        10 ~C~~C~rpf~WRKKW   24 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKW   24 (42)
T ss_pred             cCcccCCcchHHHHH
Confidence            466666666555433


No 164
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=72.10  E-value=1.2  Score=26.27  Aligned_cols=26  Identities=19%  Similarity=0.402  Sum_probs=15.9

Q ss_pred             cccCCCCCCcccCC-CCcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPN-ISYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~-~~~~~~C~~C~~   62 (134)
                      |+.|..||..|... .+...-|+.||-
T Consensus         2 pH~CtrCG~vf~~g~~~il~GCp~CG~   28 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEILSGCPKCGC   28 (112)
T ss_pred             CceecccccccccccHHHHccCccccc
Confidence            56777777777742 233445777764


No 165
>KOG4173|consensus
Probab=72.02  E-value=1.4  Score=29.47  Aligned_cols=53  Identities=25%  Similarity=0.364  Sum_probs=41.2

Q ss_pred             eeeCCCCCccCChHHHHHHHH-Hhc---------CCCceecc--ccCccccCchhHHHHh-hhcCC
Q psy3507          55 YTCYACDYHTLMSEDMKKHMR-KHT---------GEKPYKCE--YCAYSCTQSSALKIHE-RKHTG  107 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l~~H~~-~h~---------~~~~~~C~--~C~~~f~~~~~l~~H~-~~h~~  107 (134)
                      -.|..|.+.|.+...|..|+. .|.         |.-.|+|-  .|+..|.+......|+ ++|.-
T Consensus       107 ~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  107 NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMHKY  172 (253)
T ss_pred             chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhccC
Confidence            389999999999999999976 332         44458884  4999999999999995 45643


No 166
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=71.89  E-value=3.4  Score=24.52  Aligned_cols=23  Identities=22%  Similarity=0.411  Sum_probs=21.0

Q ss_pred             eec----CcChhhhcCHHHHHHHHHhc
Q psy3507         111 YIC----QQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C----~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |.|    ..|+....+...+++|++.+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~  107 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKE  107 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHh
Confidence            899    99999999999999998754


No 167
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=71.88  E-value=4.8  Score=23.87  Aligned_cols=26  Identities=42%  Similarity=0.786  Sum_probs=21.6

Q ss_pred             ceee----CCCCCccCChHHHHHHHHHhcC
Q psy3507          54 KYTC----YACDYHTLMSEDMKKHMRKHTG   79 (134)
Q Consensus        54 ~~~C----~~C~~~f~~~~~l~~H~~~h~~   79 (134)
                      .|.|    ..|+....+...|..|++.+++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3889    9999999999999999886653


No 168
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=71.40  E-value=2.7  Score=26.11  Aligned_cols=58  Identities=22%  Similarity=0.414  Sum_probs=30.8

Q ss_pred             CCCccccCCCCCCcccCCC-CcceeeCCCCCccCC--hHHHHHHHHHhcCCCceeccccCccccCchh
Q psy3507          33 AEELMYHCKTCSTVSHPNI-SYKYTCYACDYHTLM--SEDMKKHMRKHTGEKPYKCEYCAYSCTQSSA   97 (134)
Q Consensus        33 ~~~~~~~C~~C~~~f~~~~-~~~~~C~~C~~~f~~--~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~   97 (134)
                      .+.+.|+|++|..+..... -+|-+|  ||...-.  -..|-++-.+|     -.||.|..+|.+.+.
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLKPneC--CgY~iCn~Cya~LWK~~~~y-----pvCPvCkTSFKss~~  136 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLKPNEC--CGYSICNACYANLWKFCNLY-----PVCPVCKTSFKSSSS  136 (140)
T ss_pred             cCCCceeccCcccccchhhcCCcccc--cchHHHHHHHHHHHHHcccC-----CCCCccccccccccc
Confidence            3446788888887754111 122222  3432211  23344443333     378999888887653


No 169
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF15269 zf-C2H2_7:  Zinc-finger
Probab=71.31  E-value=3.3  Score=20.51  Aligned_cols=21  Identities=29%  Similarity=0.442  Sum_probs=14.7

Q ss_pred             eecCcChhhhcCHHHHHHHHH
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      |+|-+|..+....+.|-+||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            667777777777777777764


No 171
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=70.96  E-value=3.6  Score=21.09  Aligned_cols=26  Identities=15%  Similarity=0.300  Sum_probs=12.9

Q ss_pred             CCCCCCcccCCCCcceeeCCCCCccCC
Q psy3507          40 CKTCSTVSHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        40 C~~C~~~f~~~~~~~~~C~~C~~~f~~   66 (134)
                      |..|++.|.. ..+.+.|..||..|-.
T Consensus         5 C~~C~~~F~~-~~rk~~Cr~Cg~~~C~   30 (57)
T cd00065           5 CMGCGKPFTL-TRRRHHCRNCGRIFCS   30 (57)
T ss_pred             CcccCccccC-CccccccCcCcCCcCh
Confidence            5555555553 2234555555555433


No 172
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=70.19  E-value=2.7  Score=25.28  Aligned_cols=25  Identities=24%  Similarity=0.385  Sum_probs=14.0

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      ...|..||..|.... ..+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~-~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ-HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC-cCccCcCCCC
Confidence            366777776665432 2345666663


No 173
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=69.98  E-value=2.6  Score=29.24  Aligned_cols=96  Identities=21%  Similarity=0.464  Sum_probs=57.2

Q ss_pred             ccccccCCccceecCcccccccccCCCCccccCCCCCCcc------c------CCCCcceeeCCCCCccCChHHH-----
Q psy3507           8 TASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVS------H------PNISYKYTCYACDYHTLMSEDM-----   70 (134)
Q Consensus         8 ~~~~~~~~~~~~~~C~~C~~h~~~h~~~~~~~C~~C~~~f------~------~~~~~~~~C~~C~~~f~~~~~l-----   70 (134)
                      ..+-.-.-|+....|..|.+-.-.| +.+.|+|..|..-.      .      .-....|+|..|++.-.. +-|     
T Consensus       114 l~~HaC~Cpl~da~C~EC~R~vw~h-GGrif~CsfC~~flCEDDQFEHQAsCQvLe~E~~KC~SCNrlGq~-sCLRCK~c  191 (314)
T PF06524_consen  114 LSTHACTCPLQDAVCIECERGVWDH-GGRIFKCSFCDNFLCEDDQFEHQASCQVLESETFKCQSCNRLGQY-SCLRCKIC  191 (314)
T ss_pred             cccccccCcCCCcEeeeeecccccC-CCeEEEeecCCCeeeccchhhhhhhhhhhhcccccccccccccch-hhhheeee
Confidence            3344444567777777775544444 45679999987532      2      122345777777764322 222     


Q ss_pred             --HHHHHH----hcCCCceeccccCccccCchhHHHHhhhc
Q psy3507          71 --KKHMRK----HTGEKPYKCEYCAYSCTQSSALKIHERKH  105 (134)
Q Consensus        71 --~~H~~~----h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  105 (134)
                        ..|.+.    -...+++.|+.|+........|..-.|+|
T Consensus       192 fCddHvrrKg~ky~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  192 FCDDHVRRKGFKYEKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             ehhhhhhhcccccccCCCCCCCCCCCcccccccceeeeecc
Confidence              334442    22347899999998777777776655555


No 174
>KOG2593|consensus
Probab=69.96  E-value=6.1  Score=29.44  Aligned_cols=35  Identities=23%  Similarity=0.485  Sum_probs=19.6

Q ss_pred             CCceeccccCccccCchhHHHHhhhcCCCCCeecCcCh
Q psy3507          80 EKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCR  117 (134)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  117 (134)
                      ..-|.|+.|.+.|.....++   ..-...-.|.|..|+
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCG  160 (436)
T ss_pred             cccccCCccccchhhhHHHH---hhcccCceEEEecCC
Confidence            34577777777776644332   222222357777775


No 175
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=69.78  E-value=5.4  Score=19.16  Aligned_cols=16  Identities=13%  Similarity=0.281  Sum_probs=6.7

Q ss_pred             eeeCCCCCccCChHHH
Q psy3507          55 YTCYACDYHTLMSEDM   70 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~l   70 (134)
                      ..|+.|+-.+.....|
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            3344444444444333


No 176
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=69.20  E-value=1.8  Score=24.96  Aligned_cols=30  Identities=13%  Similarity=0.213  Sum_probs=18.5

Q ss_pred             cccCCCCCCc-ccCCCCcceeeCCCCCccCC
Q psy3507          37 MYHCKTCSTV-SHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        37 ~~~C~~C~~~-f~~~~~~~~~C~~C~~~f~~   66 (134)
                      .|.|+.|++. +.....-.+.|..|++.|..
T Consensus        36 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         36 KHVCPVCGRPKVKRVGTGIWECRKCGAKFAG   66 (90)
T ss_pred             CccCCCCCCCceEEEEEEEEEcCCCCCEEeC
Confidence            4778888654 22333445778888777654


No 177
>KOG4167|consensus
Probab=69.20  E-value=0.95  Score=35.77  Aligned_cols=27  Identities=19%  Similarity=0.386  Sum_probs=24.0

Q ss_pred             cceeeCCCCCccCChHHHHHHHHHhcC
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMRKHTG   79 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~~h~~   79 (134)
                      ..|.|..|++.|.....+..||++|.-
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            359999999999999999999999863


No 178
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=68.60  E-value=6  Score=33.61  Aligned_cols=21  Identities=29%  Similarity=0.738  Sum_probs=10.6

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      .|+.||...    +..|.|+.|+..
T Consensus       681 fCP~CGs~t----e~vy~CPsCGae  701 (1337)
T PRK14714        681 RCPDCGTHT----EPVYVCPDCGAE  701 (1337)
T ss_pred             cCcccCCcC----CCceeCccCCCc
Confidence            466666542    123456666553


No 179
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=68.27  E-value=7.2  Score=18.85  Aligned_cols=24  Identities=33%  Similarity=0.441  Sum_probs=15.7

Q ss_pred             eeeCCCCCccCC--hHHHHHHHHHhc
Q psy3507          55 YTCYACDYHTLM--SEDMKKHMRKHT   78 (134)
Q Consensus        55 ~~C~~C~~~f~~--~~~l~~H~~~h~   78 (134)
                      -.|+.||..|..  .++-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            467777776644  466677777663


No 180
>KOG2807|consensus
Probab=68.15  E-value=8  Score=27.87  Aligned_cols=25  Identities=32%  Similarity=0.582  Sum_probs=18.6

Q ss_pred             CceeccccCccccCchhHHHHhhhc
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHERKH  105 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~h  105 (134)
                      ..|.|..|...|...-+...|...|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            4488888888888877777775554


No 181
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=68.06  E-value=5.1  Score=20.79  Aligned_cols=25  Identities=16%  Similarity=0.388  Sum_probs=12.6

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      -.|+.||+.|..... .-.|+.|+..
T Consensus         6 ~~C~~Cg~~~~~~dD-iVvCp~Cgap   30 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDD-IVVCPECGAP   30 (54)
T ss_pred             ccChhhCCcccCCCC-EEECCCCCCc
Confidence            346666666543332 2456666544


No 182
>KOG2593|consensus
Probab=67.03  E-value=4.1  Score=30.30  Aligned_cols=31  Identities=19%  Similarity=0.435  Sum_probs=20.5

Q ss_pred             CCCccccCCCCCCccc--------CCCCcceeeCCCCCc
Q psy3507          33 AEELMYHCKTCSTVSH--------PNISYKYTCYACDYH   63 (134)
Q Consensus        33 ~~~~~~~C~~C~~~f~--------~~~~~~~~C~~C~~~   63 (134)
                      +....|.|+.|++.|.        ......|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHHhhcccCceEEEecCCCc
Confidence            3445588888888877        333446788888744


No 183
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=66.75  E-value=5.3  Score=18.57  Aligned_cols=7  Identities=43%  Similarity=1.065  Sum_probs=3.0

Q ss_pred             eeeCCCC
Q psy3507          55 YTCYACD   61 (134)
Q Consensus        55 ~~C~~C~   61 (134)
                      +.|+.|+
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            4444444


No 184
>PRK04023 DNA polymerase II large subunit; Validated
Probab=66.69  E-value=7  Score=32.46  Aligned_cols=9  Identities=22%  Similarity=0.582  Sum_probs=5.3

Q ss_pred             eeeCCCCCc
Q psy3507          55 YTCYACDYH   63 (134)
Q Consensus        55 ~~C~~C~~~   63 (134)
                      +.|+.|+..
T Consensus       664 y~CPKCG~E  672 (1121)
T PRK04023        664 DECEKCGRE  672 (1121)
T ss_pred             CcCCCCCCC
Confidence            556666644


No 185
>KOG3507|consensus
Probab=66.51  E-value=4.9  Score=21.16  Aligned_cols=27  Identities=22%  Similarity=0.616  Sum_probs=13.4

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      .|.|.+||..-.-...-.+.|..||..
T Consensus        20 iYiCgdC~~en~lk~~D~irCReCG~R   46 (62)
T KOG3507|consen   20 IYICGDCGQENTLKRGDVIRCRECGYR   46 (62)
T ss_pred             EEEeccccccccccCCCcEehhhcchH
Confidence            355555555443333334556666543


No 186
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=65.93  E-value=5.5  Score=20.04  Aligned_cols=26  Identities=19%  Similarity=0.365  Sum_probs=11.1

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      +-.|..|++.........+.|..|+.
T Consensus        11 ~~~C~~C~~~i~g~~~~g~~C~~C~~   36 (53)
T PF00130_consen   11 PTYCDVCGKFIWGLGKQGYRCSWCGL   36 (53)
T ss_dssp             TEB-TTSSSBECSSSSCEEEETTTT-
T ss_pred             CCCCcccCcccCCCCCCeEEECCCCC
Confidence            34455555544223333455555543


No 187
>KOG3408|consensus
Probab=65.63  E-value=6  Score=24.17  Aligned_cols=23  Identities=13%  Similarity=0.525  Sum_probs=19.0

Q ss_pred             CeecCcChhhhcCHHHHHHHHHh
Q psy3507         110 PYICQQCRDTFSSLYLFRNRLQS  132 (134)
Q Consensus       110 ~~~C~~C~~~F~~~~~l~~H~~~  132 (134)
                      .|.|-.|.+-|.+...|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            48888888888888888888764


No 188
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=65.56  E-value=1.6  Score=34.52  Aligned_cols=75  Identities=17%  Similarity=0.459  Sum_probs=50.0

Q ss_pred             ccCCCCCCcccCCCCcc----e-eeCCCCCccCChHHHHHHHHHhcCCCce-eccccCccccCchhHHHHhhhcCCCCCe
Q psy3507          38 YHCKTCSTVSHPNISYK----Y-TCYACDYHTLMSEDMKKHMRKHTGEKPY-KCEYCAYSCTQSSALKIHERKHTGDKPY  111 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~----~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~  111 (134)
                      =.|+.|-+.+..+.++.    | .|..||-.|+....|-.-.. ++.-..| -|+.|.+.|..+.+-+-|      ..|.
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYDR~-nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~  174 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYDRE-NTSMADFPLCPFCDKEYKDPLNRRFH------AQPI  174 (750)
T ss_pred             hhhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCCcc-cCccccCcCCHHHHHHhcCccccccc------cccc
Confidence            46888876665444443    2 49999999988777654322 2222223 599999998888765544      3478


Q ss_pred             ecCcChhh
Q psy3507         112 ICQQCRDT  119 (134)
Q Consensus       112 ~C~~C~~~  119 (134)
                      .|+.||-.
T Consensus       175 aCp~CGP~  182 (750)
T COG0068         175 ACPKCGPH  182 (750)
T ss_pred             cCcccCCC
Confidence            99999863


No 189
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=65.24  E-value=4.4  Score=25.63  Aligned_cols=14  Identities=21%  Similarity=0.384  Sum_probs=7.3

Q ss_pred             eeeCCCCCccCChH
Q psy3507          55 YTCYACDYHTLMSE   68 (134)
Q Consensus        55 ~~C~~C~~~f~~~~   68 (134)
                      -.|..|++.|.+..
T Consensus        29 ReC~~C~~RFTTyE   42 (147)
T TIGR00244        29 RECLECHERFTTFE   42 (147)
T ss_pred             ccCCccCCccceee
Confidence            45555555555543


No 190
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=64.43  E-value=2.2  Score=18.97  Aligned_cols=10  Identities=20%  Similarity=0.713  Sum_probs=5.9

Q ss_pred             eeccccCccc
Q psy3507          83 YKCEYCAYSC   92 (134)
Q Consensus        83 ~~C~~C~~~f   92 (134)
                      |.|-.|++.|
T Consensus         1 ~sCiDC~~~F   10 (28)
T PF08790_consen    1 FSCIDCSKDF   10 (28)
T ss_dssp             EEETTTTEEE
T ss_pred             CeeecCCCCc
Confidence            3456666666


No 191
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=63.94  E-value=6.3  Score=18.88  Aligned_cols=7  Identities=29%  Similarity=1.089  Sum_probs=2.4

