RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3510
         (64 letters)



>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group is a member of the medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, but lacks the zinc-binding
          sites of the zinc-dependent alcohol dehydrogenases. The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 326

 Score = 82.2 bits (204), Expect = 8e-21
 Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKP-ILGK 59
           A+G+NP++T IR G     P LPAILG +V+G+VE VG+GV  F+VGD+V+G    LG 
Sbjct: 35 HASGVNPLDTKIRRGGAAARPPLPAILGCDVAGVVEAVGEGVTRFRVGDEVYGCAGGLGG 94

Query: 60 GG 61
            
Sbjct: 95 LQ 96


>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent
          oxidoreductases [Energy production and conversion /
          General function prediction only].
          Length = 326

 Score = 76.2 bits (188), Expect = 1e-18
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGK-G 60
          AAG+NP++  +R G  P +  LP I G+E +G+V  VG GV  FKVGD+V     +G+ G
Sbjct: 36 AAGVNPIDVLVRQGLAPPVRPLPFIPGSEAAGVVVAVGSGVTGFKVGDRVAALGGVGRDG 95

Query: 61 GYSQ 64
          GY++
Sbjct: 96 GYAE 99


>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone
          reductase-like medium chain degydrogenases/reductases. 
          Members identified as zinc-dependent alcohol
          dehydrogenases and quinone oxidoreductase. QOR
          catalyzes the conversion of a quinone + NAD(P)H to a
          hydroquinone + NAD(P)+. Quinones are cyclic diones
          derived from aromatic compounds.  Membrane bound QOR
          actin the respiratory chains of bacteria and
          mitochondria, while soluble QOR acts to protect from
          toxic quinones (e.g. DT-diaphorase) or as a soluble
          eye-lens protein in some vertebrates (e.g.
          zeta-crystalin). QOR reduces quinones through a
          semi-quinone intermediate via a NAD(P)H-dependent
          single electron transfer. QOR is a member of the medium
          chain dehydrogenase/reductase family, but lacks the
          zinc-binding sites of the prototypical alcohol
          dehydrogenases of this group. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones. 
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation.  ADH
          is a member of the medium chain alcohol dehydrogenase
          family (MDR), which has a NAD(P)(H)-binding domain in a
          Rossmann fold of a beta-alpha form. The NAD(H)-binding
          region is comprised of 2 structurally similar halves,
          each of which contacts a mononucleotide.  A GxGxxG
          motif after the first mononucleotide contact half
          allows the close contact of the coenzyme with the ADH
          backbone.  The N-terminal catalytic domain has a
          distant homology to GroES. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit, a catalytic zinc at the active
          site and a structural zinc in a lobe of the catalytic
          domain.  NAD(H) binding occurs in the cleft between the
          catalytic and coenzyme-binding domains at the active
          site, and coenzyme binding induces a conformational
          closing of this cleft. Coenzyme binding typically
          precedes and contributes to substrate binding. In human
          ADH catalysis, the zinc ion helps coordinate the
          alcohol, followed by deprotonation of  a histidine, the
          ribose of NAD, a serine, then the alcohol, which allows
          the transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 309

 Score = 75.3 bits (186), Expect = 2e-18
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 2  AAGINPVETYIRSGQYPNLP--DLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGK 59
          AAG+NPV+  IR G         LP I G +V+G+V  VG GV  FKVGD+VFG     +
Sbjct: 36 AAGVNPVDLKIREGLLKAAFPLTLPLIPGHDVAGVVVAVGPGVTGFKVGDEVFGMTPFTR 95

Query: 60 GG 61
          GG
Sbjct: 96 GG 97


>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent
          quinone reductase activity (QOR).  Zeta-crystallin is a
          eye lens protein with NADP-dependent quinone reductase
          activity (QOR). It has been cited as a structural
          component in mammalian eyes, but also has homology to
          quinone reductases in unrelated species. QOR catalyzes
          the conversion of a quinone and NAD(P)H to a
          hydroquinone and NAD(P+. Quinones are cyclic diones
          derived from aromatic compounds. Membrane bound QOR
          acts in the respiratory chains of bacteria and
          mitochondria, while soluble QOR acts to protect from
          toxic quinones (e.g. DT-diaphorase) or as a soluble
          eye-lens protein in some vertebrates (e.g.
          zeta-crystalin). QOR reduces quinones through a
          semi-quinone intermediate via a NAD(P)H-dependent
          single electron transfer. QOR is a member of the medium
          chain dehydrogenase/reductase family, but lacks the
          zinc-binding sites of the prototypical alcohol
          dehydrogenases of this group.  Alcohol dehydrogenase in
          the liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  The N-terminal
          catalytic domain has a distant homology to GroES. These
          proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site, and a structural
          zinc in a lobe of the catalytic domain.  NAD(H)-binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 325

 Score = 75.3 bits (186), Expect = 3e-18
 Identities = 29/51 (56%), Positives = 41/51 (80%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVF 52
          A+G+NPV+TYIR+G YP LP LP + G++ +G+VE VG+GV   KVGD+V+
Sbjct: 36 ASGVNPVDTYIRAGAYPGLPPLPYVPGSDGAGVVEAVGEGVDGLKVGDRVW 86


>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR).  Quinone
          oxidoreductase (QOR) and 2-haloacrylate reductase. QOR
          catalyzes the conversion of a quinone + NAD(P)H to a
          hydroquinone + NAD(P)+. Quinones are cyclic diones
          derived from aromatic compounds.  Membrane bound QOR
          actin the respiratory chains of bacteria and
          mitochondria, while soluble QOR acts to protect from
          toxic quinones (e.g. DT-diaphorase) or as a soluble
          eye-lens protein in some vertebrates (e.g.
          zeta-crystalin). QOR reduces quinones through a
          semi-quinone intermediate via a NAD(P)H-dependent
          single electron transfer. QOR is a member of the medium
          chain dehydrogenase/reductase family, but lacks the
          zinc-binding sites of the prototypical alcohol
          dehydrogenases of this group. 2-haloacrylate reductase,
          a member of this subgroup, catalyzes the
          NADPH-dependent reduction of a carbon-carbon double
          bond in organohalogen compounds. Although similar to
          QOR, Burkholderia 2-haloacrylate reductase does not act
          on the quinones 1,4-benzoquinone and
          1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases
          are the major enzymes in the interconversion of
          alcohols and aldehydes, or ketones.  Alcohol
          dehydrogenase in the liver converts ethanol and NAD+ to
          acetaldehyde and NADH, while in yeast and some other
          microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation.  ADH
          is a member of the medium chain alcohol dehydrogenase
          family (MDR), which have a NAD(P)(H)-binding domain in
          a Rossmann fold of a beta-alpha form. The
          NAD(H)-binding region is comprised of 2 structurally
          similar halves, each of which contacts a
          mononucleotide.  A GxGxxG motif after the first
          mononucleotide contact half allows the close contact of
          the coenzyme with the ADH backbone.  The N-terminal
          catalytic domain has a distant homology  to GroES.
          These proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H)  binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 320

 Score = 72.5 bits (179), Expect = 3e-17
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 8/65 (12%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV--FGKPILGK 59
          A G+N ++TY RSG YP    LP +LG E +G+VE VG GV  FKVGD+V   G P    
Sbjct: 35 AIGVNFIDTYFRSGLYP--LPLPFVLGVEGAGVVEAVGPGVTGFKVGDRVAYAGPP---- 88

Query: 60 GGYSQ 64
          G Y++
Sbjct: 89 GAYAE 93


>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           The medium chain reductase/dehydrogenases
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases  (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH) , quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          ADH-like proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and generally have 2 tightly bound zinc atoms per
          subunit, a catalytic zinc at the active site and a
          structural zinc in a lobe of the catalytic domain. The
          active site zinc is coordinated by a histidine, two
          cysteines, and a water molecule. The second zinc seems
          to play a structural role, affects subunit
          interactions, and is typically coordinated by 4
          cysteines. Other MDR members have only a catalytic
          zinc, and some contain no coordinated zinc.
          Length = 271

 Score = 70.4 bits (173), Expect = 1e-16
 Identities = 31/59 (52%), Positives = 37/59 (62%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
          AAG+   + +IR G YP  P LP ILG E +G+V EVG GV   KVGD+V   P LG G
Sbjct: 8  AAGLCGTDLHIRRGGYPPPPKLPLILGHEGAGVVVEVGPGVTGVKVGDRVVVLPNLGCG 66


>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group is a member of the medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, but lacks the zinc-binding
          sites of the zinc-dependent alcohol dehydrogenases. The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 328

 Score = 69.9 bits (172), Expect = 3e-16
 Identities = 29/63 (46%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKP--ILG 58
           A G+N  +   R G Y   P LPA LG E +G+VE VG GV  F VGD+V   P   LG
Sbjct: 35 EAIGLNRADAMFRRGAYIEPPPLPARLGYEAAGVVEAVGAGVTGFAVGDRVSVIPAADLG 94

Query: 59 KGG 61
          + G
Sbjct: 95 QYG 97


>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone
          oxidoreductase.  PIG3 p53-inducible quinone
          oxidoreductase, a medium chain dehydrogenase/reductase
          family member, acts in the apoptotic pathway. PIG3
          reduces ortho-quinones, but its apoptotic activity has
          been attributed to oxidative stress generation, since
          overexpression of PIG3 accumulates reactive oxygen
          species. PIG3 resembles the MDR family member quinone
          reductases, which catalyze the reduction of quinone to
          hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are
          the major enzymes in the interconversion of alcohols
          and aldehydes or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology  to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site, and a structural
          zinc in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 323

 Score = 69.4 bits (171), Expect = 3e-16
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
          AAG+N  +   R G YP  P    ILG EV+G+V  VG GV  +KVGD+V    +L  GG
Sbjct: 36 AAGVNRADLLQRQGLYPPPPGASDILGLEVAGVVVAVGPGVTGWKVGDRVCA--LLAGGG 93

Query: 62 YSQ 64
          Y++
Sbjct: 94 YAE 96


>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group is a member of the medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, but lacks the zinc-binding
          sites of the zinc-dependent alcohol dehydrogenases. The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 337

 Score = 69.5 bits (171), Expect = 4e-16
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
          A G+N  +   R G Y + P  P + G E +G VE VG+GVK FKVGD+V G      GG
Sbjct: 35 ACGLNFADLMARQGLYDSAPKPPFVPGFECAGTVEAVGEGVKDFKVGDRVMGLTRF--GG 92

Query: 62 YS 63
          Y+
Sbjct: 93 YA 94


>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent;
          Provisional.
          Length = 327

 Score = 69.0 bits (169), Expect = 6e-16
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A GIN ++TYIRSG YP  P LP+ LGTE +G+V +VG GVKH KVGD+V
Sbjct: 37 AIGINYIDTYIRSGLYPP-PSLPSGLGTEAAGVVSKVGSGVKHIKVGDRV 85


>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR).  QOR catalyzes the
          conversion of a quinone + NAD(P)H to a hydroquinone +
          NAD(P)+. Quinones are cyclic diones derived from
          aromatic compounds. Membrane bound QOR acts in the
          respiratory chains of bacteria and mitochondria, while
          soluble QOR acts to protect from toxic quinones (e.g.
          DT-diaphorase) or as a soluble eye-lens protein in some
          vertebrates (e.g. zeta-crystalin). QOR reduces quinones
          through a semi-quinone intermediate via a
          NAD(P)H-dependent single electron transfer. QOR is a
          member of the medium chain dehydrogenase/reductase
          family, but lacks the zinc-binding sites of the
          prototypical alcohol dehydrogenases of this group.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site, and a structural
          zinc in a lobe of the catalytic domain.  NAD(H)-binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 323