Q ss_pred             eeeCCCC
Q psy3507          55 YTCYACD   61 (134)
Q Consensus        55 ~~C~~C~   61 (134)
                      +.|..|+
T Consensus        25 w~C~~C~   31 (40)
T PF04810_consen   25 WICNFCG   31 (40)
T ss_dssp             EEETTT-
T ss_pred             EECcCCC
Confidence            3444443


No 192
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=63.23  E-value=4.8  Score=24.31  Aligned_cols=25  Identities=32%  Similarity=0.696  Sum_probs=13.5

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      ...|..||..|.... ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-~~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEI-DLYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCC-cCccCcCCcC
Confidence            356666666655332 2355666664


No 193
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=63.06  E-value=6.9  Score=24.31  Aligned_cols=15  Identities=20%  Similarity=0.208  Sum_probs=7.3

Q ss_pred             CCCCcceeeCCCCCc
Q psy3507          49 PNISYKYTCYACDYH   63 (134)
Q Consensus        49 ~~~~~~~~C~~C~~~   63 (134)
                      ..++....|+.|++.
T Consensus       100 i~g~~~~~CPwCg~~  114 (131)
T PF15616_consen  100 IDGEGEVTCPWCGNE  114 (131)
T ss_pred             eCCCCCEECCCCCCe
Confidence            334444555555543


No 194
>PRK00420 hypothetical protein; Validated
Probab=62.99  E-value=7.5  Score=23.47  Aligned_cols=28  Identities=14%  Similarity=0.198  Sum_probs=17.5

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTL   65 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~   65 (134)
                      -.|+.||..+..-......|+.||....
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCeee
Confidence            4578888665532334567888887544


No 195
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=62.93  E-value=1.2  Score=22.78  Aligned_cols=15  Identities=33%  Similarity=0.738  Sum_probs=4.1

Q ss_pred             eeeCCCCCccCChHH
Q psy3507          55 YTCYACDYHTLMSED   69 (134)
Q Consensus        55 ~~C~~C~~~f~~~~~   69 (134)
                      |.|+.|...|-..-+
T Consensus        22 y~C~~C~~~FC~dCD   36 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCD   36 (51)
T ss_dssp             E--TTTT--B-HHHH
T ss_pred             EECCCCCCccccCcC
Confidence            444444444433333


No 196
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=62.31  E-value=6.2  Score=18.38  Aligned_cols=10  Identities=20%  Similarity=0.620  Sum_probs=4.0

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      .|..|++.|.
T Consensus         5 ~C~eC~~~f~   14 (34)
T PF01286_consen    5 KCDECGKPFM   14 (34)
T ss_dssp             E-TTT--EES
T ss_pred             hHhHhCCHHH
Confidence            4566666655


No 197
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=61.59  E-value=7  Score=24.75  Aligned_cols=27  Identities=15%  Similarity=0.347  Sum_probs=16.7

Q ss_pred             cccCCCCCCccc--CCCCcceeeCCCCCcc
Q psy3507          37 MYHCKTCSTVSH--PNISYKYTCYACDYHT   64 (134)
Q Consensus        37 ~~~C~~C~~~f~--~~~~~~~~C~~C~~~f   64 (134)
                      .|.|..||....  ++ ...-+|+.|+...
T Consensus       112 ~l~C~~Cg~~~~~~~~-~~l~~Cp~C~~~~  140 (146)
T PF07295_consen  112 TLVCENCGHEVELTHP-ERLPPCPKCGHTE  140 (146)
T ss_pred             eEecccCCCEEEecCC-CcCCCCCCCCCCe
Confidence            477888876544  33 3345688877643


No 198
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=61.37  E-value=1.9  Score=23.97  Aligned_cols=8  Identities=38%  Similarity=1.144  Sum_probs=3.6

Q ss_pred             eeeCCCCC
Q psy3507          55 YTCYACDY   62 (134)
Q Consensus        55 ~~C~~C~~   62 (134)
                      |+|..|+.
T Consensus        13 Y~c~~cg~   20 (82)
T COG2331          13 YECTECGN   20 (82)
T ss_pred             Eeecccch
Confidence            44444443


No 199
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=61.25  E-value=5.9  Score=20.86  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=4.9

Q ss_pred             CCCceeccccC
Q psy3507          79 GEKPYKCEYCA   89 (134)
Q Consensus        79 ~~~~~~C~~C~   89 (134)
                      |+..-.|+.|.
T Consensus        41 GE~VArCPSCS   51 (67)
T COG5216          41 GEVVARCPSCS   51 (67)
T ss_pred             CceEEEcCCce
Confidence            44444444443


No 200
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=61.06  E-value=6.2  Score=23.25  Aligned_cols=30  Identities=13%  Similarity=0.265  Sum_probs=14.6

Q ss_pred             CccccCCCCCCccc-------CCCCcceeeCCCCCcc
Q psy3507          35 ELMYHCKTCSTVSH-------PNISYKYTCYACDYHT   64 (134)
Q Consensus        35 ~~~~~C~~C~~~f~-------~~~~~~~~C~~C~~~f   64 (134)
                      ++.|.|+.||..-.       ....-.-.|..||.+|
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~   56 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSF   56 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCceeEEEcccCcceE
Confidence            34466666665432       1111234566666554


No 201
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=60.75  E-value=11  Score=19.56  Aligned_cols=30  Identities=23%  Similarity=0.393  Sum_probs=16.6

Q ss_pred             ccceecCcccccccc----cCCCCccccCCCCCC
Q psy3507          16 PFTLATCIHCRLLLV----PTAEELMYHCKTCST   45 (134)
Q Consensus        16 ~~~~~~C~~C~~h~~----~h~~~~~~~C~~C~~   45 (134)
                      .....+|..|..|-=    .-.....|.|..||.
T Consensus        19 ~r~aLIC~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   19 NRYALICSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             CceeEECcccchhhcccccccCCceEEEcCCCCC
Confidence            344567888855422    222334577777764


No 202
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=60.73  E-value=5.4  Score=25.37  Aligned_cols=10  Identities=20%  Similarity=0.547  Sum_probs=5.0

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      .|+.||..|.
T Consensus        30 eC~~C~~RFT   39 (156)
T COG1327          30 ECLECGERFT   39 (156)
T ss_pred             cccccccccc
Confidence            4555555554


No 203
>PF12773 DZR:  Double zinc ribbon
Probab=59.76  E-value=15  Score=18.20  Aligned_cols=9  Identities=22%  Similarity=0.656  Sum_probs=4.2

Q ss_pred             ccCCCCCCc
Q psy3507          38 YHCKTCSTV   46 (134)
Q Consensus        38 ~~C~~C~~~   46 (134)
                      ..|+.||..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            445555543


No 204
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=59.73  E-value=5.9  Score=29.53  Aligned_cols=28  Identities=21%  Similarity=0.571  Sum_probs=24.1

Q ss_pred             cCcccccccccCCCCccccCCCCCCcccC
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSHP   49 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~~   49 (134)
                      .|+.|+..|.+-... -|.|+.||..+..
T Consensus       352 ~Cp~Cg~~m~S~G~~-g~rC~kCg~~~~~  379 (421)
T COG1571         352 VCPRCGGRMKSAGRN-GFRCKKCGTRARE  379 (421)
T ss_pred             CCCccCCchhhcCCC-CcccccccccCCc
Confidence            799999988887665 8999999999873


No 205
>PF03563 Bunya_G2:  Bunyavirus glycoprotein G2;  InterPro: IPR005168 Bunyavirus has three genomic segments: small (S), middle-sized (M), and large (L). The S segment encodes the nucleocapsid and a non-structural protein. The M segment codes for two glycoproteins, G1 and G2, and another non-structural protein (NSm). The L segment codes for an RNA polymerase. This entry represents the polyprotein region forming the G2 glycoprotein, which interacts with the IPR005167 from INTERPRO G1 glycoprotein [].
Probab=59.43  E-value=12  Score=26.15  Aligned_cols=36  Identities=31%  Similarity=0.602  Sum_probs=23.8

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHH
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      +|.-||..+.+-..=+-.| +||..|.+.+.|+.|..
T Consensus       236 ~C~nC~La~HPFtnC~s~C-vCG~~f~~sd~mk~HR~  271 (285)
T PF03563_consen  236 KCKNCGLAYHPFTNCGSHC-VCGMKFETSDRMKMHRE  271 (285)
T ss_pred             hCcccCeeccCCCCCCCee-eccccccchHHHHHHHh
Confidence            4677777665433333344 68888888888887754


No 206
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=59.34  E-value=7.2  Score=24.12  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=5.3

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      |.|..|++.|.
T Consensus        54 yrC~~C~~tf~   64 (129)
T COG3677          54 YKCKSCGSTFT   64 (129)
T ss_pred             cccCCcCccee
Confidence            44444444444


No 207
>PRK12722 transcriptional activator FlhC; Provisional
Probab=59.04  E-value=7  Score=25.83  Aligned_cols=27  Identities=26%  Similarity=0.607  Sum_probs=12.2

Q ss_pred             ceecCcccccccccCCCCc--cccCCCCC
Q psy3507          18 TLATCIHCRLLLVPTAEEL--MYHCKTCS   44 (134)
Q Consensus        18 ~~~~C~~C~~h~~~h~~~~--~~~C~~C~   44 (134)
                      +...|..|+-+..+|..+.  .|.|+.|.
T Consensus       133 ~l~~C~~Cgg~fv~~~~e~~~~f~CplC~  161 (187)
T PRK12722        133 QLSSCNCCGGHFVTHAHDPVGSFVCGLCQ  161 (187)
T ss_pred             eeccCCCCCCCeeccccccCCCCcCCCCC
Confidence            3344555544444444332  34444444


No 208
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=58.83  E-value=6.4  Score=25.07  Aligned_cols=34  Identities=26%  Similarity=0.763  Sum_probs=19.7

Q ss_pred             CceeccccCccccCchhHHHHhhhcCCCCCeecCcChhh
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDT  119 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  119 (134)
                      -+|.|. |+..|.+.   +.|-..-.|+ .|.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            357777 77765553   3333334444 6777777653


No 209
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=58.29  E-value=9.5  Score=26.40  Aligned_cols=49  Identities=12%  Similarity=0.223  Sum_probs=28.8

Q ss_pred             eecCcccccc--cccCCCCccccCCCCCCccc------CCCCcceeeCCCCCccCCh
Q psy3507          19 LATCIHCRLL--LVPTAEELMYHCKTCSTVSH------PNISYKYTCYACDYHTLMS   67 (134)
Q Consensus        19 ~~~C~~C~~h--~~~h~~~~~~~C~~C~~~f~------~~~~~~~~C~~C~~~f~~~   67 (134)
                      .+-|..|..-  .+.-..+..-.|..|.+.|.      -.|.--|.|+.|+..|...
T Consensus       112 qFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  112 QFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             eeeccccchHHHhccCcccccccccccccccCCCccccccceeeeecccccccchhh
Confidence            3556666221  23333344466788888776      2222348888888888754


No 210
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=57.84  E-value=9.4  Score=19.39  Aligned_cols=9  Identities=33%  Similarity=1.254  Sum_probs=4.0

Q ss_pred             ceeeCCCCC
Q psy3507          54 KYTCYACDY   62 (134)
Q Consensus        54 ~~~C~~C~~   62 (134)
                      .+.|..|+.
T Consensus        37 R~~CGkCgy   45 (51)
T COG1998          37 RWACGKCGY   45 (51)
T ss_pred             eeEeccccc
Confidence            344444443


No 211
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=57.80  E-value=3.2  Score=22.62  Aligned_cols=27  Identities=19%  Similarity=0.470  Sum_probs=13.0

Q ss_pred             ecCcccccccccCCCCccccCCCCCCccc
Q psy3507          20 ATCIHCRLLLVPTAEELMYHCKTCSTVSH   48 (134)
Q Consensus        20 ~~C~~C~~h~~~h~~~~~~~C~~C~~~f~   48 (134)
                      +.| .|++++-...+.+.-+| .||+...
T Consensus         4 frC-~Cgr~lya~e~~kTkkC-~CG~~l~   30 (68)
T PF09082_consen    4 FRC-DCGRYLYAKEGAKTKKC-VCGKTLK   30 (68)
T ss_dssp             EEE-TTS--EEEETT-SEEEE-TTTEEEE
T ss_pred             EEe-cCCCEEEecCCcceeEe-cCCCeee
Confidence            445 35555555555555556 6665543


No 212
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=57.75  E-value=9.2  Score=17.34  Aligned_cols=23  Identities=30%  Similarity=0.626  Sum_probs=12.0

Q ss_pred             CcccccccccCCCCccccCCCCC
Q psy3507          22 CIHCRLLLVPTAEELMYHCKTCS   44 (134)
Q Consensus        22 C~~C~~h~~~h~~~~~~~C~~C~   44 (134)
                      |+.|+.-+..-.+...+.|..|.
T Consensus         4 C~~C~t~L~yP~gA~~vrCs~C~   26 (31)
T TIGR01053         4 CGGCRTLLMYPRGASSVRCALCQ   26 (31)
T ss_pred             cCCCCcEeecCCCCCeEECCCCC
Confidence            44554444444555555555554


No 213
>PRK12496 hypothetical protein; Provisional
Probab=56.73  E-value=8.4  Score=24.86  Aligned_cols=26  Identities=19%  Similarity=0.414  Sum_probs=16.5

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCcc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHT   64 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f   64 (134)
                      |.|.-|++.|....+ .-.|+.||...
T Consensus       128 ~~C~gC~~~~~~~~~-~~~C~~CG~~~  153 (164)
T PRK12496        128 KVCKGCKKKYPEDYP-DDVCEICGSPV  153 (164)
T ss_pred             EECCCCCccccCCCC-CCcCCCCCChh
Confidence            778888888753222 13588888543


No 214
>PRK04351 hypothetical protein; Provisional
Probab=56.64  E-value=9.4  Score=24.25  Aligned_cols=33  Identities=27%  Similarity=0.596  Sum_probs=19.4

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccC
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQ   94 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   94 (134)
                      .|.|..|+..+...       +.+ +...|.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCcEEeCCCCcEeee
Confidence            47787787655432       112 3355888888765543


No 215
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=56.15  E-value=10  Score=19.79  Aligned_cols=11  Identities=18%  Similarity=0.685  Sum_probs=5.8

Q ss_pred             cceeeCCCCCc
Q psy3507          53 YKYTCYACDYH   63 (134)
Q Consensus        53 ~~~~C~~C~~~   63 (134)
                      ..|.|+.||..
T Consensus        13 v~~~Cp~cGip   23 (55)
T PF13824_consen   13 VNFECPDCGIP   23 (55)
T ss_pred             cCCcCCCCCCc
Confidence            34555555543


No 216
>KOG2071|consensus
Probab=56.09  E-value=6.9  Score=30.35  Aligned_cols=26  Identities=23%  Similarity=0.448  Sum_probs=22.5

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      ..|-+|..||.+|........||..|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            56789999999999999888888877


No 217
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=55.95  E-value=13  Score=18.38  Aligned_cols=11  Identities=27%  Similarity=0.788  Sum_probs=4.8

Q ss_pred             cccCCCCCCcc
Q psy3507          37 MYHCKTCSTVS   47 (134)
Q Consensus        37 ~~~C~~C~~~f   47 (134)
                      ...|+.|+..|
T Consensus        14 ~i~C~~C~~~~   24 (51)
T PF00628_consen   14 MIQCDSCNRWY   24 (51)
T ss_dssp             EEEBSTTSCEE
T ss_pred             eEEcCCCChhh
Confidence            34444444443


No 218
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=54.86  E-value=7.2  Score=23.90  Aligned_cols=9  Identities=22%  Similarity=0.726  Sum_probs=4.0

Q ss_pred             ccCCCCCCcc
Q psy3507          38 YHCKTCSTVS   47 (134)
Q Consensus        38 ~~C~~C~~~f   47 (134)
                      ..| .||..|
T Consensus        71 ~~C-~Cg~~~   79 (124)
T PRK00762         71 IEC-ECGYEG   79 (124)
T ss_pred             EEe-eCcCcc
Confidence            444 444443


No 220
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=54.43  E-value=19  Score=17.36  Aligned_cols=8  Identities=38%  Similarity=0.986  Sum_probs=3.8

Q ss_pred             ceeccccC
Q psy3507          82 PYKCEYCA   89 (134)
Q Consensus        82 ~~~C~~C~   89 (134)
                      ...|++|+
T Consensus        36 ~~~CP~C~   43 (44)
T PF14634_consen   36 SVKCPICR   43 (44)
T ss_pred             CCCCcCCC
Confidence            34555553


No 221
>KOG0717|consensus
Probab=53.71  E-value=8.1  Score=29.19  Aligned_cols=21  Identities=24%  Similarity=0.499  Sum_probs=17.7

Q ss_pred             eecCcChhhhcCHHHHHHHHH
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +.|..|.+.|.+...|.+|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            778889999999888888864


No 222
>PRK12860 transcriptional activator FlhC; Provisional
Probab=52.56  E-value=10  Score=25.09  Aligned_cols=28  Identities=32%  Similarity=0.710  Sum_probs=14.4

Q ss_pred             cceecCcccccccccCCCCc--cccCCCCC
Q psy3507          17 FTLATCIHCRLLLVPTAEEL--MYHCKTCS   44 (134)
Q Consensus        17 ~~~~~C~~C~~h~~~h~~~~--~~~C~~C~   44 (134)
                      ++...|..|+-+..+|..+.  .|.|+.|.
T Consensus       132 L~l~~C~~Cgg~fv~~~~e~~~~f~CplC~  161 (189)
T PRK12860        132 LQLARCCRCGGKFVTHAHDLRHNFVCGLCQ  161 (189)
T ss_pred             eeeccCCCCCCCeeccccccCCCCcCCCCC
Confidence            44455555655555554432  45555554


No 223
>PRK11032 hypothetical protein; Provisional
Probab=52.44  E-value=10  Score=24.41  Aligned_cols=26  Identities=15%  Similarity=0.285  Sum_probs=11.9

Q ss_pred             ccCCCCCCccc-CCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSH-PNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~-~~~~~~~~C~~C~~~   63 (134)
                      ..|..||.... ......-.|+.|+..
T Consensus       125 LvC~~Cg~~~~~~~p~~i~pCp~C~~~  151 (160)
T PRK11032        125 LVCEKCHHHLAFYTPEVLPLCPKCGHD  151 (160)
T ss_pred             EEecCCCCEEEecCCCcCCCCCCCCCC
Confidence            55666664433 111223356666543


No 224
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=52.39  E-value=11  Score=18.45  Aligned_cols=22  Identities=18%  Similarity=0.475  Sum_probs=8.6

Q ss_pred             CCCCCCcccCCCCcceeeCCCC
Q psy3507          40 CKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        40 C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      |..|++.+.......+.|..|+
T Consensus        14 C~~C~~~i~~~~~~~~~C~~C~   35 (50)
T cd00029          14 CDVCRKSIWGLFKQGLRCSWCK   35 (50)
T ss_pred             hhhcchhhhccccceeEcCCCC
Confidence            4444444332222334444443


No 225
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=51.78  E-value=4.3  Score=19.77  Aligned_cols=13  Identities=31%  Similarity=1.083  Sum_probs=7.4

Q ss_pred             CCeecCcChhhhc
Q psy3507         109 KPYICQQCRDTFS  121 (134)
Q Consensus       109 ~~~~C~~C~~~F~  121 (134)
                      .|+.|..|++.|=
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            3678888887774


No 226
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=51.78  E-value=3.7  Score=24.85  Aligned_cols=24  Identities=21%  Similarity=0.467  Sum_probs=10.7

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      ..|..|+..|..-....-.|..|.
T Consensus        55 ~~C~~C~~~fg~l~~~~~~C~~C~   78 (118)
T PF02318_consen   55 RHCARCGKPFGFLFNRGRVCVDCK   78 (118)
T ss_dssp             SB-TTTS-BCSCTSTTCEEETTTT
T ss_pred             cchhhhCCcccccCCCCCcCCcCC
Confidence            345666655554333334455444


No 227
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=51.50  E-value=18  Score=22.79  Aligned_cols=17  Identities=18%  Similarity=0.333  Sum_probs=9.6

Q ss_pred             ceeccccCccccCchhH
Q psy3507          82 PYKCEYCAYSCTQSSAL   98 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l   98 (134)
                      -+.|+.|++.|-..+..
T Consensus       124 f~~C~~C~kiyW~GsH~  140 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHW  140 (147)
T ss_pred             EEECCCCCCEecccccH
Confidence            35666666666554433


No 228
>KOG3408|consensus
Probab=51.19  E-value=9  Score=23.41  Aligned_cols=23  Identities=30%  Similarity=0.489  Sum_probs=17.5

Q ss_pred             ceeccccCccccCchhHHHHhhh
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERK  104 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~  104 (134)
                      .|-|-.|.+-|.+...|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            47788888888888888888664


No 229
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=51.05  E-value=6.3  Score=21.55  Aligned_cols=27  Identities=22%  Similarity=0.401  Sum_probs=13.0

Q ss_pred             cccCCCCCCcccCCCC---cceeeCCCCCc
Q psy3507          37 MYHCKTCSTVSHPNIS---YKYTCYACDYH   63 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~---~~~~C~~C~~~   63 (134)
                      ...|..|+........   ..+.|+.|+..
T Consensus        41 ~v~Cg~C~~~~~~~~~~c~~~~~C~~C~~~   70 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEYSCGADYFCPICGLY   70 (71)
T ss_dssp             EEEETTT--EEES-SBTT--SEEETTTTEE
T ss_pred             CeECCCCCCccChhhhhcCCCccCcCcCCC
Confidence            4566777666552211   34677777643


No 230
>KOG2906|consensus
Probab=50.96  E-value=11  Score=22.09  Aligned_cols=34  Identities=21%  Similarity=0.574  Sum_probs=17.3

Q ss_pred             eeccccCccccCchhHHHHhhhcCCCCC----eecCcChhhh
Q psy3507          83 YKCEYCAYSCTQSSALKIHERKHTGDKP----YICQQCRDTF  120 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~----~~C~~C~~~F  120 (134)
                      -.|+.||..-..-..    +++-..+.|    |+|-.|+...
T Consensus        66 ~~Cp~Cgh~rayF~q----lQtRSADEPmT~FYkC~~C~~~W  103 (105)
T KOG2906|consen   66 ATCPTCGHERAYFMQ----LQTRSADEPMTTFYKCCKCKHRW  103 (105)
T ss_pred             CcCCCCCCCceEEEE----eeeccCCCcHhHhhhhhcccccc
Confidence            368888743211111    223333444    8888887643


No 231
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=50.87  E-value=12  Score=15.93  Aligned_cols=6  Identities=33%  Similarity=1.326  Sum_probs=2.8

Q ss_pred             CCCCCC
Q psy3507          40 CKTCST   45 (134)
Q Consensus        40 C~~C~~   45 (134)
                      |+.||.
T Consensus         5 Cp~Cg~   10 (26)
T PF13248_consen    5 CPNCGA   10 (26)
T ss_pred             CcccCC
Confidence            444444


No 232
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=49.77  E-value=28  Score=22.23  Aligned_cols=21  Identities=14%  Similarity=0.395  Sum_probs=11.1

Q ss_pred             eeeCCCCCccC------ChHHHHHHHH
Q psy3507          55 YTCYACDYHTL------MSEDMKKHMR   75 (134)
Q Consensus        55 ~~C~~C~~~f~------~~~~l~~H~~   75 (134)
                      .+|..|++.|-      ..+.+..|+.
T Consensus        15 v~C~~c~kWFCNg~~~~s~SHIv~HLv   41 (152)
T PF09416_consen   15 VKCNTCNKWFCNGRGNTSGSHIVNHLV   41 (152)
T ss_dssp             EEETTTTEEEES--TTSSS-HHHHHHH
T ss_pred             eEcCCCCcEeecCCCCCcccHHHHHHH
Confidence            45555555542      4466666754


No 233
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=49.76  E-value=11  Score=22.44  Aligned_cols=29  Identities=14%  Similarity=0.245  Sum_probs=21.7

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCCh
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLMS   67 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~~   67 (134)
                      .|+.|+..|.......|.|+.|...+...
T Consensus         5 ~cp~c~sEytYed~~~~~cpec~~ew~~~   33 (112)
T COG2824           5 PCPKCNSEYTYEDGGQLICPECAHEWNEN   33 (112)
T ss_pred             CCCccCCceEEecCceEeCchhccccccc
Confidence            58888888776666688888888877643


No 234
>KOG2482|consensus
Probab=49.15  E-value=9.7  Score=27.67  Aligned_cols=51  Identities=18%  Similarity=0.409  Sum_probs=35.8

Q ss_pred             ceeccccCccc-cCchhHHHHhhh-cC---C------------------CCCeecCcChhhhcCHHHHHHHHHh
Q psy3507          82 PYKCEYCAYSC-TQSSALKIHERK-HT---G------------------DKPYICQQCRDTFSSLYLFRNRLQS  132 (134)
Q Consensus        82 ~~~C~~C~~~f-~~~~~l~~H~~~-h~---~------------------~~~~~C~~C~~~F~~~~~l~~H~~~  132 (134)
                      ..+|-.|...+ ..++....|+-. |.   |                  -..+.|-.|.+.|..+..|+.||+.
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            35788887644 345666667543 32   1                  1237899999999999999999964


No 235
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=48.64  E-value=11  Score=28.67  Aligned_cols=13  Identities=15%  Similarity=0.473  Sum_probs=8.1

Q ss_pred             ccccCCCCCCccc
Q psy3507          36 LMYHCKTCSTVSH   48 (134)
Q Consensus        36 ~~~~C~~C~~~f~   48 (134)
                      ..|+|..||..|.
T Consensus       424 ~~~~c~~c~~~yd  436 (479)
T PRK05452        424 PRMQCSVCQWIYD  436 (479)
T ss_pred             CeEEECCCCeEEC
Confidence            4466666666665


No 236
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=48.39  E-value=12  Score=23.56  Aligned_cols=9  Identities=33%  Similarity=1.028  Sum_probs=4.5

Q ss_pred             eeccccCcc
Q psy3507          83 YKCEYCAYS   91 (134)
Q Consensus        83 ~~C~~C~~~   91 (134)
                      |.|..|+..
T Consensus       144 ~~C~~C~~~  152 (157)
T PF10263_consen  144 YRCGRCGGP  152 (157)
T ss_pred             EECCCCCCE
Confidence            455555543


No 237
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=47.94  E-value=15  Score=19.98  Aligned_cols=8  Identities=38%  Similarity=1.294  Sum_probs=3.1

Q ss_pred             eccccCcc
Q psy3507          84 KCEYCAYS   91 (134)
Q Consensus        84 ~C~~C~~~   91 (134)
                      .|+.|...
T Consensus        57 ~CP~C~~~   64 (70)
T PF11793_consen   57 ECPYCSSP   64 (70)
T ss_dssp             E-TTT-SE
T ss_pred             CCcCCCCe
Confidence            46666543


No 238
>KOG0978|consensus
Probab=47.54  E-value=4.1  Score=32.34  Aligned_cols=16  Identities=19%  Similarity=0.374  Sum_probs=9.9

Q ss_pred             eeccccCccccCchhH
Q psy3507          83 YKCEYCAYSCTQSSAL   98 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l   98 (134)
                      -.||.|+.+|.....+
T Consensus       679 RKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVH  694 (698)
T ss_pred             CCCCCCCCCCCccccc
Confidence            3677777777665443


No 239
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=47.50  E-value=20  Score=17.61  Aligned_cols=21  Identities=29%  Similarity=0.834  Sum_probs=10.2

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      |.|+.|++..  .+ ..|.|..|.
T Consensus         1 ~~C~~C~~~i--~g-~r~~C~~C~   21 (46)
T cd02249           1 YSCDGCLKPI--VG-VRYHCLVCE   21 (46)
T ss_pred             CCCcCCCCCC--cC-CEEECCCCC
Confidence            3455555521  12 455565554


No 240
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=47.12  E-value=12  Score=21.12  Aligned_cols=9  Identities=22%  Similarity=0.966  Sum_probs=2.5

Q ss_pred             ccccCCCCC
Q psy3507          36 LMYHCKTCS   44 (134)
Q Consensus        36 ~~~~C~~C~   44 (134)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            446666666


No 241
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=46.90  E-value=21  Score=17.22  Aligned_cols=9  Identities=22%  Similarity=1.054  Sum_probs=4.6

Q ss_pred             cceeeCCCC
Q psy3507          53 YKYTCYACD   61 (134)
Q Consensus        53 ~~~~C~~C~   61 (134)
                      ..|.|..|+
T Consensus        12 ~r~~C~~C~   20 (41)
T cd02337          12 TRWHCTVCE   20 (41)
T ss_pred             CceECCCCc
Confidence            445555554


No 242
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=46.58  E-value=6.2  Score=28.69  Aligned_cols=27  Identities=19%  Similarity=0.495  Sum_probs=10.3

Q ss_pred             ccccCCCCCCcccCCCCcc-eeeCCCCC
Q psy3507          36 LMYHCKTCSTVSHPNISYK-YTCYACDY   62 (134)
Q Consensus        36 ~~~~C~~C~~~f~~~~~~~-~~C~~C~~   62 (134)
                      +-|+|..|+.....-...| -.|..||.
T Consensus       284 RFFkC~~C~~Rt~sl~r~P~~~C~~Cg~  311 (344)
T PF09332_consen  284 RFFKCKDCGNRTISLERLPKKHCSNCGS  311 (344)
T ss_dssp             EEEE-T-TS-EEEESSSS--S--TTT-S
T ss_pred             eeEECCCCCCeeeecccCCCCCCCcCCc
Confidence            3467777776654322223 34666664


No 243
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=46.34  E-value=4.6  Score=28.48  Aligned_cols=26  Identities=23%  Similarity=0.490  Sum_probs=7.9

Q ss_pred             CccccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          35 ELMYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        35 ~~~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      .+-..|..|+.....   ....|+.||..
T Consensus       195 ~R~L~Cs~C~t~W~~---~R~~Cp~Cg~~  220 (290)
T PF04216_consen  195 KRYLHCSLCGTEWRF---VRIKCPYCGNT  220 (290)
T ss_dssp             EEEEEETTT--EEE-----TTS-TTT---
T ss_pred             cEEEEcCCCCCeeee---cCCCCcCCCCC
Confidence            344445555543321   12345555543


No 244
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=46.33  E-value=7.7  Score=19.69  Aligned_cols=15  Identities=33%  Similarity=0.769  Sum_probs=10.7

Q ss_pred             CCCeecCcChhhhcC
Q psy3507         108 DKPYICQQCRDTFSS  122 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~  122 (134)
                      ++++.|..||..|..
T Consensus         2 Dk~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVF   16 (49)
T ss_pred             CeeEEcccCCCeEEE
Confidence            456778888877754


No 245
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=46.01  E-value=15  Score=17.10  Aligned_cols=8  Identities=38%  Similarity=1.277  Sum_probs=3.6

Q ss_pred             eeCCCCCc
Q psy3507          56 TCYACDYH   63 (134)
Q Consensus        56 ~C~~C~~~   63 (134)
                      .|..|+..
T Consensus        22 ~C~~C~Y~   29 (35)
T PF02150_consen   22 ACRTCGYE   29 (35)
T ss_dssp             EESSSS-E
T ss_pred             CCCCCCCc
Confidence            45555543


No 246
>KOG2636|consensus
Probab=46.01  E-value=14  Score=27.77  Aligned_cols=28  Identities=21%  Similarity=0.440  Sum_probs=22.1

Q ss_pred             hhcCCCCCeecCcCh-hhhcCHHHHHHHH
Q psy3507         103 RKHTGDKPYICQQCR-DTFSSLYLFRNRL  130 (134)
Q Consensus       103 ~~h~~~~~~~C~~C~-~~F~~~~~l~~H~  130 (134)
                      +.|.-...|.|.+|| +++.-+..+.+|.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHh
Confidence            456666779999999 7888888888885


No 247
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=45.98  E-value=20  Score=21.31  Aligned_cols=7  Identities=57%  Similarity=1.611  Sum_probs=3.5

Q ss_pred             eeeCCCC
Q psy3507          55 YTCYACD   61 (134)
Q Consensus        55 ~~C~~C~   61 (134)
                      |.|..|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            4555554


No 248
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=45.65  E-value=19  Score=21.01  Aligned_cols=38  Identities=18%  Similarity=0.432  Sum_probs=19.9

Q ss_pred             ceeccccCccccCchhHHHHhhhc-CCC-CCeecCcChhhhc
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERKH-TGD-KPYICQQCRDTFS  121 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~h-~~~-~~~~C~~C~~~F~  121 (134)
                      ...|+.||..-..-..++  ++.- .+. .-|.|..|+..++
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q--~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQ--TRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cCCCCCCCCCeeEEEEec--cCCCCCCcEEEEEeCCCCCeeE
Confidence            368999985422211111  2221 111 2389999997764


No 249
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=45.51  E-value=9.2  Score=18.50  Aligned_cols=12  Identities=25%  Similarity=0.268  Sum_probs=7.8

Q ss_pred             ccccCCCCCCcc
Q psy3507          36 LMYHCKTCSTVS   47 (134)
Q Consensus        36 ~~~~C~~C~~~f   47 (134)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356677777665


No 250
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=44.62  E-value=11  Score=22.15  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=6.2

Q ss_pred             ccccCCCCCCcc
Q psy3507          36 LMYHCKTCSTVS   47 (134)
Q Consensus        36 ~~~~C~~C~~~f   47 (134)
                      +++.|+.||..|
T Consensus        78 ~~~rC~eCG~~f   89 (97)
T cd00924          78 KPKRCPECGHVF   89 (97)
T ss_pred             CceeCCCCCcEE
Confidence            455555555544


No 251
>PF12907 zf-met2:  Zinc-binding
Probab=44.46  E-value=9.5  Score=18.47  Aligned_cols=20  Identities=30%  Similarity=0.572  Sum_probs=9.3