 Score = 67.9 bits (167), Expect = 1e-15
 Identities = 28/64 (43%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           AAG+N  +  +  G+Y   P LP + G+EV+G+VE VG+GV  FKVGD+V    + G+G
Sbjct: 35 EAAGVNFPDLLMIQGKYQVKPPLPFVPGSEVAGVVEAVGEGVTGFKVGDRVVA--LTGQG 92

Query: 61 GYSQ 64
          G+++
Sbjct: 93 GFAE 96


>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like.  Member
          identified as possible enoyl reductase of the MDR
          family. 2-enoyl thioester reductase (ETR) catalyzes the
          NADPH-dependent dependent conversion of trans-2-enoyl
          acyl carrier protein/coenzyme A (ACP/CoA) to
          acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl
          thioester reductase activity has been linked in
          Candida tropicalis as essential in maintaining
          mitiochondrial respiratory function. This ETR family is
          a part of the medium chain dehydrogenase/reductase
          family, but lack the zinc coordination sites
          characteristic of the alcohol dehydrogenases in this
          family. NAD(P)(H)-dependent oxidoreductases are the
          major enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  The N-terminal catalytic
          domain has a distant homology to GroES.  These proteins
          typically form dimers (typically higher plants,
          mammals) or tetramers (yeast, bacteria), and have 2
          tightly bound zinc atoms per subunit, a catalytic zinc
          at the active site, and a structural zinc in a lobe of
          the catalytic domain.  NAD(H)-binding occurs in the
          cleft between the catalytic  and coenzyme-binding
          domains at the active site, and coenzyme binding
          induces a conformational closing of this cleft.
          Coenzyme binding typically precedes and contributes to
          substrate binding.  Candida tropicalis enoyl thioester
          reductase (Etr1p) catalyzes the NADPH-dependent
          reduction of trans-2-enoyl thioesters in mitochondrial
          fatty acid synthesis. Etr1p forms homodimers with each
          subunit containing a nucleotide-binding Rossmann fold
          domain and a catalytic domain.
          Length = 339

 Score = 65.7 bits (161), Expect = 8e-15
 Identities = 25/52 (48%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFG 53
          A  +NPV+   +   Y  +P  PAILG + +G V EVG GV  FKVGD+V G
Sbjct: 35 AVALNPVDWKHQD--YGFIPSYPAILGCDFAGTVVEVGSGVTRFKVGDRVAG 84


>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain.  This
          is the catalytic domain of alcohol dehydrogenases. Many
          of them contain an inserted zinc binding domain. This
          domain has a GroES-like structure.
          Length = 108

 Score = 61.1 bits (149), Expect = 3e-14
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
          AAGI   + +I  G+ P +  LP ILG E +GIVEEVG GV   KVGD+V   P++  G
Sbjct: 10 AAGICGSDLHIYRGEPPPVK-LPLILGHEGAGIVEEVGPGVTGLKVGDRVVVYPLIPCG 67


>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase,
          PIG3 family.  Members of this family are putative
          quinone oxidoreductases that belong to the broader
          superfamily (modeled by Pfam pfam00107) of
          zinc-dependent alcohol (of medium chain length)
          dehydrogenases and quinone oxiooreductases. The
          alignment shows no motif of conserved Cys residues as
          are found in zinc-binding members of the superfamily,
          and members are likely to be quinone oxidoreductases
          instead. A member of this family in Homo sapiens, PIG3,
          is induced by p53 but is otherwise uncharacterized
          [Unknown function, Enzymes of unknown specificity].
          Length = 325

 Score = 63.0 bits (154), Expect = 8e-14
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
          AAG+N  +   R+G+YP  P    ILG EV+G V  VG+GV  +KVGD+V    ++  GG
Sbjct: 36 AAGVNRPDLLQRAGKYPPPPGASDILGLEVAGEVVAVGEGVSRWKVGDRVCA--LVAGGG 93

Query: 62 YSQ 64
          Y++
Sbjct: 94 YAE 96


>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional.
          Length = 334

 Score = 63.1 bits (154), Expect = 8e-14
 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           AAG+N  +T  R G+YP  P    ILG EV+G VE+VG  VK FK GD+V    +L  G
Sbjct: 36 SAAGVNRADTLQRQGKYPPPPGSSEILGLEVAGYVEDVGSDVKRFKEGDRVMA--LLPGG 93

Query: 61 GYSQ 64
          GY++
Sbjct: 94 GYAE 97


>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members.
          This group contains a structure identified as an
          arginate lyase. Other members are identified quinone
          reductases, alginate lyases, and other proteins related
          to the zinc-dependent dehydrogenases/reductases. QOR
          catalyzes the conversion of a quinone and NAD(P)H to a
          hydroquinone and NAD(P+. Quinones are cyclic diones
          derived from aromatic compounds. Membrane bound QOR
          acts in the respiratory chains of bacteria and
          mitochondria, while soluble QOR acts to protect from
          toxic quinones (e.g. DT-diaphorase) or as a soluble
          eye-lens protein in some vertebrates (e.g.
          zeta-crystalin). QOR reduces quinones through a
          semi-quinone intermediate via a NAD(P)H-dependent
          single electron transfer. QOR is a member of the medium
          chain dehydrogenase/reductase family, but lacks the
          zinc-binding sites of the prototypical alcohol
          dehydrogenases of this group.  Alcohol dehydrogenase in
          the liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation. ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  The N-terminal
          catalytic domain has a distant homology to GroES. These
          proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain. NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.  In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 336

 Score = 62.5 bits (153), Expect = 1e-13
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVF 52
          A  +NPV+T +R+G  P  P  P ILG + SG+VE VG  V  FKVGD+V+
Sbjct: 39 AVSVNPVDTKVRAGGAPV-PGQPKILGWDASGVVEAVGSEVTLFKVGDEVY 88


>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase
           (MDR)/zinc-dependent alcohol dehydrogenase-like family. 
           This group is a member of the medium chain
           dehydrogenases/reductase (MDR)/zinc-dependent alcohol
           dehydrogenase-like family, but lacks the zinc-binding
           sites of the zinc-dependent alcohol dehydrogenases. The
           medium chain dehydrogenases/reductase
           (MDR)/zinc-dependent alcohol dehydrogenase-like family,
           which contains the zinc-dependent alcohol dehydrogenase
           (ADH-Zn) and related proteins, is a diverse group of
           proteins related to the first identified member, class I
           mammalian ADH.  MDRs display a broad range of activities
           and are distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P)-binding Rossmann fold domain of a
           beta-alpha form and an N-terminal catalytic domain with
           distant homology to GroES.  The MDR group contains a
           host of activities, including the founding alcohol
           dehydrogenase (ADH), quinone reductase, sorbitol
           dehydrogenase, formaldehyde dehydrogenase, butanediol
           DH, ketose reductase, cinnamyl reductase, and numerous
           others. The zinc-dependent alcohol dehydrogenases (ADHs)
           catalyze the  NAD(P)(H)-dependent interconversion of
           alcohols to aldehydes or ketones.  Active site zinc has
           a catalytic role, while structural zinc aids in
           stability.  ADH-like proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and generally have 2 tightly bound zinc atoms
           per subunit. The active site zinc is coordinated by a
           histidine, two cysteines, and a water molecule. The
           second zinc seems to play a structural role, affects
           subunit interactions, and is typically coordinated by 4
           cysteines.
          Length = 319

 Score = 62.2 bits (152), Expect = 2e-13
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 2   AAGINPVETYIRSGQYPNLPDL---PAILGTEVSGIVEEVGQGVKHFKVGDKVFGK-PIL 57
           AA +NPV+  +R G  P L      P I G + +G V  VG GV  FKVGD+VFG+ P  
Sbjct: 35  AASVNPVDWKLRRG-PPKLLLGRPFPPIPGMDFAGEVVAVGSGVTRFKVGDEVFGRLPPK 93

Query: 58  GKGGYSQ 64
           G G  ++
Sbjct: 94  GGGALAE 100


>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like.  2-enoyl
          thioester reductase (ETR) catalyzes the NADPH-dependent
          conversion of trans-2-enoyl acyl carrier
          protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty
          acid synthesis. 2-enoyl thioester reductase activity
          has been linked in Candida tropicalis as essential in
          maintaining mitiochondrial respiratory function. This
          ETR family is a part of the medium chain
          dehydrogenase/reductase family, but lack the zinc
          coordination sites characteristic of the alcohol
          dehydrogenases in this family. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones. 
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation. 
          ADH is a member of the medium chain alcohol
          dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  The N-terminal
          catalytic domain has a distant homology  to GroES.
          These proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.  Candida tropicalis
          enoyl thioester reductase (Etr1p) catalyzes the
          NADPH-dependent reduction of trans-2-enoyl thioesters
          in mitochondrial fatty acid synthesis. Etr1p forms
          homodimers with each subunit containing a
          nucleotide-binding Rossmann fold domain and a catalytic
          domain.
          Length = 323

 Score = 57.7 bits (140), Expect = 6e-12
 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
          AA INP +    SG Y + P LPA+ G E  G+V EVG GV    VG +V   P+ G+G 
Sbjct: 35 AAPINPSDLITISGAYGSRPPLPAVPGNEGVGVVVEVGSGVSGLLVGQRVL--PLGGEGT 92

Query: 62 YSQ 64
          + +
Sbjct: 93 WQE 95


>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase.  Enoylreductase in Polyketide
          synthases.
          Length = 287

 Score = 57.4 bits (140), Expect = 8e-12
 Identities = 25/63 (39%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           AAG+N  +  I  G YP      A+LG E +G+V  VG GV    VGD+V G   L  G
Sbjct: 4  RAAGLNFRDVLIALGLYPG----EAVLGGECAGVVTRVGPGVTGLAVGDRVMG---LAPG 56

Query: 61 GYS 63
           ++
Sbjct: 57 AFA 59


>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase.
          Putative enoyl reductase of polyketide synthase.
          Polyketide synthases produce polyketides in step by
          step mechanism that is similar to fatty acid synthesis.
          Enoyl reductase reduces a double to single bond.
          Erythromycin is one example of a polyketide generated
          by 3 complex enzymes (megasynthases). 2-enoyl thioester
          reductase (ETR) catalyzes the NADPH-dependent dependent
          conversion of trans-2-enoyl acyl carrier
          protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty
          acid synthesis. 2-enoyl thioester reductase activity
          has been linked in  Candida tropicalis as essential in
          maintaining mitiochondrial respiratory function. This
          ETR family is a part of the medium chain
          dehydrogenase/reductase family, but lack the zinc
          coordination sites characteristic of the alcohol
          dehydrogenases in this family. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes or ketones.
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation. 
          ADH is a member of the medium chain alcohol
          dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide. The N-terminal
          catalytic domain has a distant homology  to GroES.
          These proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site, and a structural
          zinc in a lobe of the catalytic domain. NAD(H) binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains, at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.
          Length = 293

 Score = 56.8 bits (138), Expect = 1e-11
 Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           AAG+N  +  +  G  P        LG E SGIV  VG GV   KVGD+V G   L  G
Sbjct: 8  KAAGLNFRDVLVALGLLP---GDETPLGLECSGIVTRVGSGVTGLKVGDRVMG---LAPG 61