Q ss_pred             eccccCccc---cCchhHHHHhh
Q psy3507          84 KCEYCAYSC---TQSSALKIHER  103 (134)
Q Consensus        84 ~C~~C~~~f---~~~~~l~~H~~  103 (134)
                      .|.+|-..|   .+...|..|..
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHH
Confidence            455555322   22344666644


No 252
>PTZ00448 hypothetical protein; Provisional
Probab=44.35  E-value=17  Score=26.70  Aligned_cols=23  Identities=17%  Similarity=0.496  Sum_probs=19.9

Q ss_pred             CeecCcChhhhcCHHHHHHHHHh
Q psy3507         110 PYICQQCRDTFSSLYLFRNRLQS  132 (134)
Q Consensus       110 ~~~C~~C~~~F~~~~~l~~H~~~  132 (134)
                      .|.|..|+-.|.+....+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999988888888864


No 253
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=44.26  E-value=16  Score=22.85  Aligned_cols=29  Identities=24%  Similarity=0.522  Sum_probs=17.3

Q ss_pred             ccccCCCCCCccc----CCCCcceeeCCCCCcc
Q psy3507          36 LMYHCKTCSTVSH----PNISYKYTCYACDYHT   64 (134)
Q Consensus        36 ~~~~C~~C~~~f~----~~~~~~~~C~~C~~~f   64 (134)
                      -.|.|..|+..+.    +.....|.|..|+..+
T Consensus       111 ~~y~C~~C~~~~~~~rr~~~~~~y~C~~C~g~l  143 (146)
T smart00731      111 YPYRCTGCGQRYLRVRRSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEEECCCCCCCCceEccccCcceEEcCCCCCEE
Confidence            3577777776655    1111457777777654


No 254
>KOG0957|consensus
Probab=43.94  E-value=20  Score=27.57  Aligned_cols=48  Identities=23%  Similarity=0.484  Sum_probs=30.6

Q ss_pred             ccceecCcccccccccCCCCccccCCCCCCccc-------------CCCCcceeeCCCCCccCC
Q psy3507          16 PFTLATCIHCRLLLVPTAEELMYHCKTCSTVSH-------------PNISYKYTCYACDYHTLM   66 (134)
Q Consensus        16 ~~~~~~C~~C~~h~~~h~~~~~~~C~~C~~~f~-------------~~~~~~~~C~~C~~~f~~   66 (134)
                      +-..+.|++|++-..   ..+..+|+.|...|.             ......+.|..|++.-.+
T Consensus       541 ~a~~ysCgiCkks~d---QHll~~CDtC~lhYHlGCL~PPLTR~Pkk~kn~gWqCsECdk~esS  601 (707)
T KOG0957|consen  541 KAMNYSCGICKKSTD---QHLLTQCDTCHLHYHLGCLSPPLTRLPKKNKNFGWQCSECDKNESS  601 (707)
T ss_pred             cccceeeeeeccchh---hHHHhhcchhhceeeccccCCccccCcccccCcceeecccccccCc
Confidence            344678999955333   334578999998887             122334789999665433


No 255
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=43.58  E-value=37  Score=22.27  Aligned_cols=32  Identities=19%  Similarity=0.630  Sum_probs=17.1

Q ss_pred             CCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhh
Q psy3507          79 GEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDT  119 (134)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  119 (134)
                      +..-|.|+.|.-.|+...+...         -|.|+.||..
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~~~---------~F~Cp~Cg~~  141 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAMEL---------GFTCPKCGED  141 (176)
T ss_pred             cCCceeCCCCCCcccHHHHHHh---------CCCCCCCCch
Confidence            3344777666655544333221         2777777653


No 256
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=43.31  E-value=24  Score=17.72  Aligned_cols=8  Identities=50%  Similarity=1.497  Sum_probs=3.7

Q ss_pred             ceeeCCCC
Q psy3507          54 KYTCYACD   61 (134)
Q Consensus        54 ~~~C~~C~   61 (134)
                      .|.|..|.
T Consensus        15 R~~C~~C~   22 (48)
T cd02341          15 RYHCSECD   22 (48)
T ss_pred             eEECCCCC
Confidence            34444443


No 257
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=43.20  E-value=23  Score=25.43  Aligned_cols=26  Identities=23%  Similarity=0.585  Sum_probs=13.0

Q ss_pred             CCccccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          34 EELMYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      |.+-..|..|+..-..   ..-.|+.||.
T Consensus       209 G~RyL~CslC~teW~~---~R~~C~~Cg~  234 (309)
T PRK03564        209 GLRYLHCNLCESEWHV---VRVKCSNCEQ  234 (309)
T ss_pred             CceEEEcCCCCCcccc---cCccCCCCCC
Confidence            3444556666654321   2345666664


No 258
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=42.62  E-value=13  Score=17.55  Aligned_cols=12  Identities=25%  Similarity=1.035  Sum_probs=5.0

Q ss_pred             cccCCCCCCccc
Q psy3507          37 MYHCKTCSTVSH   48 (134)
Q Consensus        37 ~~~C~~C~~~f~   48 (134)
                      .|+|+.||....
T Consensus         6 ~YkC~~CGniVe   17 (36)
T PF06397_consen    6 FYKCEHCGNIVE   17 (36)
T ss_dssp             EEE-TTT--EEE
T ss_pred             EEEccCCCCEEE
Confidence            466666665543


No 259
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=42.37  E-value=21  Score=22.78  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=6.2

Q ss_pred             ccccCCCCCCcc
Q psy3507          36 LMYHCKTCSTVS   47 (134)
Q Consensus        36 ~~~~C~~C~~~f   47 (134)
                      ..|.|+.|+..+
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            345555555543


No 260
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=42.08  E-value=19  Score=27.34  Aligned_cols=21  Identities=24%  Similarity=0.627  Sum_probs=17.9

Q ss_pred             eecCcChhhhcCHHHHHHHHH
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +.|+.|.+.|.....+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            678889999999988888874


No 261
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=41.85  E-value=28  Score=22.53  Aligned_cols=13  Identities=23%  Similarity=0.652  Sum_probs=5.7

Q ss_pred             eeccccCccccCc
Q psy3507          83 YKCEYCAYSCTQS   95 (134)
Q Consensus        83 ~~C~~C~~~f~~~   95 (134)
                      +.|+.|++.|-..
T Consensus       131 ~~C~~CgkiYW~G  143 (165)
T COG1656         131 YRCPKCGKIYWKG  143 (165)
T ss_pred             eECCCCcccccCc
Confidence            3344444444333


No 262
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=41.53  E-value=19  Score=27.42  Aligned_cols=26  Identities=15%  Similarity=0.374  Sum_probs=19.4

Q ss_pred             ceeccccCccccCchhHHHHhhh-cCC
Q psy3507          82 PYKCEYCAYSCTQSSALKIHERK-HTG  107 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~-h~~  107 (134)
                      -+.|+.|++.|.....+..|+.. |.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            36788888888888888888764 544


No 263
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=41.19  E-value=22  Score=18.04  Aligned_cols=20  Identities=30%  Similarity=0.884  Sum_probs=11.9

Q ss_pred             CCCeecCcChhhhcCHHHHHHHH
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRL  130 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~  130 (134)
                      .+|--|+.|...|..   |..|+
T Consensus         3 ~k~GYCE~Cr~kfd~---l~~Hi   22 (49)
T smart00586        3 KKPGYCENCREKYDD---LETHL   22 (49)
T ss_pred             CCCcccccHhHHHhh---HHHHh
Confidence            345567777766653   55554


No 264
>KOG2272|consensus
Probab=41.09  E-value=36  Score=23.81  Aligned_cols=14  Identities=14%  Similarity=0.468  Sum_probs=8.7

Q ss_pred             CceeccccCccccC
Q psy3507          81 KPYKCEYCAYSCTQ   94 (134)
Q Consensus        81 ~~~~C~~C~~~f~~   94 (134)
                      ..|.|..|.+.|.-
T Consensus       220 eHFvCa~CekPFlG  233 (332)
T KOG2272|consen  220 EHFVCAKCEKPFLG  233 (332)
T ss_pred             hheeehhcCCcccc
Confidence            34677777666654


No 265
>COG5415 Predicted integral membrane metal-binding protein [General function prediction only]
Probab=40.95  E-value=17  Score=24.59  Aligned_cols=41  Identities=17%  Similarity=0.267  Sum_probs=24.1

Q ss_pred             ccccccccCCccceecCcccccccc-cCCCCcc---ccCCCCCCc
Q psy3507           6 VCTASIGLKNPFTLATCIHCRLLLV-PTAEELM---YHCKTCSTV   46 (134)
Q Consensus         6 ~~~~~~~~~~~~~~~~C~~C~~h~~-~h~~~~~---~~C~~C~~~   46 (134)
                      +.++.....+|+...+|..|..|-- .+.++++   |.|+.|...
T Consensus       179 l~G~ne~~~~~~~alIC~~C~hhngl~~~~ek~~~efiC~~Cn~~  223 (251)
T COG5415         179 LAGGNELDLSPFKALICPQCHHHNGLYRLAEKPIIEFICPHCNHK  223 (251)
T ss_pred             HhCCCccccCchhhhccccccccccccccccccchheecccchhh
Confidence            3445555668888888998855432 2333333   556666543


No 266
>PRK11823 DNA repair protein RadA; Provisional
Probab=40.94  E-value=22  Score=26.86  Aligned_cols=25  Identities=24%  Similarity=0.582  Sum_probs=15.0

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCCcc
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDYHT   64 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~~f   64 (134)
                      .|.|..||..+   .....+|+.|+.+-
T Consensus         7 ~y~C~~Cg~~~---~~~~g~Cp~C~~w~   31 (446)
T PRK11823          7 AYVCQECGAES---PKWLGRCPECGAWN   31 (446)
T ss_pred             eEECCcCCCCC---cccCeeCcCCCCcc
Confidence            47777777654   33445677776543


No 267
>KOG2636|consensus
Probab=40.76  E-value=22  Score=26.86  Aligned_cols=28  Identities=29%  Similarity=0.521  Sum_probs=21.2

Q ss_pred             HhcCCCceeccccC-ccccCchhHHHHhh
Q psy3507          76 KHTGEKPYKCEYCA-YSCTQSSALKIHER  103 (134)
Q Consensus        76 ~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  103 (134)
                      .|--...|.|.+|| .++.-+..+.+|-.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhH
Confidence            45556678888888 78888888888854


No 268
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=40.63  E-value=39  Score=23.47  Aligned_cols=53  Identities=17%  Similarity=0.236  Sum_probs=31.5

Q ss_pred             CCccccCCCCCCcccCCCCcceeeC-CCCCccCChHHHHHHHHHhcCCCceeccccCccccCc
Q psy3507          34 EELMYHCKTCSTVSHPNISYKYTCY-ACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQS   95 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~~~~~~~~~C~-~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   95 (134)
                      ....|.|++.+..|.  +..+|..- .||-+|.....-..  .     ....|++|+..|...
T Consensus       110 ~~~~~~CPvt~~~~~--~~~~fv~l~~cG~V~s~~alke~--k-----~~~~Cp~c~~~f~~~  163 (260)
T PF04641_consen  110 SEGRFICPVTGKEFN--GKHKFVYLRPCGCVFSEKALKEL--K-----KSKKCPVCGKPFTEE  163 (260)
T ss_pred             CCceeECCCCCcccC--CceeEEEEcCCCCEeeHHHHHhh--c-----ccccccccCCccccC
Confidence            345688888888873  33344433 57777765432221  1     234588888887743


No 269
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.07  E-value=9.3  Score=26.18  Aligned_cols=23  Identities=17%  Similarity=0.287  Sum_probs=12.9

Q ss_pred             CceeccccCccccCchhHHHHhh
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHER  103 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~  103 (134)
                      +.+.||+|+..|....-+..-.|
T Consensus        18 k~ieCPvC~tkFkkeev~tgsiR   40 (267)
T COG1655          18 KTIECPVCNTKFKKEEVKTGSIR   40 (267)
T ss_pred             ceeccCcccchhhhhheecccee
Confidence            44667777776666544433333


No 270
>PRK05978 hypothetical protein; Provisional
Probab=39.52  E-value=23  Score=22.49  Aligned_cols=6  Identities=50%  Similarity=1.143  Sum_probs=2.4

Q ss_pred             eCCCCC
Q psy3507          57 CYACDY   62 (134)
Q Consensus        57 C~~C~~   62 (134)
                      |+.||.
T Consensus        55 C~~CG~   60 (148)
T PRK05978         55 CAACGE   60 (148)
T ss_pred             ccccCC
Confidence            444443


No 271
>KOG1280|consensus
Probab=39.47  E-value=33  Score=25.08  Aligned_cols=38  Identities=21%  Similarity=0.544  Sum_probs=27.1

Q ss_pred             CCceeccccCccccCchhHHHHhhh-cCCCCC-eecCcCh
Q psy3507          80 EKPYKCEYCAYSCTQSSALKIHERK-HTGDKP-YICQQCR  117 (134)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~-~~C~~C~  117 (134)
                      ...|.|+.|+..-.+...|..|... |....+ ..|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3469999999998889999999665 543322 3556554


No 272
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=39.46  E-value=19  Score=21.71  Aligned_cols=28  Identities=14%  Similarity=0.344  Sum_probs=12.5

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~   66 (134)
                      .+|+.|++...--+.. ..|..|+....-
T Consensus        70 V~CP~C~K~TKmLGr~-D~CM~C~~pLTL   97 (114)
T PF11023_consen   70 VECPNCGKQTKMLGRV-DACMHCKEPLTL   97 (114)
T ss_pred             eECCCCCChHhhhchh-hccCcCCCcCcc
Confidence            4455555554322222 245555544333


No 273
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=39.43  E-value=48  Score=17.24  Aligned_cols=45  Identities=7%  Similarity=0.101  Sum_probs=18.3

Q ss_pred             CccccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccc
Q psy3507          35 ELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEY   87 (134)
Q Consensus        35 ~~~~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~   87 (134)
                      ...+.|++-...|.    .|.....|+..|...+ +...+   .......|++
T Consensus         9 ~~~~~CPiT~~~~~----~PV~s~~C~H~fek~a-I~~~i---~~~~~~~CPv   53 (57)
T PF11789_consen    9 TISLKCPITLQPFE----DPVKSKKCGHTFEKEA-ILQYI---QRNGSKRCPV   53 (57)
T ss_dssp             B--SB-TTTSSB-S----SEEEESSS--EEEHHH-HHHHC---TTTS-EE-SC
T ss_pred             EeccCCCCcCChhh----CCcCcCCCCCeecHHH-HHHHH---HhcCCCCCCC
Confidence            34466666665543    3555666666664433 33332   2234456665


No 274
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=39.32  E-value=31  Score=14.79  Aligned_cols=21  Identities=29%  Similarity=0.578  Sum_probs=8.7

Q ss_pred             ccccccccCCCCccccCCCCC
Q psy3507          24 HCRLLLVPTAEELMYHCKTCS   44 (134)
Q Consensus        24 ~C~~h~~~h~~~~~~~C~~C~   44 (134)
                      .|+.-+.--.+-....|..|.
T Consensus         3 ~Cr~~L~yp~GA~sVrCa~C~   23 (25)
T PF06943_consen    3 GCRTLLMYPRGAPSVRCACCH   23 (25)
T ss_pred             CCCceEEcCCCCCCeECCccC
Confidence            333333333344444444443


No 275
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.28  E-value=12  Score=18.85  Aligned_cols=16  Identities=31%  Similarity=0.607  Sum_probs=10.5

Q ss_pred             ecCcChhhhcCHHHHH
Q psy3507         112 ICQQCRDTFSSLYLFR  127 (134)
Q Consensus       112 ~C~~C~~~F~~~~~l~  127 (134)
                      .|+.|++.|..+....
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            5777777777655443


No 276
>KOG3002|consensus
Probab=39.19  E-value=29  Score=24.79  Aligned_cols=91  Identities=20%  Similarity=0.296  Sum_probs=49.4

Q ss_pred             ccceecCcccccccccCCCCc---cccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccc----c
Q psy3507          16 PFTLATCIHCRLLLVPTAEEL---MYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEY----C   88 (134)
Q Consensus        16 ~~~~~~C~~C~~h~~~h~~~~---~~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C   88 (134)
                      -+....|++|..-+..+.-+-   -..|..|-.      ++...|+.|...+.....+..  ..-.....+.|+.    |
T Consensus        45 ~~~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~------~~~~~CP~Cr~~~g~~R~~am--EkV~e~~~vpC~~~~~GC  116 (299)
T KOG3002|consen   45 DLDLLDCPVCFNPLSPPIFQCDNGHLACSSCRT------KVSNKCPTCRLPIGNIRCRAM--EKVAEAVLVPCKNAKLGC  116 (299)
T ss_pred             chhhccCchhhccCcccceecCCCcEehhhhhh------hhcccCCccccccccHHHHHH--HHHHHhceecccccccCC
Confidence            445566777754444332111   022223321      456789999888886655443  3223334566663    7