Query: 61 GYS 63
           ++
Sbjct: 62 AFA 64


>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1.  Human
           Reticulon 4 Interacting Protein 1 is a member of the
           medium chain dehydrogenase/ reductase (MDR) family.
           Riticulons are endoplasmic reticulum associated proteins
           involved in membrane trafficking  and neuroendocrine
           secretion. The MDR/zinc-dependent alcohol
           dehydrogenase-like family, which contains the
           zinc-dependent alcohol dehydrogenase (ADH-Zn) and
           related proteins, is a diverse group of proteins related
           to the first identified member, class I mammalian ADH.
           MDRs display a broad range of activities and are
           distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of a
           beta-alpha form and an N-terminal catalytic domain with
           distant homology to GroES.
          Length = 350

 Score = 56.8 bits (138), Expect = 1e-11
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 14/66 (21%)

Query: 2   AAGINPVETYIRSG--------------QYPNLPDLPAILGTEVSGIVEEVGQGVKHFKV 47
           AA +NP++  +RSG                 +  + P  LG + SG+V ++G GVK F++
Sbjct: 38  AASVNPIDVLMRSGYGRTLLNKKRKPQSCKYSGIEFPLTLGRDCSGVVVDIGSGVKSFEI 97

Query: 48  GDKVFG 53
           GD+V+G
Sbjct: 98  GDEVWG 103


>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family. 
          This group contains proteins related to the
          zinc-dependent  alcohol dehydrogenases. However, while
          the group has structural zinc site characteristic of
          these enzymes, it lacks the consensus site for a
          catalytic zinc. NAD(P)(H)-dependent oxidoreductases are
          the major enzymes in the interconversion of alcohols
          and aldehydes, or ketones.   Alcohol dehydrogenase in
          the liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation. ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide. A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone. The
          N-terminal catalytic domain has a distant homology to
          GroES. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
           and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site, and a structural
          zinc in a lobe of the catalytic domain. NAD(H)-binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 342

 Score = 55.0 bits (133), Expect = 7e-11
 Identities = 20/50 (40%), Positives = 31/50 (62%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          AA +N ++ ++R G       LP ILG++ +G+VE VG GV + K G +V
Sbjct: 36 AAALNHLDLWVRRGMPGIKLPLPHILGSDGAGVVEAVGPGVTNVKPGQRV 85


>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related
          zinc-dependent alcohol dehydrogenases.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  There are 7 vertebrate ADH 7
          classes, 6 of which have been identified in humans.
          Class III, glutathione-dependent formaldehyde
          dehydrogenase, has been identified as the primordial
          form and exists in diverse species, including plants,
          micro-organisms, vertebrates, and invertebrates. Class
          I, typified by  liver dehydrogenase, is an evolving
          form. Gene duplication and functional specialization of
          ADH into ADH classes and subclasses created numerous
          forms in vertebrates. For example, the A, B and C
          (formerly alpha, beta, gamma) human class I subunits
          have high overall structural similarity, but differ in
          the substrate binding pocket and therefore in substrate
          specificity.  In human ADH catalysis, the zinc ion
          helps coordinate the alcohol, followed by deprotonation
          of  a histidine (His-51), the ribose of NAD, a serine
          (Ser-48), then the alcohol, which allows the transfer
          of a hydride to NAD+, creating NADH and a zinc-bound
          aldehyde or ketone. In yeast and some bacteria, the
          active site zinc binds an aldehyde, polarizing it, and
          leading to the reverse reaction. ADH is a member of the
          medium chain alcohol dehydrogenase family (MDR), which
          has a NAD(P)(H)-binding domain in a Rossmann fold of an
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide. A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology  to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.
          Length = 365

 Score = 52.1 bits (125), Expect = 6e-10
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A G+   + ++  G+ P    LP ILG E +GIVE +G GV   K GDKV
Sbjct: 34 ATGVCHTDLHVIDGKLPTP--LPVILGHEGAGIVESIGPGVTTLKPGDKV 81


>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III
          [Energy production and conversion].
          Length = 366

 Score = 52.2 bits (126), Expect = 7e-10
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           A G+   + +  SG  P     PA+LG E +GIVE VG+GV   K GD V
Sbjct: 35 TATGVCHTDAHTLSGDDP--EGFPAVLGHEGAGIVEAVGEGVTSVKPGDHV 83


>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones. This group contains proteins
          that share the characteristic catalytic and structural
          zinc-binding sites of the zinc-dependent alcohol
          dehydrogenase family.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation. ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide. A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone. The
          N-terminal catalytic domain has a distant homology to
          GroES. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain. NAD(H)-binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine (His-51), the
          ribose of NAD, a serine (Ser-48), then the alcohol,
          which allows the transfer of a hydride to NAD+,
          creating NADH and a zinc-bound aldehyde or ketone. In
          yeast and some bacteria, the active site zinc binds an
          aldehyde, polarizing it, and leading to the reverse
          reaction.
          Length = 332

 Score = 51.2 bits (123), Expect = 2e-09
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           AAG+   +     G +P     P ILG E+ G VEEVG+GV+ FK GD+V     +  G
Sbjct: 33 KAAGVCYRDLLFWKGFFPRG-KYPLILGHEIVGTVEEVGEGVERFKPGDRVILYYYIPCG 91


>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase.  Benzyl
          alcohol dehydrogenase is similar to liver alcohol
          dehydrogenase, but has some amino acid substitutions
          near  the active site, which may determine the enzyme's
          specificity of oxidizing aromatic substrates.  Also
          known as aryl-alcohol dehydrogenases, they catalyze the
          conversion of an aromatic alcohol + NAD+ to an aromatic
          aldehyde + NADH + H+.  NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones. 
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation. 
          ADH is a member of the medium chain alcohol
          dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.  In human  ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 365

 Score = 51.0 bits (123), Expect = 2e-09
 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 12 IRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          +R G  P    LPA+LG E +G+VE VG  V   K GD V
Sbjct: 46 VRDGGLP--TPLPAVLGHEGAGVVEAVGSAVTGLKPGDHV 83


>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family. 
          This group resembles the zinc-dependent alcohol
          dehydrogenases of the medium chain dehydrogenase
          family. However, this subgroup does not contain the
          characteristic catalytic zinc site. Also, it contains
          an atypical structural zinc-binding pattern:
          DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases
          are the major enzymes in the interconversion of
          alcohols and aldehydes, or ketones.   Alcohol
          dehydrogenase in the liver converts ethanol and NAD+ to
          acetaldehyde and NADH, while in yeast and some other
          microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation. ADH
          is a member of the medium chain alcohol dehydrogenase
          family (MDR), which has a NAD(P)(H)-binding domain in a
          Rossmann fold of a beta-alpha form.  The NAD(H)-binding
          region is comprised of 2 structurally similar halves,
          each of which contacts a mononucleotide. A GxGxxG motif
          after the first mononucleotide contact half allows the
          close contact of the coenzyme with the ADH backbone.
          The N-terminal catalytic domain has a distant homology
          to GroES. These proteins typically form dimers
          (typically higher plants, mammals) or tetramers (yeast,
          bacteria), and have 2 tightly bound zinc atoms per
          subunit, a catalytic zinc at the active site and a
          structural zinc in a lobe of the catalytic domain.
          NAD(H)-binding occurs in the cleft between the
          catalytic  and coenzyme-binding domains at the active
          site, and coenzyme binding induces a conformational
          closing of this cleft. Coenzyme binding typically
          precedes and contributes to substrate binding. In human
          ADH catalysis, the zinc ion helps coordinate the
          alcohol, followed by deprotonation of  a histidine, the
          ribose of NAD, a serine, then the alcohol, which allows
          the transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 325

 Score = 50.4 bits (121), Expect = 2e-09
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           AG+NPV+  + +      P +P I G E +G+VEEVG  VK  K GD+V
Sbjct: 35 MAGVNPVDYNVINA-VKVKP-MPHIPGAEFAGVVEEVGDHVKGVKKGDRV 82


>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase.
          Glutathione-dependent formaldehyde dehydrogenases
          (FDHs, Class III ADH) are members of the
          zinc-dependent/medium chain alcohol dehydrogenase
          family.  FDH converts formaldehyde and NAD(P) to
          formate and NAD(P)H. The initial step in this process
          the spontaneous formation of a
          S-(hydroxymethyl)glutathione adduct from formaldehyde
          and glutathione, followed by FDH-mediated oxidation
          (and detoxification) of the adduct to
          S-formylglutathione. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes or ketones.
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation.
          Class III ADH are also known as glutathione-dependent
          formaldehyde dehydrogenase (FDH), which convert
          aldehydes to corresponding carboxylic acid and alcohol.
           ADH is a member of the medium chain alcohol
          dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of an
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  A GxGxxG motif after the
          first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.
          Length = 363

 Score = 50.2 bits (121), Expect = 3e-09
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 22 DLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           LPA+LG E +G+VEEVG GV   K GD V
Sbjct: 52 PLPAVLGHEGAGVVEEVGPGVTGVKPGDHV 81


>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. 
           (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent
           medium chain alcohol dehydrogenase, catalyzes the
           NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and
           meso-butanediol to acetoin. BDH functions as a
           homodimer.  NAD(P)(H)-dependent oxidoreductases are the
           major enzymes in the interconversion of alcohols and
           aldehydes, or ketones.  The medium chain alcohol
           dehydrogenase family (MDR) have a NAD(P)(H)-binding
           domain in a Rossmann fold of a beta-alpha form. The
           N-terminal region typically has an all-beta catalytic
           domain. These proteins typically form dimers (typically
           higher plants, mammals) or tetramers (yeast, bacteria),
           and have 2 tightly bound zinc atoms per subunit.
           Sorbitol and aldose reductase are NAD(+) binding
           proteins of the polyol pathway, which interconverts
           glucose and fructose. Sorbitol dehydrogenase is
           tetrameric and has a single catalytic zinc per subunit.
          Length = 351

 Score = 50.2 bits (121), Expect = 3e-09
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 23  LPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
            P  LG E SG+V EVG GV  FKVGD+V  +P +  G
Sbjct: 64  APVTLGHEFSGVVVEVGSGVTGFKVGDRVVVEPTIKCG 101


>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like
          proteins, child 2.  2-enoyl thioester reductase (ETR)
          like proteins. ETR catalyzes the NADPH-dependent
          conversion of trans-2-enoyl acyl carrier
          protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty
          acid synthesis. 2-enoyl thioester reductase activity
          has been linked in Candida tropicalis as essential in
          maintaining mitiochondrial respiratory function. This
          ETR family is a part of the medium chain
          dehydrogenase/reductase family, but lack the zinc
          coordination sites characteristic of the 2-enoyl
          thioester reductase (ETR) like proteins. ETR catalyzes
          the NADPH-dependent dependent conversion of
          trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA)
          to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl
          thioester reductase activity has been linked in Candida
          tropicalis as essential in maintaining mitiochondrial
          respiratory function. This ETR family is a part of the
          medium chain dehydrogenase/reductase family, but lack
          the zinc coordination sites characteristic of the
          alcohol dehydrogenases in this family.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.   ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  The N-terminal
          catalytic domain has a distant homology to GroES.
          These proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site, and a structural
          zinc in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains, at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.  Candida tropicalis
          enoyl thioester reductase (Etr1p) catalyzes the
          NADPH-dependent reduction of trans-2-enoyl thioesters
          in mitochondrial fatty acid synthesis. Etr1p forms
          homodimers, with each subunit containing a
          nucleotide-binding Rossmann fold domain and a catalytic
          domain.
          Length = 324

 Score = 49.6 bits (119), Expect = 5e-09
 Identities = 21/45 (46%), Positives = 29/45 (64%)

Query: 14 SGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILG 58
           G Y   P+LPAI G+E  G+V+ VG+GVK  +VG +V   P+ G
Sbjct: 49 RGTYGYKPELPAIGGSEAVGVVDAVGEGVKGLQVGQRVAVAPVHG 93


>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family
          protein.  Members of this model form a distinct subset
          of the larger family of oxidoreductases that includes
          zinc-binding alcohol dehydrogenases and NADPH:quinone
          reductases (pfam00107). While some current members of
          this family carry designations as putative alginate
          lyase, it seems no sequence with a direct
          characterization as such is detected by this model
          [Energy metabolism, Fermentation].
          Length = 336

 Score = 49.4 bits (118), Expect = 6e-09
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVF 52
          A  +NPV+T +R+   P     P ILG + +G+V  VG  V  FK GD+V+
Sbjct: 38 AISVNPVDTKVRARMAPE-AGQPKILGWDAAGVVVAVGDEVTLFKPGDEVW 87


>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase.  Member
           identified as possible enoyl reductase of the MDR
           family. 2-enoyl thioester reductase (ETR) catalyzes the
           NADPH-dependent dependent conversion of trans-2-enoyl
           acyl carrier protein/coenzyme A (ACP/CoA) to
           acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl
           thioester reductase activity has been linked in Candida
           tropicalis as essential in maintaining mitiochondrial
           respiratory function. This ETR family is a part of the
           medium chain dehydrogenase/reductase family, but lack
           the zinc coordination sites characteristic of the
           alcohol dehydrogenases in this family.
           NAD(P)(H)-dependent oxidoreductases are the major
           enzymes in the interconversion of alcohols and
           aldehydes, or ketones.  Alcohol dehydrogenase in the
           liver converts ethanol and NAD+ to acetaldehyde and
           NADH, while in yeast and some other microorganisms ADH
           catalyzes the conversion acetaldehyde to ethanol in
           alcoholic fermentation.  ADH is a member of the medium
           chain alcohol dehydrogenase family (MDR), which has a
           NAD(P)(H)-binding domain in a Rossmann fold of a
           beta-alpha form.  The NAD(H)-binding region is comprised
           of 2 structurally similar halves, each of which contacts
           a mononucleotide.  The N-terminal catalytic domain has a
           distant homology to GroES.  These proteins typically
           form dimers (typically higher plants, mammals) or
           tetramers (yeast, bacteria), and have 2 tightly bound
           zinc atoms per subunit, a catalytic zinc at the active
           site, and a structural zinc in a lobe of the catalytic
           domain.  NAD(H)  binding occurs in the cleft between the
           catalytic and coenzyme-binding domains at the active
           site, and coenzyme binding induces a conformational
           closing of this cleft. Coenzyme binding typically
           precedes and contributes to substrate binding.  Candida
           tropicalis enoyl thioester reductase (Etr1p) catalyzes
           the NADPH-dependent reduction of trans-2-enoyl
           thioesters in mitochondrial fatty acid synthesis. Etr1p
           forms homodimers, with each subunit containing a
           nucleotide-binding Rossmann fold domain and a catalytic
           domain.
          Length = 324

 Score = 49.3 bits (118), Expect = 7e-09
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 2   AAGINPVETYIRSG--QYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGK 59
           AAG++ V+T +RSG    P  P+LP + G EV+G+V+ VG GV    +G +V        
Sbjct: 36  AAGVHFVDTQLRSGWGPGPFPPELPYVPGGEVAGVVDAVGPGVDPAWLGRRVVAHTGRAG 95

Query: 60  GGYSQ 64
           GGY++
Sbjct: 96  GGYAE 100


>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases.  This
          group contains proteins identified as sorbitol
          dehydrogenases and other sugar dehydrogenases of the
          medium-chain dehydrogenase/reductase family (MDR),
          which includes zinc-dependent alcohol dehydrogenase and
          related proteins. Sorbitol and aldose reductase are
          NAD(+) binding proteins of the polyol pathway, which
          interconverts glucose and fructose. Sorbitol
          dehydrogenase is tetrameric and has a single catalytic
          zinc per subunit. NAD(P)(H)-dependent oxidoreductases
          are the major enzymes in the interconversion of
          alcohols and aldehydes, or ketones. Related proteins
          include threonine dehydrogenase, formaldehyde
          dehydrogenase, and butanediol dehydrogenase. The medium
          chain alcohol dehydrogenase family (MDR) has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit. Horse liver alcohol
          dehydrogenase is a dimeric enzyme and each subunit has
          two domains. The NAD binding domain is in a Rossmann
          fold and the catalytic domain contains a zinc ion to
          which substrates bind. There is a cleft between the
          domains that closes upon formation of the ternary
          complex.
          Length = 343

 Score = 48.4 bits (116), Expect = 1e-08
 Identities = 26/62 (41%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 1  MAAGI--NPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILG 58
           A GI  + +  Y+ +G Y      P +LG E SG VEEVG GV    VGD+V   P+L 
Sbjct: 32 KACGICGSDIPRYLGTGAYH----PPLVLGHEFSGTVEEVGSGVDDLAVGDRVAVNPLLP 87

Query: 59 KG 60
           G
Sbjct: 88 CG 89


>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase.
          L-threonine dehydrogenase (TDH) catalyzes the
          zinc-dependent formation of 2-amino-3-ketobutyrate from
          L-threonine, via NAD(H)-dependent oxidation.  THD is a
          member of the zinc-requiring, medium chain
          NAD(H)-dependent alcohol dehydrogenase family (MDR).
          MDRs  have a NAD(P)(H)-binding domain in a Rossmann
          fold of a beta-alpha form. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones.
          The N-terminal region typically has an all-beta
          catalytic domain. These proteins typically form dimers
          (typically higher plants, mammals) or tetramers (yeast,
          bacteria),  and have 2 tightly bound zinc atoms per
          subunit. Sorbitol and aldose reductase are NAD(+)
          binding proteins of the polyol pathway, which
          interconverts glucose and fructose.
          Length = 334

 Score = 48.3 bits (116), Expect = 2e-08
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           A GI   + +I  G++      P + G E +G+V  VG  V  FKVGD+V
Sbjct: 32 AACGICGTDLHIYEGEFG--AAPPLVPGHEFAGVVVAVGSKVTGFKVGDRV 80


>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol
          dehydrogenases.  NAD(P)(H)-dependent oxidoreductases
          are the major enzymes in the interconversion of
          alcohols and aldehydes or ketones.  This group includes
          alcohol dehydrogenases corresponding to mammalian
          classes I, II, IV. Alcohol dehydrogenase in the liver
          converts ethanol and NAD+ to acetaldehyde and NADH,
          while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology  to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine (His-51), the
          ribose of NAD,  a serine (Ser-48) , then the alcohol,
          which allows the transfer of a hydride to NAD+,
          creating NADH and a zinc-bound aldehyde or ketone. In
          yeast and some bacteria, the active site zinc binds an
          aldehyde, polarizing it, and leading to the reverse
          reaction.
          Length = 373

 Score = 48.1 bits (115), Expect = 2e-08
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A GI   + ++ SG+       P ILG E +GIVE VG+GV   K GDKV
Sbjct: 41 ATGICRSDDHVVSGKLVTP--FPVILGHEAAGIVESVGEGVTTVKPGDKV 88


>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group is a member of the medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, but lacks the zinc-binding
          sites of the zinc-dependent alcohol dehydrogenases. The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 336

 Score = 47.5 bits (114), Expect = 3e-08
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A  +N  +  I +G+YP     P I  ++ +G V  VG+GV  FKVGD+V
Sbjct: 36 AVSLNYRDLLILNGRYPPPVKDPLIPLSDGAGEVVAVGEGVTRFKVGDRV 85


>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase.  Putative
          L-iditol 2-dehydrogenase based on annotation of some
          members in this subgroup.  L-iditol 2-dehydrogenase
          catalyzes the NAD+-dependent conversion of L-iditol to
          L-sorbose in fructose and mannose metabolism. This
          enzyme is related to sorbitol dehydrogenase, alcohol
          dehydrogenase, and other medium chain
          dehydrogenase/reductases. The zinc-dependent alcohol
          dehydrogenase (ADH-Zn)-like family of proteins is a
          diverse group of proteins related to the first
          identified member, class I mammalian ADH.  This group
          is also called the medium chain
          dehydrogenases/reductase family (MDR) to highlight its
          broad range of activities and to distinguish from the
          smaller short chain dehydrogenases (~ 250 amino acids
          vs. the ~ 350 amino acids of the MDR).  The MDR
          proteins have 2 domains: a C-terminal NAD(P)
          binding-Rossmann fold domain of a beta-alpha form and
          an N-terminal GroES-like catalytic domain.  The MDR
          group contains a host of activities, including the
          founding alcohol dehydrogenase (ADH), quinone
          reductase, sorbitol dehydrogenase, formaldehyde
          dehydrogenase, butanediol DH, ketose reductase,
          cinnamyl reductase, and numerous others. The
          zinc-dependent alcohol  dehydrogenases (ADHs) catalyze
          the  NAD(P)(H)-dependent interconversion of alcohols to
          aldehydes or ketones.  Active site zinc has a catalytic
          role, while structural zinc aids in stability.
          ADH-like proteins  typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and generally have 2 tightly bound zinc atoms per
          subunit. The active site zinc is coordinated by a
          histidine, two cysteines, and a water molecule. The
          second zinc seems to play a structural role, affects
          subunit interactions, and is typically coordinated by 4
          cysteines.
          Length = 343

 Score = 47.2 bits (113), Expect = 4e-08
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 21 PDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILG 58
             P ILG E++G + EVG GV  FKVGD+VF  P + 
Sbjct: 51 LKPPRILGHEIAGEIVEVGDGVTGFKVGDRVFVAPHVP 88


>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase.  Sorbitol and
          aldose reductase are NAD(+) binding proteins of the
          polyol pathway, which interconverts glucose and
          fructose. Sorbitol dehydrogenase is tetrameric and has
          a single catalytic zinc per subunit. Aldose reductase
          catalyzes the NADP(H)-dependent conversion of glucose
          to sorbital, and SDH uses NAD(H) in the conversion of
          sorbitol to fructose.  NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones.
          The medium chain alcohol dehydrogenase family (MDR)
          have a NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit.
          Length = 343

 Score = 47.1 bits (113), Expect = 4e-08
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P +LG E +G V  VG GV H KVGD+V
Sbjct: 55 PMVLGHESAGTVVAVGSGVTHLKVGDRV 82


>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family.  This
          group contains members identified as related to
          zinc-dependent alcohol dehydrogenase and other members
          of the MDR family. The medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, which contains the
          zinc-dependent alcohol dehydrogenase (ADH-Zn) and
          related proteins, is a diverse group of proteins
          related to the first identified member, class I
          mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          includes various activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 337

 Score = 46.8 bits (112), Expect = 5e-08
 Identities = 24/58 (41%), Positives = 29/58 (50%), Gaps = 12/58 (20%)

Query: 3  AGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           G NP  +Y            P ILG E+SG V EVG+GV   KVGD+V   P +  G
Sbjct: 45 HGRNPFASY------------PRILGHELSGEVVEVGEGVAGLKVGDRVVVDPYISCG 90