Q ss_pred             CccccCchhHHHHhhhcCCCCCeecCcC
Q psy3507          89 AYSCTQSSALKIHERKHTGDKPYICQQC  116 (134)
Q Consensus        89 ~~~f~~~~~l~~H~~~h~~~~~~~C~~C  116 (134)
                      .+.|.-... ..|.+.-.. +|+.|+.=
T Consensus       117 ~~~~~Y~~~-~~HE~~C~f-~~~~CP~p  142 (299)
T KOG3002|consen  117 TKSFPYGEK-SKHEKVCEF-RPCSCPVP  142 (299)
T ss_pred             ceeeccccc-ccccccccc-CCcCCCCC
Confidence            777766655 556555443 67777654


No 277
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=39.15  E-value=27  Score=16.72  Aligned_cols=23  Identities=17%  Similarity=0.443  Sum_probs=9.9

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      ..|..|++.+.... ..+.|..|+
T Consensus        12 ~~C~~C~~~i~~~~-~~~~C~~C~   34 (49)
T smart00109       12 TKCCVCRKSIWGSF-QGLRCSWCK   34 (49)
T ss_pred             CCccccccccCcCC-CCcCCCCCC
Confidence            34555555443211 234455553


No 278
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=39.06  E-value=25  Score=23.48  Aligned_cols=29  Identities=17%  Similarity=0.400  Sum_probs=18.4

Q ss_pred             ccccCCCCCC---cccCCCCcceeeCCCCCcc
Q psy3507          36 LMYHCKTCST---VSHPNISYKYTCYACDYHT   64 (134)
Q Consensus        36 ~~~~C~~C~~---~f~~~~~~~~~C~~C~~~f   64 (134)
                      +.|.|+.|+.   .|.........|+.|+..|
T Consensus       151 kGfiCe~C~~~~~IfPF~~~~~~~C~~C~~v~  182 (202)
T PF13901_consen  151 KGFICEICNSDDIIFPFQIDTTVRCPKCKSVF  182 (202)
T ss_pred             CCCCCccCCCCCCCCCCCCCCeeeCCcCcccc
Confidence            4577777764   3334444567788887765


No 279
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=38.88  E-value=24  Score=26.71  Aligned_cols=26  Identities=23%  Similarity=0.568  Sum_probs=15.9

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCCCccC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACDYHTL   65 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~~~f~   65 (134)
                      .|.|..||..+   .....+|+.|+.+-.
T Consensus         7 ~y~C~~Cg~~~---~~~~g~Cp~C~~w~t   32 (454)
T TIGR00416         7 KFVCQHCGADS---PKWQGKCPACHAWNT   32 (454)
T ss_pred             eEECCcCCCCC---ccccEECcCCCCccc
Confidence            47777777754   334566777765433


No 280
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=38.82  E-value=17  Score=17.78  Aligned_cols=9  Identities=22%  Similarity=0.678  Sum_probs=3.9

Q ss_pred             CCCCCCccc
Q psy3507          40 CKTCSTVSH   48 (134)
Q Consensus        40 C~~C~~~f~   48 (134)
                      |+.||..+.
T Consensus         5 C~~Cg~~l~   13 (47)
T PF13005_consen    5 CPDCGGELK   13 (47)
T ss_pred             CCCCCceee
Confidence            444444433


No 281
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.66  E-value=30  Score=21.34  Aligned_cols=32  Identities=19%  Similarity=0.370  Sum_probs=20.7

Q ss_pred             cccCCCCCCccc------------CCCCcceeeCCCCCccCChH
Q psy3507          37 MYHCKTCSTVSH------------PNISYKYTCYACDYHTLMSE   68 (134)
Q Consensus        37 ~~~C~~C~~~f~------------~~~~~~~~C~~C~~~f~~~~   68 (134)
                      ..+|+.|+....            ..-+.|--|..||+.|....
T Consensus        39 i~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpwte   82 (160)
T COG4306          39 ITQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             HhcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcHH
Confidence            356777776544            33345666888888887754


No 282
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=38.52  E-value=27  Score=25.74  Aligned_cols=24  Identities=29%  Similarity=0.632  Sum_probs=14.3

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCcc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHT   64 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f   64 (134)
                      |.|..||..+   .....+|+.|+.+-
T Consensus         1 ~~c~~cg~~~---~~~~g~cp~c~~w~   24 (372)
T cd01121           1 YVCSECGYVS---PKWLGKCPECGEWN   24 (372)
T ss_pred             CCCCCCCCCC---CCccEECcCCCCce
Confidence            5677777654   23445677776543


No 283
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=38.30  E-value=42  Score=16.36  Aligned_cols=27  Identities=11%  Similarity=0.117  Sum_probs=9.5

Q ss_pred             CCCCCCcccCCCCcceeeCCCCCccCChH
Q psy3507          40 CKTCSTVSHPNISYKYTCYACDYHTLMSE   68 (134)
Q Consensus        40 C~~C~~~f~~~~~~~~~C~~C~~~f~~~~   68 (134)
                      |++|-. |......|..=+ ||.+|....
T Consensus         1 CpIc~e-~~~~~n~P~~L~-CGH~~c~~c   27 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLP-CGHVFCKDC   27 (43)
T ss_dssp             -TTT-----TTSS-EEE-S-SS-EEEHHH
T ss_pred             CCcccc-ccCCCCCCEEEe-CccHHHHHH
Confidence            455555 544444444433 666665443


No 284
>KOG0696|consensus
Probab=38.22  E-value=12  Score=28.43  Aligned_cols=59  Identities=20%  Similarity=0.368  Sum_probs=37.4

Q ss_pred             CCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHH-hhhcCCCCCeecCcChh
Q psy3507          51 ISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIH-ERKHTGDKPYICQQCRD  118 (134)
Q Consensus        51 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~~~~~~~C~~C~~  118 (134)
                      +...|+|.+|.        +..|.+.|. -..|.|+--++.+.+...-..| .+.|+-..|--|.+||.
T Consensus        70 gKQGfQCqvC~--------fvvHkrChe-fVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGs  129 (683)
T KOG0696|consen   70 GKQGFQCQVCC--------FVVHKRCHE-FVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGS  129 (683)
T ss_pred             ccCceeeeEEe--------ehhhhhhcc-eEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHH
Confidence            44567777774        355666663 2347777777777776666666 34566556666777764


No 285
>PRK07591 threonine synthase; Validated
Probab=37.52  E-value=23  Score=26.53  Aligned_cols=22  Identities=18%  Similarity=0.511  Sum_probs=9.5

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      ++|..||+.|... .. +.|+.|+
T Consensus        19 l~C~~Cg~~~~~~-~~-~~C~~cg   40 (421)
T PRK07591         19 LKCRECGAEYPLG-PI-HVCEECF   40 (421)
T ss_pred             EEeCCCCCcCCCC-CC-ccCCCCC
Confidence            4444455444432 11 4444444


No 286
>PRK11827 hypothetical protein; Provisional
Probab=37.51  E-value=25  Score=18.68  Aligned_cols=28  Identities=21%  Similarity=0.197  Sum_probs=11.6

Q ss_pred             cCcccccccccCCCCccccCCCCCCccc
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSH   48 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~   48 (134)
                      .|..|+.-.+.........|..|+..|.
T Consensus        10 aCP~ckg~L~~~~~~~~Lic~~~~laYP   37 (60)
T PRK11827         10 ACPVCNGKLWYNQEKQELICKLDNLAFP   37 (60)
T ss_pred             ECCCCCCcCeEcCCCCeEECCccCeecc
Confidence            4555533333322223344555555444


No 287
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=37.37  E-value=14  Score=24.63  Aligned_cols=11  Identities=27%  Similarity=0.498  Sum_probs=5.1

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      +.|+.||.++.
T Consensus        44 ~~C~~CgYR~~   54 (201)
T COG1779          44 GVCERCGYRST   54 (201)
T ss_pred             EEccccCCccc
Confidence            34444554443


No 288
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=37.36  E-value=18  Score=22.51  Aligned_cols=27  Identities=19%  Similarity=0.600  Sum_probs=12.1

Q ss_pred             ecCc--ccccccccCCCCccccCCCCCCcc
Q psy3507          20 ATCI--HCRLLLVPTAEELMYHCKTCSTVS   47 (134)
Q Consensus        20 ~~C~--~C~~h~~~h~~~~~~~C~~C~~~f   47 (134)
                      .-|.  .|++-...- +...|.|+.|++..
T Consensus        19 ~aC~~~~C~kKv~~~-~~~~y~C~~C~~~~   47 (146)
T PF08646_consen   19 PACPNEKCNKKVTEN-GDGSYRCEKCNKTV   47 (146)
T ss_dssp             EE-TSTTTS-B-EEE-TTTEEEETTTTEEE
T ss_pred             CCCCCccCCCEeecC-CCcEEECCCCCCcC
Confidence            3466  664433322 33446666666554


No 289
>KOG0717|consensus
Probab=37.16  E-value=21  Score=27.11  Aligned_cols=22  Identities=32%  Similarity=0.481  Sum_probs=18.5

Q ss_pred             eeccccCccccCchhHHHHhhh
Q psy3507          83 YKCEYCAYSCTQSSALKIHERK  104 (134)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (134)
                      +-|.+|++.|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999999999888654


No 290
>PRK06450 threonine synthase; Validated
Probab=36.99  E-value=22  Score=25.80  Aligned_cols=23  Identities=22%  Similarity=0.567  Sum_probs=12.1

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      ++|..||+.|..  ...+.|+.|+.
T Consensus         4 ~~C~~Cg~~~~~--~~~~~C~~cg~   26 (338)
T PRK06450          4 EVCMKCGKERES--IYEIRCKKCGG   26 (338)
T ss_pred             eEECCcCCcCCC--cccccCCcCCC
Confidence            456666666532  22355666653


No 291
>PHA02942 putative transposase; Provisional
Probab=36.95  E-value=39  Score=25.00  Aligned_cols=11  Identities=27%  Similarity=0.905  Sum_probs=5.9

Q ss_pred             ceeccccCccc
Q psy3507          82 PYKCEYCAYSC   92 (134)
Q Consensus        82 ~~~C~~C~~~f   92 (134)
                      .|.|+.||...
T Consensus       342 ~f~C~~CG~~~  352 (383)
T PHA02942        342 YFHCPSCGYEN  352 (383)
T ss_pred             EEECCCCCCEe
Confidence            45565555543


No 292
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=36.95  E-value=13  Score=19.00  Aligned_cols=11  Identities=18%  Similarity=0.655  Sum_probs=5.7

Q ss_pred             ecCcChhhhcC
Q psy3507         112 ICQQCRDTFSS  122 (134)
Q Consensus       112 ~C~~C~~~F~~  122 (134)
                      .|++|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            88899888864


No 293
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=36.80  E-value=28  Score=20.76  Aligned_cols=21  Identities=14%  Similarity=0.301  Sum_probs=17.1

Q ss_pred             eecCcChhhhcCHHHHHHHHH
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +-|-.|.+-|.+...|..|.+
T Consensus        56 hYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          56 HYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhc
Confidence            678888888888888888864


No 294
>PLN02294 cytochrome c oxidase subunit Vb
Probab=36.75  E-value=17  Score=23.64  Aligned_cols=19  Identities=26%  Similarity=0.576  Sum_probs=14.1

Q ss_pred             hhhcCCCCCeecCcChhhhc
Q psy3507         102 ERKHTGDKPYICQQCRDTFS  121 (134)
Q Consensus       102 ~~~h~~~~~~~C~~C~~~F~  121 (134)
                      +..+.| +|..|+.||..|.
T Consensus       134 f~L~kG-kp~RCpeCG~~fk  152 (174)
T PLN02294        134 FWLEKG-KSFECPVCTQYFE  152 (174)
T ss_pred             EEecCC-CceeCCCCCCEEE
Confidence            344444 6899999999886


No 295
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=36.33  E-value=28  Score=24.63  Aligned_cols=24  Identities=25%  Similarity=0.649  Sum_probs=12.0

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCcc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHT   64 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f   64 (134)
                      |.|+.|...|-.   .+-.|+.|+-.|
T Consensus       256 yvCs~Clsi~C~---~p~~C~~Cgt~f  279 (279)
T TIGR00627       256 FVCSVCLSVLCQ---YTPICKTCKTAF  279 (279)
T ss_pred             EECCCccCCcCC---CCCCCCCCCCCC
Confidence            666666555532   223555555443


No 296
>KOG3799|consensus
Probab=36.27  E-value=17  Score=22.69  Aligned_cols=42  Identities=24%  Similarity=0.343  Sum_probs=22.3

Q ss_pred             eecCcccccccccCCCCccccCCCCCCccc---------CCCCcceeeCCCCC
Q psy3507          19 LATCIHCRLLLVPTAEELMYHCKTCSTVSH---------PNISYKYTCYACDY   62 (134)
Q Consensus        19 ~~~C~~C~~h~~~h~~~~~~~C~~C~~~f~---------~~~~~~~~C~~C~~   62 (134)
                      ..+|++|.+-.  -...--+.|.+|.-.|-         .+....+.|..|.+
T Consensus        65 datC~IC~KTK--FADG~GH~C~YCq~r~CARCGGrv~lrsNKv~wvcnlc~k  115 (169)
T KOG3799|consen   65 DATCGICHKTK--FADGCGHNCSYCQTRFCARCGGRVSLRSNKVMWVCNLCRK  115 (169)
T ss_pred             Ccchhhhhhcc--cccccCcccchhhhhHHHhcCCeeeeccCceEEeccCCcH
Confidence            35677873322  12222355666655543         34445677777765


No 297
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=36.19  E-value=34  Score=17.42  Aligned_cols=12  Identities=25%  Similarity=0.697  Sum_probs=6.3

Q ss_pred             eeccccCccccC
Q psy3507          83 YKCEYCAYSCTQ   94 (134)
Q Consensus        83 ~~C~~C~~~f~~   94 (134)
                      +.|+.|+..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            555555554444


No 298
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=36.09  E-value=30  Score=20.72  Aligned_cols=31  Identities=19%  Similarity=0.159  Sum_probs=19.0

Q ss_pred             CCCCcccCCCCcceeeCCCCCccCChHHHHHH
Q psy3507          42 TCSTVSHPNISYKYTCYACDYHTLMSEDMKKH   73 (134)
Q Consensus        42 ~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H   73 (134)
                      ++|..+.. ...-+.|+.||..+.+......-
T Consensus        20 ~~G~~~~v-~~~~~~C~~CGe~~~~~e~~~~~   50 (127)
T TIGR03830        20 YKGESITI-GVPGWYCPACGEELLDPEESKRN   50 (127)
T ss_pred             EcCEEEEE-eeeeeECCCCCCEEEcHHHHHHH
Confidence            34444444 33457788898888777655443


No 299
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=35.63  E-value=3.5  Score=19.32  Aligned_cols=11  Identities=18%  Similarity=0.625  Sum_probs=4.8

Q ss_pred             CeecCcChhhh
Q psy3507         110 PYICQQCRDTF  120 (134)
Q Consensus       110 ~~~C~~C~~~F  120 (134)
                      +..|..||-.+
T Consensus        21 ~isC~~CGPr~   31 (35)
T PF07503_consen   21 FISCTNCGPRY   31 (35)
T ss_dssp             T--BTTCC-SC
T ss_pred             CccCCCCCCCE
Confidence            45666666544


No 300
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=35.47  E-value=41  Score=16.77  Aligned_cols=8  Identities=25%  Similarity=0.924  Sum_probs=3.9

Q ss_pred             cceeeCCC
Q psy3507          53 YKYTCYAC   60 (134)
Q Consensus        53 ~~~~C~~C   60 (134)
                      ..|.|..|
T Consensus        14 ~r~~C~~C   21 (49)
T cd02335          14 IRIKCAEC   21 (49)
T ss_pred             cEEECCCC
Confidence            34555554


No 301
>PLN02748 tRNA dimethylallyltransferase
Probab=35.31  E-value=27  Score=26.64  Aligned_cols=24  Identities=17%  Similarity=0.540  Sum_probs=20.6

Q ss_pred             CCeecCcChh-hhcCHHHHHHHHHh
Q psy3507         109 KPYICQQCRD-TFSSLYLFRNRLQS  132 (134)
Q Consensus       109 ~~~~C~~C~~-~F~~~~~l~~H~~~  132 (134)
                      +.|.|..|++ .+....++..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4588999997 89999999999854


No 302
>PHA02998 RNA polymerase subunit; Provisional
Probab=35.26  E-value=35  Score=22.46  Aligned_cols=11  Identities=18%  Similarity=0.443  Sum_probs=5.0

Q ss_pred             eeccccCcccc
Q psy3507          83 YKCEYCAYSCT   93 (134)
Q Consensus        83 ~~C~~C~~~f~   93 (134)
                      |.|..|+..|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            44444444443


No 303
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=35.26  E-value=37  Score=24.14  Aligned_cols=24  Identities=25%  Similarity=0.443  Sum_probs=18.2

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHH
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      ..-|.|+.|-+-|.+...|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            345788888888888888888865