>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase.  This
          group contains arabinose dehydrogenase (AraDH) and
          related alcohol dehydrogenases. AraDH is a member of
          the medium chain dehydrogenase/reductase family and
          catalyzes the NAD(P)-dependent oxidation of D-arabinose
          and other pentoses, the initial step in the metabolism
          of d-arabinose into 2-oxoglutarate. Like the alcohol
          dehydrogenases, AraDH binds a zinc in the catalytic
          cleft as well as a distal structural zinc. AraDH forms
          homotetramers as a dimer of dimers. AraDH replaces a
          conserved catalytic His with replace with Arg, compared
          to the canonical ADH site. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones. 
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation.  ADH
          is a member of the medium chain alcohol dehydrogenase
          family (MDR), which has a NAD(P)(H)-binding domain in a
          Rossmann fold of a beta-alpha form. The NAD(H)-binding
          region is comprised of 2 structurally similar halves,
          each of which contacts a mononucleotide.  A GxGxxG
          motif after the first mononucleotide contact half
          allows the close contact of the coenzyme with the ADH
          backbone.  The N-terminal catalytic domain has a
          distant homology to GroES.  These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit, a catalytic zinc at the active
          site and a structural zinc in a lobe of the catalytic
          domain.  NAD(H) binding occurs in the cleft between the
          catalytic and coenzyme-binding domains at the active
          site, and coenzyme binding induces a conformational
          closing of this cleft. Coenzyme binding typically
          precedes and contributes to substrate binding. In human
          ADH catalysis, the zinc ion helps coordinate the
          alcohol, followed by deprotonation of a histidine, the
          ribose of NAD, a serine, then the alcohol, which allows
          the transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 340

 Score = 46.8 bits (112), Expect = 5e-08
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 12 IRSGQYPNL--PDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          +  G +  +    LP  LG E +G VEEVG GV   K GD V
Sbjct: 44 VIDGVWGGILPYKLPFTLGHENAGWVEEVGSGVDGLKEGDPV 85


>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General
          function prediction only].
          Length = 339

 Score = 46.0 bits (110), Expect = 8e-08
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15 GQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          G +P    LP I G E+ G V EVG+GV   KVGD+V
Sbjct: 50 GDWPVPK-LPLIPGHEIVGTVVEVGEGVTGLKVGDRV 85


>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR).  2-enoyl
          thioester reductase (ETR) catalyzes the NADPH-dependent
          conversion of trans-2-enoyl acyl carrier
          protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty
          acid synthesis. 2-enoyl thioester reductase activity
          has been linked in  Candida tropicalis as essential in
          maintaining mitiochondrial respiratory function. This
          ETR family is a part of the medium chain
          dehydrogenase/reductase family, but lack the zinc
          coordination sites characteristic of the alcohol
          dehydrogenases in this family. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones. 
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation. 
          ADH is a member of the medium chain alcohol
          dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  The N-terminal catalytic
          domain has a distant homology to GroES. These proteins
          typically form dimers (typically higher plants,
          mammals) or tetramers (yeast, bacteria), and have 2
          tightly bound zinc atoms per subunit, a catalytic zinc
          at the active site, and a structural zinc in a lobe of
          the catalytic domain.  NAD(H) binding occurs in the
          cleft between the catalytic and coenzyme-binding
          domains, at the active site, and coenzyme binding
          induces a conformational closing of this cleft.
          Coenzyme binding typically precedes and contributes to
          substrate binding. Candida tropicalis enoyl thioester
          reductase (Etr1p) catalyzes the NADPH-dependent
          reduction of trans-2-enoyl thioesters in mitochondrial
          fatty acid synthesis. Etr1p forms homodimers, with each
          subunit containing a nucleotide-binding Rossmann fold
          domain and a catalytic domain.
          Length = 341

 Score = 44.9 bits (107), Expect = 2e-07
 Identities = 27/63 (42%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 1  MAAGINPVETYIRSGQYPNLP----DLPAILGTEVSGIVEEVGQGVKHFKVGDKVF-GKP 55
          +AA INP +     G YP  P    + PA+ G E  G V +VG GVK  K GD V   +P
Sbjct: 37 LAAPINPADINQIQGVYPIKPPTTPEPPAVGGNEGVGEVVKVGSGVKSLKPGDWVIPLRP 96

Query: 56 ILG 58
           LG
Sbjct: 97 GLG 99


>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  There are 7 vertebrate ADH 7
          classes, 6 of which have been identified in humans.
          Class III, glutathione-dependent formaldehyde
          dehydrogenase, has been identified as the primordial
          form and exists in diverse species, including plants,
          micro-organisms, vertebrates, and invertebrates. Class
          I, typified by  liver dehydrogenase, is an evolving
          form. Gene duplication and functional specialization of
          ADH into ADH classes and subclasses created numerous
          forms in vertebrates.  For example, the A, B and C
          (formerly alpha, beta, gamma) human class I subunits
          have high overall structural similarity, but differ in
          the substrate binding pocket and therefore in substrate
          specificity. In human ADH catalysis, the zinc ion helps
          coordinate the alcohol, followed by deprotonation of  a
          histidine (His-51), the ribose of NAD,  a serine
          (Ser-48) , then the alcohol, which allows the transfer
          of a hydride to NAD+, creating NADH and a zinc-bound
          aldehyde or ketone. In yeast and some bacteria, the
          active site zinc binds an aldehyde, polarizing it, and
          leading to the reverse reaction. ADH is a member of the
          medium chain alcohol dehydrogenase family (MDR), which
          has a NAD(P)(H)-binding domain in a Rossmann fold of an
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  A GxGxxG motif after the
          first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology  to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.
          Length = 365

 Score = 45.0 bits (107), Expect = 2e-07
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 1  MAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          +A  +   +     G        P ILG E +GIVE VG+GV + K GDKV
Sbjct: 35 LATSVCHTDILAIEGFKA--TLFPVILGHEGAGIVESVGEGVTNLKPGDKV 83


>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional.
          Length = 334

 Score = 44.6 bits (106), Expect = 3e-07
 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 15 GQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFG 53
          G YP +   P ILG EV G VEEVG+ VK FK GD+V  
Sbjct: 47 GFYPRM-KYPVILGHEVVGTVEEVGENVKGFKPGDRVAS 84


>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase.  Polyketide
          synthases produce polyketides in step by step mechanism
          that is similar to fatty acid synthesis. Enoyl
          reductase reduces a double to single bond. Erythromycin
          is one example of a polyketide generated by 3 complex
          enzymes (megasynthases). 2-enoyl thioester reductase
          (ETR) catalyzes the NADPH-dependent dependent
          conversion of trans-2-enoyl acyl carrier
          protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty
          acid synthesis. 2-enoyl thioester reductase activity
          has been linked in  Candida tropicalis as essential in
          maintaining mitiochondrial respiratory function. This
          ETR family is a part of the medium chain
          dehydrogenase/reductase family, but lack the zinc
          coordination sites characteristic of the alcohol
          dehydrogenases in this family. NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes, or ketones.
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation.  ADH
          is a member of the medium chain alcohol dehydrogenase
          family (MDR), which have a NAD(P)(H)-binding domain in
          a Rossmann fold of a beta-alpha form.  The
          NAD(H)-binding region is comprised of 2 structurally
          similar halves, each of which contacts a
          mononucleotide. The N-terminal catalytic domain has a
          distant homology to GroES. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit, a catalytic zinc at the active
          site, and a structural zinc in a lobe of the catalytic
          domain. NAD(H)-binding occurs in the cleft between the
          catalytic and coenzyme-binding domains at the active
          site, and coenzyme binding induces a conformational
          closing of this cleft. Coenzyme binding typically
          precedes and contributes to substrate binding.
          Length = 303

 Score = 44.3 bits (105), Expect = 3e-07
 Identities = 17/37 (45%), Positives = 20/37 (54%)

Query: 15 GQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          G YP +P  P   G E SG+V  VG  V    VGD+V
Sbjct: 29 GLYPTMPPYPFTPGFEASGVVRAVGPHVTRLAVGDEV 65


>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group is a member of the medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, but lacks the zinc-binding
          sites of the zinc-dependent alcohol dehydrogenases. The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 325

 Score = 44.6 bits (106), Expect = 3e-07
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
          AAG+NPV+  + +   P     P + G + +G+V  VG  V  +KVGD+V     L +GG
Sbjct: 36 AAGLNPVDWKVIAWGPPA-WSYPHVPGVDGAGVVVAVGAKVTGWKVGDRVAYHASLARGG 94


>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  There are 7 vertebrate ADH 7
          classes, 6 of which have been identified in humans.
          Class III, glutathione-dependent formaldehyde
          dehydrogenase, has been identified as the primordial
          form and exists in diverse species, including plants,
          micro-organisms, vertebrates, and invertebrates. Class
          I, typified by  liver dehydrogenase, is an evolving
          form. Gene duplication and functional specialization of
          ADH into ADH classes and subclasses created numerous
          forms in vertebrates.  For example, the A, B and C
          (formerly alpha, beta, gamma) human class I subunits
          have high overall structural similarity, but differ in
          the substrate binding pocket and therefore in substrate
          specificity.  In human ADH catalysis, the zinc ion
          helps coordinate the alcohol, followed by deprotonation
          of  a histidine (His-51), the ribose of NAD,  a serine
          (Ser-48) , then the alcohol, which allows the transfer
          of a hydride to NAD+, creating NADH and a zinc-bound
          aldehyde or ketone. In yeast and some bacteria, the
          active site zinc binds an aldehyde, polarizing it, and
          leading to the reverse reaction. ADH is a member of the
          medium chain alcohol dehydrogenase family (MDR), which
          has a NAD(P)(H)-binding domain in a Rossmann fold of an
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  A GxGxxG motif after the
          first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology  to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H)  binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.
          Length = 369

 Score = 44.6 bits (106), Expect = 3e-07
 Identities = 18/32 (56%), Positives = 20/32 (62%)

Query: 20 LPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           P  P ILG E +GIVE VG+GV   K GD V
Sbjct: 53 TPLFPRILGHEAAGIVESVGEGVTDLKPGDHV 84


>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with
           the periplasmic membrane in yeast.  This group contains
           members identified in targeting of yeast membrane
           proteins ATPase. AST1 is a cytoplasmic protein
           associated with the periplasmic membrane in yeast,
           identified as a multicopy suppressor of pma1 mutants
           which cause temperature sensitive growth arrest due to
           the inability of ATPase to target to the cell surface.
           This family is homologous to the medium chain family of
           dehydrogenases and reductases. Medium chain
           dehydrogenases/reductase (MDR)/zinc-dependent alcohol
           dehydrogenase-like family, which contains the
           zinc-dependent alcohol dehydrogenase (ADH-Zn) and
           related proteins, is a diverse group of proteins related
           to the first identified member, class I mammalian ADH.
           MDRs display a broad range of activities and are
           distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of an
           beta-alpha form and an N-terminal catalytic domain with
           distant homology to GroES.
          Length = 352

 Score = 44.2 bits (105), Expect = 4e-07
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 2   AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKH-FKVGDKVFG---KPIL 57
           AA +NPV+  + +    +       LG + SG++ +VG  V   +KVGD+V G    P  
Sbjct: 37  AAALNPVDLKLYNSYTFHFKVKEKGLGRDYSGVIVKVGSNVASEWKVGDEVCGIYPHPYG 96

Query: 58  GKGGYSQ 64
           G+G  SQ
Sbjct: 97  GQGTLSQ 103


>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family.  This
           group resembles the zinc-dependent alcohol dehydrogenase
           and has the catalytic and structural zinc-binding sites
           characteristic of this group. The medium chain
           dehydrogenases/reductase (MDR)/zinc-dependent alcohol
           dehydrogenase-like family, which contains the
           zinc-dependent alcohol dehydrogenase (ADH-Zn) and
           related proteins, is a diverse group of proteins related
           to the first identified member, class I mammalian ADH.
           MDRs display a broad range of activities and are
           distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of a
           beta-alpha form and an N-terminal catalytic domain with
           distant homology  to GroES.  The MDR group contains a
           host of activities, including the founding alcohol
           dehydrogenase (ADH), quinone reductase, sorbitol
           dehydrogenase, formaldehyde dehydrogenase, butanediol
           DH, ketose reductase, cinnamyl reductase, and numerous
           others. The zinc-dependent alcohol dehydrogenases (ADHs)
           catalyze the  NAD(P)(H)-dependent interconversion of
           alcohols to aldehydes or ketones.  Active site zinc has
           a catalytic role, while structural zinc aids in
           stability.  ADH-like proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and generally have 2 tightly bound zinc atoms
           per subunit. The active site zinc is coordinated by a
           histidine, two cysteines, and a water molecule. The
           second zinc seems to play a structural role, affects
           subunit interactions, and is typically coordinated by 4
           cysteines. Other MDR members have only a catalytic zinc,
           and some contain no coordinated zinc.
          Length = 384

 Score = 43.7 bits (103), Expect = 6e-07
 Identities = 17/41 (41%), Positives = 28/41 (68%)

Query: 17  YPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPIL 57
           YP L + P ++G E SG+VE+ G+ VK+F+ GD V  + ++
Sbjct: 81  YPGLTEFPVVIGHEFSGVVEKTGKNVKNFEKGDPVTAEEMM 121


>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. 
          Members identified as glutathione-dependent
          formaldehyde dehydrogenase(FDH), a member of the zinc
          dependent/medium chain alcohol dehydrogenase family.
          FDH converts formaldehyde and NAD(P) to formate and
          NAD(P)H. The initial step in this process the
          spontaneous formation of a S-(hydroxymethyl)glutathione
          adduct from formaldehyde and glutathione, followed by
          FDH-mediated oxidation (and detoxification) of the
          adduct to S-formylglutathione.  MDH family uses NAD(H)
          as a cofactor in the interconversion of alcohols and
          aldehydes or ketones. Like many zinc-dependent alcohol
          dehydrogenases (ADH) of the medium chain alcohol
          dehydrogenase/reductase family (MDR), these FDHs form
          dimers, with 4 zinc ions per dimer. The medium chain
          alcohol dehydrogenase family (MDR) have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.   ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  A GxGxxG motif after the
          first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology  to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
           and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H)  binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding.
          Length = 368

 Score = 43.4 bits (103), Expect = 7e-07
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P ILG E +GIVE VG+GV   K GD V
Sbjct: 57 PVILGHEGAGIVESVGEGVTSVKPGDHV 84


>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like.
          This group is related to formaldehyde dehydrogenase
          (FDH), which  is a member of the zinc-dependent/medium
          chain alcohol dehydrogenase family.  This family uses
          NAD(H) as a cofactor in the interconversion of alcohols
          and aldehydes, or ketones. Another member is identified
          as a dihydroxyacetone reductase. Like the
          zinc-dependent alcohol dehydrogenases (ADH) of the
          medium chain alcohol dehydrogenase/reductase family
          (MDR), tetrameric FDHs have a catalytic zinc that
          resides between the catalytic and NAD(H)binding domains
          and a structural zinc in a lobe of the catalytic
          domain. Unlike ADH, where NAD(P)(H) acts as a cofactor,
          NADH in FDH is a tightly bound redox cofactor (similar
          to nicotinamide proteins). The medium chain alcohol
          dehydrogenase family (MDR) has a NAD(P)(H)-binding
          domain in a Rossmann fold of a beta-alpha form. The
          N-terminal region typically has an all-beta catalytic
          domain. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit.
          Length = 345

 Score = 43.4 bits (103), Expect = 8e-07
 Identities = 17/26 (65%), Positives = 20/26 (76%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          ILG E  G+VEEVG  V +FKVGD+V
Sbjct: 57 ILGHEGVGVVEEVGSAVTNFKVGDRV 82


>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD).  These
          alcohol dehydrogenases are related to the cinnamyl
          alcohol dehydrogenases (CAD), members of the medium
          chain dehydrogenase/reductase family.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones. Cinnamyl alcohol dehydrogenases
          (CAD) reduce cinnamaldehydes to cinnamyl alcohols in
          the last step of monolignal metabolism in plant cells
          walls. CAD binds 2 zinc ions and is NADPH- dependent.
          CAD family members are also found in non-plant species,
          e.g. in yeast where they have an aldehyde reductase
          activity. The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 341

 Score = 43.3 bits (103), Expect = 9e-07
 Identities = 19/40 (47%), Positives = 23/40 (57%)

Query: 12 IRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
             G +P  P LP I G E +G+V  VG GV   KVGD+V
Sbjct: 45 AALGDWPVKPKLPLIGGHEGAGVVVAVGPGVSGLKVGDRV 84


>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH,
          6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase,
          N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR
          family members.  This group contains enzymes of the
          zinc-dependent alcohol dehydrogenase family, including
          members (aka MDR) identified as
          6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase
          and N-benzyl-3-pyrrolidinol dehydrogenase.
          6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase
          catalyzes the conversion of
          6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to
          6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+.
          This group displays the characteristic catalytic and
          structural zinc sites of the zinc-dependent alcohol
          dehydrogenases. NAD(P)(H)-dependent oxidoreductases are
          the major enzymes in the interconversion of alcohols
          and aldehydes, or ketones.  Alcohol dehydrogenase in
          the liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation. ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide. A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone. The
          N-terminal catalytic domain has a distant homology to
          GroES. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain. NAD(H)-binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 338

 Score = 43.0 bits (102), Expect = 1e-06
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          AAG+   + +I  G  P L  LP  LG E++G V EVG GV +FKVGD+V
Sbjct: 35 AAGVCHSDLHILDGGVPTLTKLPLTLGHEIAGTVVEVGAGVTNFKVGDRV 84


>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde
          dehydrogenase related proteins, child 1.  Members
          identified as glutathione-dependent formaldehyde
          dehydrogenase(FDH), a member of the
          zinc-dependent/medium chain alcohol dehydrogenase
          family.  FDH converts formaldehyde and NAD(P) to
          formate and NAD(P)H. The initial step in this process
          the spontaneous formation of a
          S-(hydroxymethyl)glutathione adduct from formaldehyde
          and glutathione, followed by FDH-mediated oxidation
          (and detoxification) of the adduct to
          S-formylglutathione.  MDH family uses NAD(H) as a
          cofactor in the interconversion of alcohols and
          aldehydes, or ketones. Like many zinc-dependent alcohol
          dehydrogenases (ADH) of the medium chain alcohol
          dehydrogenase/reductase family (MDR), these FDHs form
          dimers, with 4 zinc ions per dimer. The medium chain
          alcohol dehydrogenase family (MDR) has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit.
          Length = 386

 Score = 42.9 bits (102), Expect = 1e-06
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 20 LPDLPA--ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          +P +    ILG E  G+VEEVG  V++ KVGD+V
Sbjct: 49 IPGMKKGDILGHEFMGVVEEVGPEVRNLKVGDRV 82


>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD).  These
          alcohol dehydrogenases are related to the cinnamyl
          alcohol dehydrogenases (CAD), members of the medium
          chain dehydrogenase/reductase family.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones. Cinnamyl alcohol dehydrogenases
          (CAD) reduce cinnamaldehydes to cinnamyl alcohols in
          the last step of monolignal metabolism in plant cells
          walls. CAD binds 2 zinc ions and is NADPH- dependent.
          CAD family members are also found in non-plant species,
          e.g. in yeast where they have an aldehyde reductase
          activity. The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 329

 Score = 42.6 bits (101), Expect = 1e-06
 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 15 GQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILG 58
          G  P  P LP I G E+ G VE VG GV  F VGD+V G P LG
Sbjct: 51 GDLPP-PKLPLIPGHEIVGRVEAVGPGVTRFSVGDRV-GVPWLG 92


>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR
          family members.  Includes Human Mgc45594 gene product
          of undetermined function. The medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, which contains the
          zinc-dependent alcohol dehydrogenase (ADH-Zn) and
          related proteins, is a diverse group of proteins
          related to the first identified member, class I
          mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR). The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.
          Length = 329

 Score = 42.2 bits (100), Expect = 2e-06
 Identities = 20/49 (40%), Positives = 24/49 (48%)

Query: 3  AGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           GIN  +    +G+Y      P   G E  G V  VG+GV  FKVGD V
Sbjct: 40 VGINASDINFTAGRYDPGVKPPFDCGFEGVGEVVAVGEGVTDFKVGDAV 88


>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family.  This
          model describes a clade within the family pfam00107 of
          zinc-binding dehydrogenases. The family pfam00107
          contains class III alcohol dehydrogenases, including
          enzymes designated S-(hydroxymethyl)glutathione
          dehydrogenase and NAD/mycothiol-dependent formaldehyde
          dehydrogenase. Members of the current family occur only
          in species that contain the very small protein
          mycofactocin (TIGR03969), a possible cofactor
          precursor, and radical SAM protein TIGR03962. We name
          this family for Rxyl_3153, where the lone member of the
          family co-clusters with these markers in Rubrobacter
          xylanophilus [Unknown function, Enzymes of unknown
          specificity].
          Length = 369

 Score = 42.3 bits (100), Expect = 2e-06
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A+G+   + ++ +G  P +P  P + G E +G+V +VG GV   K GD V
Sbjct: 35 ASGLCHSDEHLVTGDLP-MPRYPILGGHEGAGVVTKVGPGVTGVKPGDHV 83


>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase.  The enzyme
           modelled by This model is responsible for the conversion
           of crotonyl-CoA reductase to butyryl-CoA. In serine
           cycle methylotrophic bacteria this enzyme is involved in
           the process of acetyl-CoA to glyoxylate. In other
           bacteria the enzyme is used to produce butyrate for
           incorporation into polyketides such as tylosin from
           Streptomyces fradiae and coronatine from Pseudomonas
           syringae.
          Length = 398

 Score = 42.1 bits (99), Expect = 2e-06
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 1   MAAGIN----------PVETYIRSGQYPNLPDLP-AILGTEVSGIVEEVGQGVKHFKVGD 49
           MAAG+N          PV T     +     DLP  I+G++ SG+V  VG GV  +KVGD
Sbjct: 45  MAAGVNYNNVWAALGEPVST-FAFLRKYGKLDLPFHIIGSDASGVVWRVGPGVTRWKVGD 103