No 304
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=35.22  E-value=56  Score=26.15  Aligned_cols=52  Identities=23%  Similarity=0.365  Sum_probs=30.7

Q ss_pred             cccccccccccCCccceecCcccccccccCCCCccccCCCCCCcccCCCCcceeeCCCCCccCCh
Q psy3507           3 NYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMS   67 (134)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~C~~C~~h~~~h~~~~~~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~   67 (134)
                      .++.|    +..+|-....|..|+..+..      -.|+.||.......   --|+.||......
T Consensus         3 ~Cp~C----g~~n~~~akFC~~CG~~l~~------~~Cp~CG~~~~~~~---~fC~~CG~~~~~~   54 (645)
T PRK14559          3 ICPQC----QFENPNNNRFCQKCGTSLTH------KPCPQCGTEVPVDE---AHCPNCGAETGTI   54 (645)
T ss_pred             cCCCC----CCcCCCCCccccccCCCCCC------CcCCCCCCCCCccc---ccccccCCcccch
Confidence            34555    33455556678888665421      25888888743222   2488888765554


No 305
>KOG2923|consensus
Probab=34.98  E-value=25  Score=18.92  Aligned_cols=11  Identities=36%  Similarity=0.942  Sum_probs=5.4

Q ss_pred             CCCceeccccC
Q psy3507          79 GEKPYKCEYCA   89 (134)
Q Consensus        79 ~~~~~~C~~C~   89 (134)
                      |+..-.|+-|+
T Consensus        41 ge~Va~CpsCS   51 (67)
T KOG2923|consen   41 GEDVARCPSCS   51 (67)
T ss_pred             CCeeecCCCce
Confidence            44444555554


No 306
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=34.92  E-value=39  Score=19.93  Aligned_cols=12  Identities=33%  Similarity=0.445  Sum_probs=6.1

Q ss_pred             ceeeCCCCCccC
Q psy3507          54 KYTCYACDYHTL   65 (134)
Q Consensus        54 ~~~C~~C~~~f~   65 (134)
                      ...|+.||..+.
T Consensus        42 h~~C~~CG~y~~   53 (99)
T PRK14892         42 IITCGNCGLYTE   53 (99)
T ss_pred             eEECCCCCCccC
Confidence            345666655443


No 307
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=34.65  E-value=35  Score=16.15  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=3.4

Q ss_pred             ceeeCCCCCcc
Q psy3507          54 KYTCYACDYHT   64 (134)
Q Consensus        54 ~~~C~~C~~~f   64 (134)
                      .|-|+.|...+
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            35566666655


No 308
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=34.24  E-value=22  Score=19.51  Aligned_cols=12  Identities=33%  Similarity=0.927  Sum_probs=5.4

Q ss_pred             cccCCCCCCccc
Q psy3507          37 MYHCKTCSTVSH   48 (134)
Q Consensus        37 ~~~C~~C~~~f~   48 (134)
                      .|.|+.|++.|.
T Consensus        17 ~~~C~~C~~~~~   28 (70)
T PF07191_consen   17 HYHCEACQKDYK   28 (70)
T ss_dssp             EEEETTT--EEE
T ss_pred             EEECccccccce
Confidence            355666665543


No 309
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=34.22  E-value=16  Score=19.12  Aligned_cols=10  Identities=30%  Similarity=0.899  Sum_probs=6.1

Q ss_pred             CceeccccCc
Q psy3507          81 KPYKCEYCAY   90 (134)
Q Consensus        81 ~~~~C~~C~~   90 (134)
                      ..|-|+.|..
T Consensus        30 ~tYmC~eC~~   39 (56)
T PF09963_consen   30 HTYMCDECKE   39 (56)
T ss_pred             cceeChhHHH
Confidence            3477777654


No 310
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=33.06  E-value=34  Score=17.90  Aligned_cols=20  Identities=20%  Similarity=0.592  Sum_probs=10.2

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      ..|+.||..-    .....|+.||
T Consensus        28 ~~C~~CG~~~----~~H~vC~~CG   47 (57)
T PRK12286         28 VECPNCGEPK----LPHRVCPSCG   47 (57)
T ss_pred             eECCCCCCcc----CCeEECCCCC
Confidence            4566666532    1234566665


No 311
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=32.64  E-value=34  Score=17.51  Aligned_cols=27  Identities=19%  Similarity=0.418  Sum_probs=9.9

Q ss_pred             cCcc--cccccccCCCCcc--ccCCCCCCcc
Q psy3507          21 TCIH--CRLLLVPTAEELM--YHCKTCSTVS   47 (134)
Q Consensus        21 ~C~~--C~~h~~~h~~~~~--~~C~~C~~~f   47 (134)
                      .|..  |..-+....+...  ..|+.|+..|
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~f   50 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTEF   50 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSEE
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCcC
Confidence            4544  5444444333333  5565555544


No 312
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=32.49  E-value=34  Score=20.62  Aligned_cols=9  Identities=22%  Similarity=0.626  Sum_probs=6.1

Q ss_pred             eecCccccc
Q psy3507          19 LATCIHCRL   27 (134)
Q Consensus        19 ~~~C~~C~~   27 (134)
                      .+.|..|+.
T Consensus        22 ~l~C~kCgy   30 (113)
T COG1594          22 KLVCRKCGY   30 (113)
T ss_pred             EEECCCCCc
Confidence            677888833


No 313
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=32.48  E-value=28  Score=29.23  Aligned_cols=45  Identities=31%  Similarity=0.493  Sum_probs=26.4

Q ss_pred             eecCcccccccc-------cCCCCccccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          19 LATCIHCRLLLV-------PTAEELMYHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        19 ~~~C~~C~~h~~-------~h~~~~~~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      ...|+.|.+...       --..+..|.|+.||+.+.-..-.--.|+.||-.
T Consensus       796 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  847 (1006)
T PRK12775        796 VATCPKCHRPLEGDEEYVCCATSELQWRCDDCGKVSEGFAFPYGMCPACGGK  847 (1006)
T ss_pred             CccCcccCCCCCCCceeEEecCcceeeehhhhccccccccCCcCcCcccccc
Confidence            357888822211       123456799999998865322222358888854


No 314
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=32.28  E-value=25  Score=18.00  Aligned_cols=30  Identities=37%  Similarity=0.711  Sum_probs=15.3

Q ss_pred             eecCccccccccc--CCCCccccCCCCCCccc
Q psy3507          19 LATCIHCRLLLVP--TAEELMYHCKTCSTVSH   48 (134)
Q Consensus        19 ~~~C~~C~~h~~~--h~~~~~~~C~~C~~~f~   48 (134)
                      ...|+.|++-+-.  ...+...+|+-|+....
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~tiN~   35 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKTINH   35 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCccce
Confidence            3456666443222  22234566777776544


No 315
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=31.83  E-value=36  Score=17.25  Aligned_cols=19  Identities=26%  Similarity=0.810  Sum_probs=10.6

Q ss_pred             CCeecCcChhhhcCHHHHHHHH
Q psy3507         109 KPYICQQCRDTFSSLYLFRNRL  130 (134)
Q Consensus       109 ~~~~C~~C~~~F~~~~~l~~H~  130 (134)
                      ++--|+.|...|..   |..|+
T Consensus         4 k~GYCE~C~~ky~~---l~~Hi   22 (49)
T PF07535_consen    4 KPGYCENCRVKYDD---LEEHI   22 (49)
T ss_pred             CCccCccccchhhh---HHHHh
Confidence            34456666666543   55555


No 316
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=31.37  E-value=40  Score=24.23  Aligned_cols=26  Identities=23%  Similarity=0.485  Sum_probs=12.8

Q ss_pred             CCccccCCCCCCcccCCCCcceeeCCCCC
Q psy3507          34 EELMYHCKTCSTVSHPNISYKYTCYACDY   62 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~~~~~~~~~C~~C~~   62 (134)
                      |.+-..|..|+.....   ..-.|+.||.
T Consensus       207 G~RyL~CslC~teW~~---~R~~C~~Cg~  232 (305)
T TIGR01562       207 GLRYLSCSLCATEWHY---VRVKCSHCEE  232 (305)
T ss_pred             CceEEEcCCCCCcccc---cCccCCCCCC
Confidence            3444556666654321   2345666664


No 317
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.91  E-value=45  Score=21.44  Aligned_cols=20  Identities=15%  Similarity=0.165  Sum_probs=13.8

Q ss_pred             CCCCcceeeCCCCCccCChH
Q psy3507          49 PNISYKYTCYACDYHTLMSE   68 (134)
Q Consensus        49 ~~~~~~~~C~~C~~~f~~~~   68 (134)
                      ...+.|.-|..||+.|+.-.
T Consensus        63 ~~~~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   63 GHYEAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCCCCChhHHhCCCCCchHH
Confidence            34446777888888887754


No 318
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=30.88  E-value=37  Score=24.96  Aligned_cols=28  Identities=18%  Similarity=0.365  Sum_probs=21.4

Q ss_pred             hhcCCCCCeecCcCh-hhhcCHHHHHHHH
Q psy3507         103 RKHTGDKPYICQQCR-DTFSSLYLFRNRL  130 (134)
Q Consensus       103 ~~h~~~~~~~C~~C~-~~F~~~~~l~~H~  130 (134)
                      +.|.-.+.|.|.+|| +.+.-+..+.+|.
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhh
Confidence            456667789999999 7777777777774


No 319
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=30.75  E-value=36  Score=17.61  Aligned_cols=8  Identities=25%  Similarity=0.837  Sum_probs=4.4

Q ss_pred             ccCCCCCC
Q psy3507          38 YHCKTCST   45 (134)
Q Consensus        38 ~~C~~C~~   45 (134)
                      ..|+.||.
T Consensus        27 ~~C~~cG~   34 (55)
T TIGR01031        27 VVCPNCGE   34 (55)
T ss_pred             eECCCCCC
Confidence            44555655


No 320
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=30.40  E-value=50  Score=15.18  Aligned_cols=21  Identities=19%  Similarity=0.347  Sum_probs=11.5

Q ss_pred             ceeccccCccccCchhHHHHhh
Q psy3507          82 PYKCEYCAYSCTQSSALKIHER  103 (134)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~  103 (134)
                      .+.|+.|++.... +-+..|+.
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHHH
Confidence            3667777765443 34566654


No 321
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=29.99  E-value=30  Score=21.51  Aligned_cols=23  Identities=26%  Similarity=0.603  Sum_probs=9.3

Q ss_pred             cCcccccccccCCCCccccCCCCCC
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCST   45 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~   45 (134)
                      .|..|+.-+..+.|+  ..|+.|+.
T Consensus        30 hCp~Cg~PLF~KdG~--v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPLFRKDGE--VFCPVCGY   52 (131)
T ss_pred             hCcccCCcceeeCCe--EECCCCCc
Confidence            344444433333332  33444543


No 322
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=29.88  E-value=28  Score=22.82  Aligned_cols=23  Identities=22%  Similarity=0.489  Sum_probs=13.6

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      +.|.-|++.|.   ...-.|+.||..
T Consensus       140 ~rC~GC~~~f~---~~~~~Cp~CG~~  162 (177)
T COG1439         140 LRCHGCKRIFP---EPKDFCPICGSP  162 (177)
T ss_pred             EEEecCceecC---CCCCcCCCCCCc
Confidence            66777777776   222347777654


No 323
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=29.68  E-value=36  Score=18.31  Aligned_cols=7  Identities=43%  Similarity=1.488  Sum_probs=3.2

Q ss_pred             ccCCCCC
Q psy3507          38 YHCKTCS   44 (134)
Q Consensus        38 ~~C~~C~   44 (134)
                      |.|+.||
T Consensus         1 y~C~KCg    7 (64)
T PF09855_consen    1 YKCPKCG    7 (64)
T ss_pred             CCCCCCC
Confidence            3444444


No 324
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=29.68  E-value=49  Score=17.51  Aligned_cols=9  Identities=22%  Similarity=0.722  Sum_probs=3.9

Q ss_pred             eeeCCCCCc
Q psy3507          55 YTCYACDYH   63 (134)
Q Consensus        55 ~~C~~C~~~   63 (134)
                      -.|..|+..
T Consensus        31 V~C~~Cg~~   39 (59)
T PRK00415         31 VRCLVCGKT   39 (59)
T ss_pred             EECcccCCC
Confidence            344444443


No 325
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=29.46  E-value=68  Score=23.23  Aligned_cols=25  Identities=32%  Similarity=0.642  Sum_probs=17.2

Q ss_pred             CceeccccCccccCchhHHHHhhhc
Q psy3507          81 KPYKCEYCAYSCTQSSALKIHERKH  105 (134)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~h  105 (134)
                      ..|+|+.|...|...-+...|...|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            3477887777777777777775544


No 326
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=29.36  E-value=74  Score=15.05  Aligned_cols=8  Identities=25%  Similarity=0.621  Sum_probs=3.7

Q ss_pred             CCCCCCcc
Q psy3507          40 CKTCSTVS   47 (134)
Q Consensus        40 C~~C~~~f   47 (134)
                      |.+|-..|
T Consensus         3 C~IC~~~~   10 (44)
T PF13639_consen    3 CPICLEEF   10 (44)
T ss_dssp             ETTTTCBH
T ss_pred             CcCCChhh
Confidence            44444444


No 327
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=29.19  E-value=25  Score=16.74  Aligned_cols=12  Identities=17%  Similarity=0.387  Sum_probs=9.0

Q ss_pred             ccccCCCCCCcc
Q psy3507          36 LMYHCKTCSTVS   47 (134)
Q Consensus        36 ~~~~C~~C~~~f   47 (134)
                      ..+.|+.||..+
T Consensus        31 p~~~C~~CGE~~   42 (46)
T TIGR03831        31 PALVCPQCGEEY   42 (46)
T ss_pred             CccccccCCCEe
Confidence            447799999865


No 328
>KOG1842|consensus
Probab=29.00  E-value=26  Score=26.47  Aligned_cols=24  Identities=13%  Similarity=0.300  Sum_probs=17.7

Q ss_pred             ceeeCCCCCccCChHHHHHHHHHh
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRKH   77 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~h   77 (134)
                      .|.|++|...|.+.+.|..|...-
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~e   38 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVE   38 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhh
Confidence            477888887777777777776643


No 329
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=28.87  E-value=7.8  Score=21.02  Aligned_cols=12  Identities=25%  Similarity=0.528  Sum_probs=4.5

Q ss_pred             cCCCceeccccC
Q psy3507          78 TGEKPYKCEYCA   89 (134)
Q Consensus        78 ~~~~~~~C~~C~   89 (134)
                      .|.-..+|+-|.
T Consensus        25 ~GvViv~C~gC~   36 (66)
T PF05180_consen   25 KGVVIVQCPGCK   36 (66)
T ss_dssp             TSEEEEE-TTS-
T ss_pred             CCeEEEECCCCc
Confidence            343344555554


No 330
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=28.81  E-value=45  Score=17.85  Aligned_cols=11  Identities=27%  Similarity=0.700  Sum_probs=6.8

Q ss_pred             ccCCCCCCccc
Q psy3507          38 YHCKTCSTVSH   48 (134)
Q Consensus        38 ~~C~~C~~~f~   48 (134)
                      ..|++|++...
T Consensus         7 v~CP~C~k~~~   17 (62)
T PRK00418          7 VNCPTCGKPVE   17 (62)
T ss_pred             ccCCCCCCccc
Confidence            55677776544


No 331
>KOG2071|consensus
Probab=28.76  E-value=42  Score=26.32  Aligned_cols=26  Identities=31%  Similarity=0.432  Sum_probs=20.3

Q ss_pred             cceeeCCCCCccCChHHHHHHHHHhc
Q psy3507          53 YKYTCYACDYHTLMSEDMKKHMRKHT   78 (134)
Q Consensus        53 ~~~~C~~C~~~f~~~~~l~~H~~~h~   78 (134)
                      .+..|..||..|........||..|.
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhhhhh
Confidence            35789999999998888777776654


No 332
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=28.74  E-value=21  Score=18.31  Aligned_cols=12  Identities=17%  Similarity=0.653  Sum_probs=7.2

Q ss_pred             CCccccCCCCCC
Q psy3507          34 EELMYHCKTCST   45 (134)
Q Consensus        34 ~~~~~~C~~C~~   45 (134)
                      ++....|+.||+
T Consensus        43 ~~~i~~Cp~CgR   54 (56)
T PF02591_consen   43 GDEIVFCPNCGR   54 (56)
T ss_pred             CCCeEECcCCCc
Confidence            345566676665


No 333
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=28.29  E-value=26  Score=17.98  Aligned_cols=16  Identities=19%  Similarity=0.571  Sum_probs=8.8

Q ss_pred             CCCccccCCCCCCccc
Q psy3507          33 AEELMYHCKTCSTVSH   48 (134)
Q Consensus        33 ~~~~~~~C~~C~~~f~   48 (134)
                      .+...|.|.+|++.+.
T Consensus        31 ~~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   31 KEPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTTCEEEETTT--EEE
T ss_pred             CCCCEEEeeCCCCEec
Confidence            3455677888877653