Query: 50  KV 51
           +V
Sbjct: 104 EV 105


>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones. This group has the
          characteristic catalytic and structural zinc sites of
          the zinc-dependent alcohol dehydrogenases.  Alcohol
          dehydrogenase in the liver converts ethanol and NAD+ to
          acetaldehyde and NADH, while in yeast and some other
          microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation. ADH
          is a member of the medium chain alcohol dehydrogenase
          family (MDR), which has a NAD(P)(H)-binding domain in a
          Rossmann fold of a beta-alpha form.  The NAD(H)-binding
          region is comprised of 2 structurally similar halves,
          each of which contacts a mononucleotide. A GxGxxG motif
          after the first mononucleotide contact half allows the
          close contact of the coenzyme with the ADH backbone.
          The N-terminal catalytic domain has a distant homology
          to GroES. These proteins typically form dimers
          (typically higher plants, mammals) or tetramers (yeast,
          bacteria), and have 2 tightly bound zinc atoms per
          subunit, a catalytic zinc at the active site and a
          structural zinc in a lobe of the catalytic domain.
          NAD(H)-binding occurs in the cleft between the
          catalytic  and coenzyme-binding domains at the active
          site, and coenzyme binding induces a conformational
          closing of this cleft. Coenzyme binding typically
          precedes and contributes to substrate binding. In human
          ADH catalysis, the zinc ion helps coordinate the
          alcohol, followed by deprotonation of  a histidine, the
          ribose of NAD, a serine, then the alcohol, which allows
          the transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 345

 Score = 42.2 bits (100), Expect = 2e-06
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 18 PNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
               LP + G E +G+V EVG+ V  ++VGD+V
Sbjct: 49 DPDVTLPHVPGHEFAGVVVEVGEDVSRWRVGDRV 82


>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase.
          Length = 364

 Score = 41.7 bits (98), Expect = 3e-06
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query: 24  PAILGTEVSGIVEEVGQGVKHFKVGDKVFGKP 55
           P ++G E +GI+EEVG  VKH  VGD+V  +P
Sbjct: 74  PMVIGHECAGIIEEVGSEVKHLVVGDRVALEP 105


>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD).  Cinnamyl
          alcohol dehydrogenases (CAD), members of the medium
          chain dehydrogenase/reductase family, reduce
          cinnamaldehydes to cinnamyl alcohols in the last step
          of monolignal metabolism in plant cells walls. CAD
          binds 2 zinc ions and is NADPH- dependent. CAD family
          members are also found in non-plant species, e.g. in
          yeast where they have an aldehyde reductase activity.
          The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins  typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 337

 Score = 41.3 bits (98), Expect = 4e-06
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P + G E+ GIV  VG  V  FKVGD+V
Sbjct: 54 PLVPGHEIVGIVVAVGSKVTKFKVGDRV 81


>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family.  This
          group shares the zinc coordination sites of the
          zinc-dependent alcohol dehydrogenases. The medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, which contains the
          zinc-dependent alcohol dehydrogenase (ADH-Zn) and
          related proteins, is a diverse group of proteins
          related to the first identified member, class I
          mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR). The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of an beta-alpha form and an N-terminal
          catalytic domain with distant homology to GroES.  The
          MDR group contains a host of activities, including the
          founding alcohol dehydrogenase (ADH), quinone
          reductase, sorbitol dehydrogenase, formaldehyde
          dehydrogenase, butanediol DH, ketose reductase,
          cinnamyl reductase, and numerous others. The
          zinc-dependent alcohol dehydrogenases (ADHs) catalyze
          the  NAD(P)(H)-dependent interconversion of alcohols to
          aldehydes or ketones.  Active site zinc has a catalytic
          role, while structural zinc aids in stability.
          ADH-like proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and generally have 2 tightly bound zinc atoms per
          subunit. The active site zinc is coordinated by a
          histidine, two cysteines, and a water molecule. The
          second zinc seems to play a structural role, affects
          subunit interactions, and is typically coordinated by 4
          cysteines.
          Length = 306

 Score = 41.5 bits (98), Expect = 4e-06
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 21 PDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           + P +LG E SG + EVG  V+ +KVGD+V
Sbjct: 53 VETPVVLGHEFSGTIVEVGPDVEGWKVGDRV 83


>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group is a member of the medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, but lacks the zinc-binding
          sites of the zinc-dependent alcohol dehydrogenases. The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 331

 Score = 41.5 bits (98), Expect = 4e-06
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
          A+G++  +  +R G YP+ P LP   G ++ G V+ +G GV  F+VGD+V     +  GG
Sbjct: 36 ASGVSFADVQMRRGLYPDQPPLPFTPGYDLVGRVDALGSGVTGFEVGDRVAALTRV--GG 93

Query: 62 YSQ 64
           ++
Sbjct: 94 NAE 96


>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated.
          Length = 341

 Score = 41.3 bits (98), Expect = 4e-06
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKVFG 53
          P ++G E  G V EVG  V  FKVGD+V G
Sbjct: 58 PMVVGHEFVGEVVEVGSEVTGFKVGDRVSG 87


>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD).
          Cinnamyl alcohol dehydrogenases (CAD), members of the
          medium chain dehydrogenase/reductase family, reduce
          cinnamaldehydes to cinnamyl alcohols in the last step
          of monolignal metabolism in plant cells walls. CAD
          binds 2 zinc ions and is NADPH- dependent. CAD family
          members are also found in non-plant species, e.g. in
          yeast where they have an aldehyde reductase activity.
          The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADHs), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 333

 Score = 40.3 bits (95), Expect = 9e-06
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A G+   + +++ G  P L   P + G EV G ++ VG+GV  +KVGD+V
Sbjct: 34 ACGVCHSDAFVKEGAMPGLS-YPRVPGHEVVGRIDAVGEGVSRWKVGDRV 82


>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating
          formaldehyde dehydrogenase (PFDH).  Formaldehyde
          dehydrogenase (FDH) is a member of the
          zinc-dependent/medium chain alcohol dehydrogenase
          family.  Unlike typical FDH, Pseudomonas putida
          aldehyde-dismutating FDH (PFDH) is
          glutathione-independent.  PFDH converts 2 molecules of
          aldehydes to corresponding carboxylic acid and alcohol.
           MDH family uses NAD(H) as a cofactor in the
          interconversion of alcohols and aldehydes, or ketones.
          Like the zinc-dependent alcohol dehydrogenases (ADH) of
          the medium chain alcohol dehydrogenase/reductase family
          (MDR), these tetrameric FDHs have a catalytic zinc that
          resides between the catalytic and NAD(H)binding domains
          and a structural zinc in a lobe of the catalytic
          domain. Unlike ADH, where NAD(P)(H) acts as a cofactor,
          NADH in FDH is a tightly bound redox cofactor (similar
          to nicotinamide proteins).  The medium chain alcohol
          dehydrogenase family (MDR) has a NAD(P)(H)-binding
          domain in a Rossmann fold of an beta-alpha form. The
          N-terminal region typically has an all-beta catalytic
          domain. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit.
          Length = 375

 Score = 40.3 bits (95), Expect = 9e-06
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 21 PDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           +   +LG E  G VEEVG  V+  KVGD+V
Sbjct: 51 AEPGLVLGHEAMGEVEEVGSAVESLKVGDRV 81


>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase.  Crotonyl-CoA
           reductase, a member of the medium chain
           dehydrogenase/reductase family, catalyzes the
           NADPH-dependent conversion of crotonyl-CoA to
           butyryl-CoA, a step in (2S)-methylmalonyl-CoA
           production for straight-chain fatty acid biosynthesis.
           Like enoyl reductase, another enzyme in fatty acid
           synthesis, crotonyl-CoA reductase is a member of the
           zinc-dependent alcohol dehydrogenase-like medium chain
           dehydrogenase/reductase family. The medium chain
           dehydrogenases/reductase (MDR)/zinc-dependent alcohol
           dehydrogenase-like family, which contains the
           zinc-dependent alcohol dehydrogenase (ADH-Zn) and
           related proteins, is a diverse group of proteins related
           to the first identified member, class I mammalian ADH.
           MDRs display a broad range of activities and are
           distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR). The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of a
           beta-alpha form and an N-terminal catalytic domain with
           distant homology to GroES.
          Length = 393

 Score = 40.5 bits (95), Expect = 1e-05
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 11/61 (18%)

Query: 1   MAAGIN----------PVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDK 50
           MAAG+N          PV T+    +         I G++ SGIV  VG+GVK++KVGD+
Sbjct: 50  MAAGVNYNNVWAALGEPVSTFAARQRRGRDEPY-HIGGSDASGIVWAVGEGVKNWKVGDE 108

Query: 51  V 51
           V
Sbjct: 109 V 109


>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase.  This protein is a
          tetrameric, zinc-binding, NAD-dependent enzyme of
          threonine catabolism. Closely related proteins include
          sorbitol dehydrogenase, xylitol dehydrogenase, and
          benzyl alcohol dehydrogenase. Eukaryotic examples of
          this enzyme have been demonstrated experimentally but
          do not appear in database search results.E. coli His-90
          modulates substrate specificity and is believed part of
          the active site [Energy metabolism, Amino acids and
          amines].
          Length = 340

 Score = 40.2 bits (94), Expect = 1e-05
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKVFGK 54
          P ++G EV+G V  +G GV+  KVGD V  +
Sbjct: 56 PQVVGHEVAGEVVGIGPGVEGIKVGDYVSVE 86


>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like.
          Length = 378

 Score = 39.9 bits (93), Expect = 1e-05
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 23 LPAILGTEVSGIVEEVGQGVKHFKVGDKVF 52
           P I G E SGIVE +G+GV  F+ GD V 
Sbjct: 63 FPRIFGHEASGIVESIGEGVTEFEKGDHVL 92


>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase.  L-idonate
          5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion
          of L-lodonate to 5-ketogluconate in the metabolism of
          L-Idonate to  6-P-gluconate. In E. coli, this GntII
          pathway is a subsidiary pathway to the canonical GntI
          system, which also phosphorylates and transports
          gluconate.  L-ido 5-DH is found in an operon with a
          regulator indR, transporter idnT, 5-keto-D-gluconate
          5-reductase, and Gnt kinase. L-ido 5-DH is a
          zinc-dependent alcohol dehydrogenase-like protein. The
          alcohol dehydrogenase ADH-like family of proteins is a
          diverse group of proteins related to the first
          identified member, class I mammalian ADH.  This group
          is also called the medium chain
          dehydrogenases/reductase family (MDR) which displays a
          broad range of activities and are distinguished from
          the smaller short chain dehydrogenases(~ 250 amino
          acids vs. the ~ 350 amino acids of the MDR).  The MDR
          proteins have 2 domains: a C-terminal NAD(P)
          binding-Rossmann fold domain of a beta-alpha form and
          an N-terminal GroES-like catalytic domain.  The MDR
          group contains a host of activities, including the
          founding alcohol dehydrogenase (ADH), quinone
          reductase, sorbitol dehydrogenase, formaldehyde
          dehydrogenase, butanediol DH, ketose reductase,
          cinnamyl reductase, and numerous others. The
          zinc-dependent alcohol dehydrogenases (ADHs) catalyze
          the NAD(P)(H)-dependent interconversion of alcohols to
          aldehydes or ketones. ADH-like proteins typically form
          dimers (typically higher plants, mammals) or tetramers
          (yeast, bacteria), and generally have 2 tightly bound
          zinc atoms per subunit. The active site zinc is
          coordinated by a histidine, two cysteines, and a water
          molecule. The second zinc seems to play a structural
          role, affects subunit interactions, and is typically
          coordinated by 4 cysteines.
          Length = 339

 Score = 39.5 bits (93), Expect = 2e-05
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P +LG EVSG+VE VG GV     G +V
Sbjct: 54 PMVLGHEVSGVVEAVGPGVTGLAPGQRV 81