No 334
>PRK06260 threonine synthase; Validated
Probab=28.28  E-value=40  Score=24.92  Aligned_cols=25  Identities=28%  Similarity=0.668  Sum_probs=13.8

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      ++|..||+.|... ...+.|+.|+..
T Consensus         4 ~~C~~cg~~~~~~-~~~~~Cp~cg~~   28 (397)
T PRK06260          4 LKCIECGKEYDPD-EIIYTCPECGGL   28 (397)
T ss_pred             EEECCCCCCCCCC-CccccCCCCCCe
Confidence            5566666666432 224566666543


No 335
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=28.24  E-value=52  Score=17.15  Aligned_cols=10  Identities=30%  Similarity=0.906  Sum_probs=2.4

Q ss_pred             cccCCCCCCc
Q psy3507          37 MYHCKTCSTV   46 (134)
Q Consensus        37 ~~~C~~C~~~   46 (134)
                      .|.|++||.+
T Consensus        33 ~y~Cp~CgAt   42 (55)
T PF05741_consen   33 KYVCPICGAT   42 (55)
T ss_dssp             G---TTT---
T ss_pred             cCcCCCCcCc
Confidence            3666666654


No 336
>KOG0402|consensus
Probab=28.19  E-value=21  Score=20.32  Aligned_cols=29  Identities=17%  Similarity=0.400  Sum_probs=19.0

Q ss_pred             ccCCCCCCccc-CCCCcceeeCCCCCccCC
Q psy3507          38 YHCKTCSTVSH-PNISYKYTCYACDYHTLM   66 (134)
Q Consensus        38 ~~C~~C~~~f~-~~~~~~~~C~~C~~~f~~   66 (134)
                      |.|+.||+.-- ....-.+.|..|.+.+..
T Consensus        37 y~CsfCGK~~vKR~AvGiW~C~~C~kv~ag   66 (92)
T KOG0402|consen   37 YTCSFCGKKTVKRKAVGIWKCGSCKKVVAG   66 (92)
T ss_pred             hhhhhcchhhhhhhceeEEecCCccceecc
Confidence            88888887543 333345778888777643


No 337
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=27.97  E-value=39  Score=25.15  Aligned_cols=22  Identities=23%  Similarity=0.434  Sum_probs=10.3

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      +.|..||+.|.  ....+.|+.|+
T Consensus         3 l~C~~Cg~~~~--~~~~~~C~~c~   24 (398)
T TIGR03844         3 LRCPGCGEVLP--DHYTLSCPLDC   24 (398)
T ss_pred             EEeCCCCCccC--CccccCCCCCC
Confidence            34555555553  22235555444


No 338
>PF07227 DUF1423:  Protein of unknown function (DUF1423);  InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []. Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.
Probab=27.77  E-value=34  Score=25.85  Aligned_cols=53  Identities=17%  Similarity=0.366  Sum_probs=32.0

Q ss_pred             ccCCCCCCccc--CCCCcceeeCCCCCccCChHHHHHHHHH----h-----cCCCceeccccCcc
Q psy3507          38 YHCKTCSTVSH--PNISYKYTCYACDYHTLMSEDMKKHMRK----H-----TGEKPYKCEYCAYS   91 (134)
Q Consensus        38 ~~C~~C~~~f~--~~~~~~~~C~~C~~~f~~~~~l~~H~~~----h-----~~~~~~~C~~C~~~   91 (134)
                      -.|-+|.+ |.  ..+-.+..|+.|+.+.-..-.|...+..    -     ..+..|.|.-||+.
T Consensus       129 C~C~iC~k-fD~~~n~~~Wi~Cd~CgH~cH~dCALr~~~i~~G~s~~g~~g~~d~~f~C~~C~~~  192 (446)
T PF07227_consen  129 CMCCICSK-FDDNKNTCSWIGCDVCGHWCHLDCALRHELIGTGPSVKGSIGTLDMQFHCRACGKT  192 (446)
T ss_pred             CCccccCC-cccCCCCeeEEeccCCCceehhhhhcccccccCCccCCCCCccCceEEEccCCCCh
Confidence            45677766 54  4444567788888877666666655321    0     11345888888763


No 339
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=27.69  E-value=30  Score=17.75  Aligned_cols=10  Identities=20%  Similarity=0.627  Sum_probs=6.9

Q ss_pred             cCCCCCCccc
Q psy3507          39 HCKTCSTVSH   48 (134)
Q Consensus        39 ~C~~C~~~f~   48 (134)
                      .|++||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5777777665


No 340
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=27.21  E-value=42  Score=21.06  Aligned_cols=21  Identities=19%  Similarity=0.295  Sum_probs=10.7

Q ss_pred             CcccccccccccCCccceecCccc
Q psy3507           2 HNYLVCTASIGLKNPFTLATCIHC   25 (134)
Q Consensus         2 h~~~~~~~~~~~~~~~~~~~C~~C   25 (134)
                      .|+..|++-|...   ....|+.|
T Consensus         4 ~nC~~CgklF~~~---~~~iCp~C   24 (137)
T TIGR03826         4 ANCPKCGRLFVKT---GRDVCPSC   24 (137)
T ss_pred             ccccccchhhhhc---CCccCHHH
Confidence            4555666655542   12346666


No 341
>KOG3362|consensus
Probab=27.10  E-value=20  Score=22.65  Aligned_cols=20  Identities=30%  Similarity=0.607  Sum_probs=11.3

Q ss_pred             ceeeCCCCCccCChHHHHHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKH   73 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H   73 (134)
                      +|.|..||..+-+..-+..|
T Consensus       129 ~ysC~~CG~kyCsv~C~~~H  148 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTH  148 (156)
T ss_pred             hhHHHhcCCceeechhhhhc
Confidence            45566666655555555544


No 342
>KOG4727|consensus
Probab=27.08  E-value=57  Score=21.36  Aligned_cols=27  Identities=22%  Similarity=0.333  Sum_probs=21.5

Q ss_pred             CCCCcceeeCCCCCccCChHHHHHHHH
Q psy3507          49 PNISYKYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        49 ~~~~~~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      ......|-|++|+-++....++..|+.
T Consensus        70 ~sq~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   70 RSQKGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ccccCceeeeecceeehhhHHHHHHhc
Confidence            344456899999999999999888875


No 343
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=26.92  E-value=51  Score=25.06  Aligned_cols=23  Identities=17%  Similarity=0.460  Sum_probs=20.7

Q ss_pred             CCeecCcChhhhcCHHHHHHHHH
Q psy3507         109 KPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       109 ~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      ..|.|+.|-+-|.+...|.+|+.
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHh
Confidence            45899999999999999999985


No 344
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=26.74  E-value=77  Score=15.27  Aligned_cols=21  Identities=33%  Similarity=1.039  Sum_probs=9.4

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCC
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      +.|..|+..+   ....|.|..|.
T Consensus         5 ~~C~~C~~~i---~g~ry~C~~C~   25 (44)
T smart00291        5 YSCDTCGKPI---VGVRYHCLVCP   25 (44)
T ss_pred             cCCCCCCCCC---cCCEEECCCCC
Confidence            4455555521   12345555553


No 345
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=26.74  E-value=67  Score=16.58  Aligned_cols=15  Identities=27%  Similarity=0.605  Sum_probs=7.4

Q ss_pred             ceecCcccccccccC
Q psy3507          18 TLATCIHCRLLLVPT   32 (134)
Q Consensus        18 ~~~~C~~C~~h~~~h   32 (134)
                      ....|..|+.....|
T Consensus        25 ~l~~c~~cg~~~~~H   39 (56)
T PF01783_consen   25 NLVKCPNCGEPKLPH   39 (56)
T ss_dssp             SEEESSSSSSEESTT
T ss_pred             ceeeeccCCCEeccc
Confidence            445555555444444


No 346
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=26.73  E-value=19  Score=21.04  Aligned_cols=33  Identities=12%  Similarity=0.061  Sum_probs=15.2

Q ss_pred             ccccCCCCCCcccCCCCc-ceeeCCCCCccCChH
Q psy3507          36 LMYHCKTCSTVSHPNISY-KYTCYACDYHTLMSE   68 (134)
Q Consensus        36 ~~~~C~~C~~~f~~~~~~-~~~C~~C~~~f~~~~   68 (134)
                      ++..|..|.+......-. .-.|+.|...|...-
T Consensus        61 ~~iiCGvC~~~LT~~EY~~~~~Cp~C~spFNp~C   94 (105)
T COG4357          61 KAIICGVCRKLLTRAEYGMCGSCPYCQSPFNPGC   94 (105)
T ss_pred             ccEEhhhhhhhhhHHHHhhcCCCCCcCCCCCccc
Confidence            334455555544311100 123777776666543


No 347
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=26.73  E-value=31  Score=15.61  Aligned_cols=13  Identities=23%  Similarity=0.922  Sum_probs=9.8

Q ss_pred             ccccCCCCCCccc
Q psy3507          36 LMYHCKTCSTVSH   48 (134)
Q Consensus        36 ~~~~C~~C~~~f~   48 (134)
                      +-|+|+.||....
T Consensus         6 ~~ykC~~Cgniv~   18 (34)
T TIGR00319         6 QVYKCEVCGNIVE   18 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            4588888887765


No 348
>PLN03239 histone acetyltransferase; Provisional
Probab=26.67  E-value=57  Score=23.95  Aligned_cols=24  Identities=17%  Similarity=0.185  Sum_probs=20.4

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHH
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +.-|.|+.|-+-|.+...|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            346999999999999999999874


No 349
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=26.51  E-value=32  Score=15.59  Aligned_cols=13  Identities=23%  Similarity=0.876  Sum_probs=9.3

Q ss_pred             ccccCCCCCCccc
Q psy3507          36 LMYHCKTCSTVSH   48 (134)
Q Consensus        36 ~~~~C~~C~~~f~   48 (134)
                      +-|+|+.||....
T Consensus         3 ~~ykC~~CGniv~   15 (34)
T cd00974           3 EVYKCEICGNIVE   15 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            3578888887664


No 350
>COG4640 Predicted membrane protein [Function unknown]
Probab=26.46  E-value=61  Score=24.29  Aligned_cols=16  Identities=13%  Similarity=0.316  Sum_probs=9.5

Q ss_pred             eeCCCCCccCChHHHH
Q psy3507          56 TCYACDYHTLMSEDMK   71 (134)
Q Consensus        56 ~C~~C~~~f~~~~~l~   71 (134)
                      .|+.||..|.....+.
T Consensus        17 qC~qCG~~~t~~~sqa   32 (465)
T COG4640          17 QCTQCGHKFTSRQSQA   32 (465)
T ss_pred             cccccCCcCCchhhhh
Confidence            3666666666655443


No 351
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=26.25  E-value=24  Score=25.02  Aligned_cols=30  Identities=27%  Similarity=0.473  Sum_probs=15.4

Q ss_pred             ccCCCCCCcccCC--CCcceeeCCCCCccCCh
Q psy3507          38 YHCKTCSTVSHPN--ISYKYTCYACDYHTLMS   67 (134)
Q Consensus        38 ~~C~~C~~~f~~~--~~~~~~C~~C~~~f~~~   67 (134)
                      .+|+.|+......  ....+.|+.|+..|...
T Consensus        27 ~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTKELERNLEVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHHHHHhhCCCCCCCCCcCcCC
Confidence            4566666654421  11235666666665543


No 352
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=26.23  E-value=52  Score=16.12  Aligned_cols=23  Identities=35%  Similarity=0.868  Sum_probs=11.2

Q ss_pred             cccCCCCCCcccCCCCcceeeCCCC
Q psy3507          37 MYHCKTCSTVSHPNISYKYTCYACD   61 (134)
Q Consensus        37 ~~~C~~C~~~f~~~~~~~~~C~~C~   61 (134)
                      .+.|+.|+...  .....|.|..|.
T Consensus         4 ~~~C~~C~~~~--i~g~Ry~C~~C~   26 (46)
T PF00569_consen    4 GYTCDGCGTDP--IIGVRYHCLVCP   26 (46)
T ss_dssp             SCE-SSS-SSS--EESSEEEESSSS
T ss_pred             CeECcCCCCCc--CcCCeEECCCCC
Confidence            36677776631  122456777664


No 353
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.17  E-value=92  Score=17.57  Aligned_cols=38  Identities=16%  Similarity=0.192  Sum_probs=25.1

Q ss_pred             cCCCCCCccc---CCCCcceeeCCCCCccCChHHHHHHHHH
Q psy3507          39 HCKTCSTVSH---PNISYKYTCYACDYHTLMSEDMKKHMRK   76 (134)
Q Consensus        39 ~C~~C~~~f~---~~~~~~~~C~~C~~~f~~~~~l~~H~~~   76 (134)
                      .|+.|+....   ..+...=.|+.|+-.+.....|..-+..
T Consensus         3 lCP~C~v~l~~~~rs~vEiD~CPrCrGVWLDrGELdKli~r   43 (88)
T COG3809           3 LCPICGVELVMSVRSGVEIDYCPRCRGVWLDRGELDKLIER   43 (88)
T ss_pred             ccCcCCceeeeeeecCceeeeCCccccEeecchhHHHHHHH
Confidence            4777776554   2333334588888888888888776553


No 354
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=26.14  E-value=75  Score=15.38  Aligned_cols=7  Identities=43%  Similarity=1.602  Sum_probs=3.2

Q ss_pred             ceeeCCC
Q psy3507          54 KYTCYAC   60 (134)
Q Consensus        54 ~~~C~~C   60 (134)
                      .|+|..|
T Consensus        14 ry~C~~C   20 (43)
T cd02340          14 RYKCLVC   20 (43)
T ss_pred             eEECCCC
Confidence            3444444


No 355
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=25.82  E-value=71  Score=21.38  Aligned_cols=11  Identities=27%  Similarity=0.591  Sum_probs=7.4

Q ss_pred             ceeccccCccc
Q psy3507          82 PYKCEYCAYSC   92 (134)
Q Consensus        82 ~~~C~~C~~~f   92 (134)
                      ...|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            46777777665


No 356
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=25.66  E-value=33  Score=22.46  Aligned_cols=28  Identities=29%  Similarity=0.635  Sum_probs=7.6

Q ss_pred             cceecCcccccccccCCCC--ccccCCCCC
Q psy3507          17 FTLATCIHCRLLLVPTAEE--LMYHCKTCS   44 (134)
Q Consensus        17 ~~~~~C~~C~~h~~~h~~~--~~~~C~~C~   44 (134)
                      .....|..|+-+..++..+  ..|.|+.|.
T Consensus       132 l~l~~C~~C~~~fv~~~~~~~~~~~Cp~C~  161 (175)
T PF05280_consen  132 LQLAPCRRCGGHFVTHAHDPRHSFVCPFCQ  161 (175)
T ss_dssp             EEEEE-TTT--EEEEESS--SS----TT--
T ss_pred             ccccCCCCCCCCeECcCCCCCcCcCCCCCC
Confidence            3344555554444443222  234444444


No 357
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=25.52  E-value=48  Score=21.71  Aligned_cols=19  Identities=16%  Similarity=0.389  Sum_probs=13.1

Q ss_pred             CCeecCcChhhhcCHHHHH
Q psy3507         109 KPYICQQCRDTFSSLYLFR  127 (134)
Q Consensus       109 ~~~~C~~C~~~F~~~~~l~  127 (134)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4677888888887655443


No 358
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=25.51  E-value=25  Score=25.09  Aligned_cols=30  Identities=30%  Similarity=0.603  Sum_probs=13.6

Q ss_pred             ccCCCCCCcccCC--CCcceeeCCCCCccCCh
Q psy3507          38 YHCKTCSTVSHPN--ISYKYTCYACDYHTLMS   67 (134)
Q Consensus        38 ~~C~~C~~~f~~~--~~~~~~C~~C~~~f~~~   67 (134)
                      .+|+.|+......  .+..+.|+.|+..|...
T Consensus        39 ~kc~~C~~~~~~~~l~~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         39 VQCENCYGLNYKKFLKSKMNICEQCGYHLKMS   70 (296)
T ss_pred             eECCCccchhhHHHHHHcCCCCCCCCCCcCCC
Confidence            4455555544311  11234555555555443


No 359
>PTZ00448 hypothetical protein; Provisional
Probab=25.32  E-value=56  Score=24.13  Aligned_cols=23  Identities=22%  Similarity=0.531  Sum_probs=20.1

Q ss_pred             ceeeCCCCCccCChHHHHHHHHH
Q psy3507          54 KYTCYACDYHTLMSEDMKKHMRK   76 (134)
Q Consensus        54 ~~~C~~C~~~f~~~~~l~~H~~~   76 (134)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            47899999999988899999874


No 360
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=25.11  E-value=67  Score=18.05  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=5.0

Q ss_pred             ccCCCCCCc
Q psy3507          38 YHCKTCSTV   46 (134)
Q Consensus        38 ~~C~~C~~~   46 (134)
                      |.|+-||..
T Consensus         2 ~~CPCCg~~   10 (78)
T PF14206_consen    2 YPCPCCGYY   10 (78)
T ss_pred             ccCCCCCcE
Confidence            456666643


No 361
>PTZ00064 histone acetyltransferase; Provisional
Probab=25.06  E-value=63  Score=25.04  Aligned_cols=24  Identities=25%  Similarity=0.351  Sum_probs=21.0

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHH
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      ..-|.|+.|-+-|.+...|.+|+.
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~  301 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLS  301 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHh
Confidence            345899999999999999999985


No 362
>KOG0782|consensus
Probab=24.86  E-value=14  Score=29.01  Aligned_cols=51  Identities=18%  Similarity=0.386  Sum_probs=32.7

Q ss_pred             HHHHHHHHHhcCCCceeccccCccccCchhHHHHhhhcCCC-CCeecCcChhhhcCHH
Q psy3507          68 EDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGD-KPYICQQCRDTFSSLY  124 (134)
Q Consensus        68 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~~C~~C~~~F~~~~  124 (134)
                      +.+.+|--+|.....-+|..|++.|.++..+      |..+ ....|..|...|-.+-
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            3666666666555556799999888765433      2222 2367888888776543


No 363
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=24.76  E-value=24  Score=23.54  Aligned_cols=21  Identities=38%  Similarity=0.698  Sum_probs=0.0

Q ss_pred             CceeccccCc-cccCchhHHHH
Q psy3507          81 KPYKCEYCAY-SCTQSSALKIH  101 (134)
Q Consensus        81 ~~~~C~~C~~-~f~~~~~l~~H  101 (134)
                      +.|.|.+||. +|.-+..+..|
T Consensus       100 ~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen  100 VEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ----------------------
T ss_pred             CeeeeEeCCCcceecHHHHHHh
Confidence            4466666663 44455555555


No 364
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=24.55  E-value=52  Score=23.34  Aligned_cols=28  Identities=18%  Similarity=0.371  Sum_probs=20.2

Q ss_pred             cCcccccccccCCCCccccCCCCCCccc
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSH   48 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~   48 (134)
                      .|+.|+.-+..-.++....|+.||..+-
T Consensus       113 FCg~CG~~~~~~~~g~~~~C~~cg~~~f  140 (279)
T COG2816         113 FCGRCGTKTYPREGGWARVCPKCGHEHF  140 (279)
T ss_pred             CCCCCCCcCccccCceeeeCCCCCCccC
Confidence            5778877776666677777888886654


No 365
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=24.07  E-value=1.1e+02  Score=15.46  Aligned_cols=45  Identities=9%  Similarity=0.004  Sum_probs=23.9

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCcccc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCT   93 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   93 (134)
                      +.|++|+..+...     ....||..|.. ..+...++.     ...|+.|+..+.
T Consensus         2 ~~Cpi~~~~~~~P-----v~~~~G~v~~~-~~i~~~~~~-----~~~cP~~~~~~~   46 (63)
T smart00504        2 FLCPISLEVMKDP-----VILPSGQTYER-RAIEKWLLS-----HGTDPVTGQPLT   46 (63)
T ss_pred             cCCcCCCCcCCCC-----EECCCCCEEeH-HHHHHHHHH-----CCCCCCCcCCCC
Confidence            4577777765432     22345655533 444444443     136777776653


No 366
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.82  E-value=58  Score=17.38  Aligned_cols=39  Identities=18%  Similarity=0.429  Sum_probs=18.6

Q ss_pred             eeCCCCCc-cCChHHHHHHHHHhcCCCceeccccCccccC
Q psy3507          56 TCYACDYH-TLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQ   94 (134)
Q Consensus        56 ~C~~C~~~-f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   94 (134)
                      +|-+|++. +.....+..-......-..|-|++|......
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva~   43 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVAI   43 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhch
Confidence            46666643 3333333333223333344777777654433


No 367
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=23.59  E-value=55  Score=17.77  Aligned_cols=8  Identities=38%  Similarity=0.941  Sum_probs=3.4

Q ss_pred             eeCCCCCc
Q psy3507          56 TCYACDYH   63 (134)
Q Consensus        56 ~C~~C~~~   63 (134)
                      .|..||..
T Consensus        40 ~C~~CG~~   47 (67)
T COG2051          40 TCLICGTT   47 (67)
T ss_pred             EecccccE
Confidence            34444433


No 368
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.24  E-value=86  Score=16.74  Aligned_cols=20  Identities=10%  Similarity=0.004  Sum_probs=10.0

Q ss_pred             ccccCCCCccccCCCCCCcc
Q psy3507          28 LLVPTAEELMYHCKTCSTVS   47 (134)
Q Consensus        28 h~~~h~~~~~~~C~~C~~~f   47 (134)
                      +..++.+.+++.|+-=+-.|
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~   34 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPN   34 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCC
Confidence            34445555666665444333


No 369
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=23.22  E-value=77  Score=18.64  Aligned_cols=34  Identities=12%  Similarity=0.189  Sum_probs=12.2

Q ss_pred             CCccccCCCCCCccc------CCCCcceeeCCCCCccCCh
Q psy3507          34 EELMYHCKTCSTVSH------PNISYKYTCYACDYHTLMS   67 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~------~~~~~~~~C~~C~~~f~~~   67 (134)
                      +.+.-.|..||....      .....-|-|+.|-+.|...
T Consensus        11 g~ke~~CalCG~tWg~~y~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDYYEEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             -SGGGS-SS---S---SS-B-TT--BSSS--SSSS-TTS-
T ss_pred             ccccccccccCCcHHHHHHhhcCCEEEEEcHHHHHHHHHH
Confidence            345566777776654      2222345677777766654


No 370
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=22.79  E-value=59  Score=20.34  Aligned_cols=23  Identities=30%  Similarity=0.699  Sum_probs=13.4

Q ss_pred             ccCCCCCCcccCCCCcceeeCCCCCc
Q psy3507          38 YHCKTCSTVSHPNISYKYTCYACDYH   63 (134)
Q Consensus        38 ~~C~~C~~~f~~~~~~~~~C~~C~~~   63 (134)
                      -+|..||..|-....   .|+.|+..
T Consensus        30 ~kC~~CG~v~~PPr~---~Cp~C~~~   52 (140)
T COG1545          30 TKCKKCGRVYFPPRA---YCPKCGSE   52 (140)
T ss_pred             EEcCCCCeEEcCCcc---cCCCCCCC
Confidence            457777777654332   36666544


No 371
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=22.70  E-value=29  Score=24.70  Aligned_cols=30  Identities=23%  Similarity=0.454  Sum_probs=14.4

Q ss_pred             ccCCCCCCcccCC--CCcceeeCCCCCccCCh
Q psy3507          38 YHCKTCSTVSHPN--ISYKYTCYACDYHTLMS   67 (134)
Q Consensus        38 ~~C~~C~~~f~~~--~~~~~~C~~C~~~f~~~   67 (134)
                      .+|+.|+......  ....+.|+.|+..|.-.
T Consensus        28 ~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~   59 (292)
T PRK05654         28 TKCPSCGQVLYRKELEANLNVCPKCGHHMRIS   59 (292)
T ss_pred             eECCCccchhhHHHHHhcCCCCCCCCCCeeCC
Confidence            4566666554411  11124566666655443


No 372
>KOG2747|consensus
Probab=22.40  E-value=59  Score=24.28  Aligned_cols=25  Identities=32%  Similarity=0.582  Sum_probs=21.3

Q ss_pred             CCCeecCcChhhhcCHHHHHHHHHh
Q psy3507         108 DKPYICQQCRDTFSSLYLFRNRLQS  132 (134)
Q Consensus       108 ~~~~~C~~C~~~F~~~~~l~~H~~~  132 (134)
                      ...|.|+.|-+.+.++..|.+|+..
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~k  180 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKK  180 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHh
Confidence            3458999999999999999999864


No 373
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=22.30  E-value=74  Score=16.21  Aligned_cols=8  Identities=25%  Similarity=0.804  Sum_probs=3.1

Q ss_pred             ccCCCCCC
Q psy3507          38 YHCKTCST   45 (134)
Q Consensus        38 ~~C~~C~~   45 (134)
                      ..|+.|+.
T Consensus        41 v~C~~C~~   48 (64)
T smart00647       41 VTCPKCGF   48 (64)
T ss_pred             eECCCCCC
Confidence            33433433


No 374
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=22.30  E-value=38  Score=15.11  Aligned_cols=11  Identities=27%  Similarity=0.818  Sum_probs=5.1

Q ss_pred             ccccCCCCCCc
Q psy3507          36 LMYHCKTCSTV   46 (134)
Q Consensus        36 ~~~~C~~C~~~   46 (134)
                      -.|.|+.|+..
T Consensus        12 ~kY~Cp~C~~~   22 (30)
T PF04438_consen   12 AKYRCPRCGAR   22 (30)
T ss_dssp             ESEE-TTT--E
T ss_pred             CEEECCCcCCc
Confidence            34777777764


No 375
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=21.46  E-value=90  Score=16.34  Aligned_cols=23  Identities=17%  Similarity=0.251  Sum_probs=16.0

Q ss_pred             eecCcChhhhcCHHHHHHHHHhc
Q psy3507         111 YICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus       111 ~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |--.-||+.|.+..++.+.+..+
T Consensus        28 ~Y~sP~Gk~~Rs~~ev~~yL~~~   50 (62)
T cd00122          28 YYYSPCGKKLRSKPEVARYLEKT   50 (62)
T ss_pred             EEECCCCceecCHHHHHHHHHhC
Confidence            33455788888888888777643


No 376
>PRK08359 transcription factor; Validated
Probab=21.17  E-value=32  Score=22.56  Aligned_cols=27  Identities=15%  Similarity=0.253  Sum_probs=13.4

Q ss_pred             ccCCCCCCccc-------CCCCcceeeCCCCCcc
Q psy3507          38 YHCKTCSTVSH-------PNISYKYTCYACDYHT   64 (134)
Q Consensus        38 ~~C~~C~~~f~-------~~~~~~~~C~~C~~~f   64 (134)
                      -.|++||....       -.+.....|..|...|
T Consensus         7 ~~CEiCG~~i~g~~~~v~ieGael~VC~~Ca~k~   40 (176)
T PRK08359          7 RYCEICGAEIRGPGHRIRIEGAELLVCDRCYEKY   40 (176)
T ss_pred             ceeecCCCccCCCCeEEEEcCeEEehHHHHHHHh
Confidence            34666665544       2233345566665333


No 377
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.04  E-value=60  Score=22.85  Aligned_cols=24  Identities=17%  Similarity=0.488  Sum_probs=13.8

Q ss_pred             cCCCCCCcccCCCCcceeeCCCCCccCC
Q psy3507          39 HCKTCSTVSHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        39 ~C~~C~~~f~~~~~~~~~C~~C~~~f~~   66 (134)
                      .|+.||.    .....+.|+.||..+..
T Consensus       311 ~C~~cg~----~~~r~~~C~~cg~~~~r  334 (364)
T COG0675         311 TCPCCGH----LSGRLFKCPRCGFVHDR  334 (364)
T ss_pred             cccccCC----ccceeEECCCCCCeehh
Confidence            4666666    22345677777765443


No 378
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=20.85  E-value=74  Score=22.29  Aligned_cols=26  Identities=19%  Similarity=0.281  Sum_probs=14.4

Q ss_pred             cCCCCCCccc---CCCCcceeeCCCCCcc
Q psy3507          39 HCKTCSTVSH---PNISYKYTCYACDYHT   64 (134)
Q Consensus        39 ~C~~C~~~f~---~~~~~~~~C~~C~~~f   64 (134)
                      .|+.||....   ..+...|-|+.|...+
T Consensus       237 pC~~Cg~~I~~~~~~gR~ty~Cp~CQ~~~  265 (269)
T PRK14811        237 PCPRCGTPIEKIVVGGRGTHFCPQCQPLR  265 (269)
T ss_pred             CCCcCCCeeEEEEECCCCcEECCCCcCCC
Confidence            4666665444   3344456666665543


No 379
>KOG4124|consensus
Probab=20.77  E-value=14  Score=26.93  Aligned_cols=47  Identities=34%  Similarity=0.793  Sum_probs=31.6

Q ss_pred             Cceeccc--cCccccCchhHHHHhhh-c------------------CCCCCeecCcChhhhcCHHHHH
Q psy3507          81 KPYKCEY--CAYSCTQSSALKIHERK-H------------------TGDKPYICQQCRDTFSSLYLFR  127 (134)
Q Consensus        81 ~~~~C~~--C~~~f~~~~~l~~H~~~-h------------------~~~~~~~C~~C~~~F~~~~~l~  127 (134)
                      +++.|++  |++.+.....|..|... |                  ...|+|.|++|.+.++....|.
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~  415 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLK  415 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCC
Confidence            5567755  77777777777776442 2                  1247899999998877654443


No 380
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=20.72  E-value=57  Score=16.38  Aligned_cols=8  Identities=38%  Similarity=1.111  Sum_probs=3.5

Q ss_pred             eeccccCc
Q psy3507          83 YKCEYCAY   90 (134)
Q Consensus        83 ~~C~~C~~   90 (134)
                      |.|++|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            88888875


No 381
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=20.59  E-value=97  Score=18.52  Aligned_cols=62  Identities=16%  Similarity=0.230  Sum_probs=29.3

Q ss_pred             CCccccCCCCCCccc-CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCchhHHHH
Q psy3507          34 EELMYHCKTCSTVSH-PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIH  101 (134)
Q Consensus        34 ~~~~~~C~~C~~~f~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  101 (134)
                      |...|.|+.||.... ...=+.--|+.|+......- +. .++.    ....++.=--+|+-+..|..-
T Consensus        39 G~~~~~C~~Cg~~~~~~~SCk~R~CP~C~~~~~~~W-~~-~~~~----~ll~~~y~HvVFTlP~~L~~~  101 (111)
T PF14319_consen   39 GFHRYRCEDCGHEKIVYNSCKNRHCPSCQAKATEQW-IE-KQRE----DLLPVPYFHVVFTLPHELRPL  101 (111)
T ss_pred             CcceeecCCCCceEEecCcccCcCCCCCCChHHHHH-HH-HHHh----hCCCCCeEEEEEcCcHHHHHH
Confidence            445578888886544 11112235788876432221 11 1111    112333333456666666543


No 382
>KOG1729|consensus
Probab=20.24  E-value=12  Score=26.55  Aligned_cols=28  Identities=14%  Similarity=0.279  Sum_probs=13.1

Q ss_pred             ccCCCCCC-cccCCCCcceeeCCCCCccCC
Q psy3507          38 YHCKTCST-VSHPNISYKYTCYACDYHTLM   66 (134)
Q Consensus        38 ~~C~~C~~-~f~~~~~~~~~C~~C~~~f~~   66 (134)
                      -.|..|++ .|.- ..+..-|..||..|-.
T Consensus       169 ~~C~~C~~~~Ftl-~~RRHHCR~CG~ivC~  197 (288)
T KOG1729|consen  169 TECMVCGCTEFTL-SERRHHCRNCGDIVCA  197 (288)
T ss_pred             eecccCCCccccH-HHHHHHHHhcchHhhh
Confidence            45666666 3332 2222335555555544


No 383
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=20.09  E-value=1.1e+02  Score=21.89  Aligned_cols=25  Identities=16%  Similarity=0.300  Sum_probs=22.4

Q ss_pred             CCcceeeCCCCCccCChHHHHHHHH
Q psy3507          51 ISYKYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        51 ~~~~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      ....|.|+.|-+-|.+...|.+|+.
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHH
Confidence            3457999999999999999999987


No 384
>KOG0320|consensus
Probab=20.05  E-value=22  Score=23.34  Aligned_cols=51  Identities=20%  Similarity=0.369  Sum_probs=28.1

Q ss_pred             CccccCCCCCCcccCCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccC
Q psy3507          35 ELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQ   94 (134)
Q Consensus        35 ~~~~~C~~C~~~f~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~   94 (134)
                      +.-|.|++|--.+....   -.-..||..|-..- ++.-++     ....|+.|++....
T Consensus       129 ~~~~~CPiCl~~~sek~---~vsTkCGHvFC~~C-ik~alk-----~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKV---PVSTKCGHVFCSQC-IKDALK-----NTNKCPTCRKKITH  179 (187)
T ss_pred             ccccCCCceecchhhcc---ccccccchhHHHHH-HHHHHH-----hCCCCCCcccccch
Confidence            34488888887764222   13446777775432 222222     22478998875443


No 385
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=20.02  E-value=69  Score=22.28  Aligned_cols=28  Identities=21%  Similarity=0.407  Sum_probs=17.0

Q ss_pred             cCcccccccccCCCCccccCCCCCCccc
Q psy3507          21 TCIHCRLLLVPTAEELMYHCKTCSTVSH   48 (134)
Q Consensus        21 ~C~~C~~h~~~h~~~~~~~C~~C~~~f~   48 (134)
                      .|+.|+.-+....+.....|+.|+...-
T Consensus       101 fC~~CG~~~~~~~~~~~~~C~~c~~~~y  128 (256)
T PRK00241        101 FCGYCGHPMHPSKTEWAMLCPHCRERYY  128 (256)
T ss_pred             cccccCCCCeecCCceeEECCCCCCEEC
Confidence            5777766555555555566777775543


Done!