>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione
          dehydrogenase/class III alcohol dehydrogenase.  The
          members of this protein family show dual function.
          First, they remove formaldehyde, a toxic metabolite, by
          acting as S-(hydroxymethyl)glutathione dehydrogenase
          (1.1.1.284). S-(hydroxymethyl)glutathione can form
          spontaneously from formaldehyde and glutathione, and so
          this enzyme previously was designated
          glutathione-dependent formaldehyde dehydrogenase. These
          same proteins are also designated alcohol dehydrogenase
          (EC 1.1.1.1) of class III, for activities that do not
          require glutathione; they tend to show poor activity
          for ethanol among their various substrate alcohols
          [Cellular processes, Detoxification, Energy metabolism,
          Fermentation].
          Length = 368

 Score = 39.4 bits (92), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          A G+   + +  SG  P     P ILG E +GIVE VG+GV   KVGD V
Sbjct: 35 ATGVCHTDAFTLSGADPE-GVFPVILGHEGAGIVEAVGEGVTSVKVGDHV 83


>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases.
          This group is predominated by atypical alcohol
          dehydrogenases; they exist as tetramers and exhibit
          specificity for NADP(H) as a cofactor in the
          interconversion of alcohols and aldehydes, or ketones. 
          Like other zinc-dependent alcohol dehydrogenases (ADH)
          of the medium chain alcohol dehydrogenase/reductase
          family (MDR), tetrameric ADHs have a catalytic zinc
          that resides between the catalytic and NAD(H)binding
          domains; however, they do not have and a structural
          zinc in a lobe of the catalytic domain.  The medium
          chain alcohol dehydrogenase family (MDR) has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit.
          Length = 351

 Score = 39.1 bits (92), Expect = 3e-05
 Identities = 17/26 (65%), Positives = 19/26 (73%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          ILG E  G+VEEVG  VK FK GD+V
Sbjct: 56 ILGHEAVGVVEEVGSEVKDFKPGDRV 81


>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related
          proteins.  Cinnamyl alcohol dehydrogenases (CAD),
          members of the medium chain dehydrogenase/reductase
          family, reduce cinnamaldehydes to cinnamyl alcohols in
          the last step of monolignal metabolism in plant cells
          walls. CAD binds 2 zinc ions and is NADPH- dependent.
          CAD family members are also found in non-plant species,
          e.g. in yeast where they have an aldehyde reductase
          activity. The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes, or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins  typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 330

 Score = 38.8 bits (91), Expect = 3e-05
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 15 GQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          G +      P + G E+ G V EVG GV+  KVGD+V
Sbjct: 46 GDWGGSK-YPLVPGHEIVGEVVEVGAGVEGRKVGDRV 81


>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases
          (ADH) and class III ADG (AKA formaldehyde
          dehydrogenase).  NAD(P)(H)-dependent oxidoreductases
          are the major enzymes in the interconversion of
          alcohols and aldehydes or ketones. This group contains
          members identified as zinc dependent alcohol
          dehydrogenases (ADH), and class III ADG (aka
          formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase
          in the liver converts ethanol and NAD+ to acetaldehyde
          and NADH, while in yeast and some other microorganisms
          ADH catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  NAD(P)(H)-dependent
          oxidoreductases are the major enzymes in the
          interconversion of alcohols and aldehydes or ketones.
          Alcohol dehydrogenase in the liver converts ethanol and
          NAD+ to acetaldehyde and NADH, while in yeast and some
          other microorganisms ADH catalyzes the conversion
          acetaldehyde to ethanol in alcoholic fermentation.
          Class III ADH are also know as glutathione-dependent
          formaldehyde dehydrogenase (FDH), which convert
          aldehydes to the corresponding carboxylic acid and
          alcohol.  ADH is a member of the medium chain alcohol
          dehydrogenase family (MDR), which have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The NAD(H)-binding region is comprised
          of 2 structurally similar halves, each of which
          contacts a mononucleotide.  A GxGxxG motif after the
          first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone. The
          N-terminal catalytic domain has a distant homology to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human  ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 371

 Score = 38.5 bits (90), Expect = 4e-05
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 22 DLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
           LP  LG E +G+V EVG+GV   +VGD V
Sbjct: 60 PLPMALGHEAAGVVVEVGEGVTDLEVGDHV 89


>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases.  Formaldehyde
          dehydrogenase (FDH) is a member of the
          zinc-dependent/medium chain alcohol dehydrogenase
          family.  Formaldehyde dehydrogenase (aka ADH3) may be
          the ancestral form of alcohol dehydrogenase, which
          evolved to detoxify formaldehyde.  This CD contains
          glutathione dependant FDH, glutathione independent FDH,
          and related alcohol dehydrogenases. FDH converts
          formaldehyde and NAD(P) to formate and NAD(P)H. The
          initial step in this process the spontaneous formation
          of a S-(hydroxymethyl)glutathione adduct from
          formaldehyde and glutathione, followed by FDH-mediated
          oxidation (and detoxification) of the adduct to
          S-formylglutathione. Unlike typical FDH, Pseudomonas
          putida aldehyde-dismutating FDH (PFDH) is
          glutathione-independent. The medium chain alcohol
          dehydrogenase family (MDR) have a NAD(P)(H)-binding
          domain in a Rossmann fold of a beta-alpha form. The
          N-terminal region typically has an all-beta catalytic
          domain. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit.
          Length = 347

 Score = 38.0 bits (89), Expect = 6e-05
 Identities = 15/26 (57%), Positives = 16/26 (61%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          ILG E  G V EVG  VK  K GD+V
Sbjct: 57 ILGHEFVGEVVEVGSDVKRLKPGDRV 82


>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase.  L-threonine dehydrogenase
          (TDH) catalyzes the zinc-dependent formation of
          2-amino-3-ketobutyrate from L-threonine via NAD(H)-
          dependent oxidation.  THD is a member of the
          zinc-requiring, medium chain NAD(H)-dependent alcohol
          dehydrogenase family (MDR). MDRs  have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. NAD(P)(H)-dependent oxidoreductases
          are the major enzymes in the interconversion of
          alcohols and aldehydes, or ketones. The N-terminal
          region typically has an all-beta catalytic domain.
          These proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria) and
          have 2 tightly bound zinc atoms per subunit. Sorbitol
          and aldose reductase are NAD(+) binding proteins of the
          polyol pathway, which interconverts glucose and
          fructose.
          Length = 341

 Score = 38.0 bits (89), Expect = 6e-05
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P I G E +G V EVG+GV   KVGD V
Sbjct: 58 PLIFGHEFAGEVVEVGEGVTRVKVGDYV 85


>gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like.
          Length = 381

 Score = 37.9 bits (88), Expect = 7e-05
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P ILG E +GIVE VG+GV+  K GD V
Sbjct: 66 PRILGHEAAGIVESVGEGVEDLKAGDHV 93


>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like,
          2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and
          other MDR family members.  This subgroup of the medium
          chain dehydrogenases/reductase (MDR)/zinc-dependent
          alcohol dehydrogenase-like family has members
          identified as 2-desacetyl-2-hydroxyethyl
          bacteriochlorophyllide A dehydrogenase and alcohol
          dehydrogenases. The medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, which contains the
          zinc-dependent alcohol dehydrogenase (ADH-Zn) and
          related proteins, is a diverse group of proteins
          related to the first identified member, class I
          mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.
          Length = 277

 Score = 37.6 bits (88), Expect = 9e-05
 Identities = 16/31 (51%), Positives = 17/31 (54%)

Query: 22 DLPAILGTEVSGIVEEVGQGVKHFKVGDKVF 52
           LP   G    G V EVG GV  FK GD+VF
Sbjct: 19 PLPLPPGYSSVGRVVEVGSGVTGFKPGDRVF 49


>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like.
          MDR/AHD-like proteins, including a protein annotated as
          a threonine dehydrogenase. L-threonine dehydrogenase
          (TDH) catalyzes the zinc-dependent formation of
          2-amino-3-ketobutyrate from L-threonine via
          NAD(H)-dependent oxidation. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Zinc-dependent ADHs are medium chain
          dehydrogenase/reductase type proteins (MDRs) and have a
          NAD(P)(H)-binding domain in a Rossmann fold of an
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. In addition to alcohol
          dehydrogenases, this group includes quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others.  These proteins typically form
          dimers (typically higher plants, mammals) or tetramers
          (yeast, bacteria), and generally have 2 tightly bound
          zinc atoms per subunit. The active site zinc is
          coordinated by a histidine, two cysteines, and a water
          molecule. The second zinc seems to play a structural
          role, affects subunit interactions, and is typically
          coordinated by 4 cysteines.
          Length = 339

 Score = 36.9 bits (86), Expect = 2e-04
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          I G E +G+V  VG GV HF+VGD+V
Sbjct: 57 IPGHEPAGVVVAVGPGVTHFRVGDRV 82


>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase
          (QOR).  NAD(P)(H)-dependent oxidoreductases are the
          major enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  The medium chain alcohol
          dehydrogenase family (MDR) have a NAD(P)(H)-binding
          domain in a Rossmann fold of a beta-alpha form. The
          N-terminal region typically has an all-beta catalytic
          domain. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit.
          Length = 320

 Score = 36.8 bits (86), Expect = 2e-04
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVF 52
          A G+N  E + R G  P++   P +LG E  G VEE   G   F  G +V 
Sbjct: 36 AFGLNRSEIFTRQGHSPSV-KFPRVLGIEAVGEVEEAPGG--TFTPGQRVA 83


>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family.
          NAD(P)(H)-dependent oxidoreductases are the major
          enzymes in the interconversion of alcohols and
          aldehydes, or ketones.   Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.  ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which have a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.   A GxGxxG motif after
          the first mononucleotide contact half allows the close
          contact of the coenzyme with the ADH backbone.  The
          N-terminal catalytic domain has a distant homology to
          GroES.  These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H)-binding
          occurs in the cleft between the catalytic  and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. In human ADH
          catalysis, the zinc ion helps coordinate the alcohol,
          followed by deprotonation of  a histidine, the ribose
          of NAD, a serine, then the alcohol, which allows the
          transfer of a hydride to NAD+, creating NADH and a
          zinc-bound aldehyde or ketone. In yeast and some
          bacteria, the active site zinc binds an aldehyde,
          polarizing it, and leading to the reverse reaction.
          Length = 367

 Score = 36.6 bits (85), Expect = 2e-04
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 24 PAILGTEVSGIVEEVGQGVKH---FKVGDKVFG 53
          P +LG E+SG V EVG  V++     VGD+V G
Sbjct: 54 PFVLGHEISGEVVEVGPNVENPYGLSVGDRVVG 86


>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family.  The
          medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.
          Length = 312

 Score = 36.2 bits (84), Expect = 3e-04
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 21 PDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKGGYSQ 64
          P  P   G E  G V  +G GV+   VGD+V G   L  G +++
Sbjct: 49 PAEPGGPGHEGWGRVVALGPGVRGLAVGDRVAG---LSGGAFAE 89


>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde
          dehydrogenase related proteins, child 2.
          Glutathione-dependent formaldehyde dehydrogenases
          (FDHs) are members of the zinc-dependent/medium chain
          alcohol dehydrogenase family. Formaldehyde
          dehydrogenase (FDH) is a member of the
          zinc-dependent/medium chain alcohol dehydrogenase
          family.  FDH converts formaldehyde and NAD to formate
          and NADH. The initial step in this process the
          spontaneous formation of a S-(hydroxymethyl)glutathione
          adduct from formaldehyde and glutathione, followed by
          FDH-mediated oxidation (and detoxification) of the
          adduct to S-formylglutathione.   These tetrameric FDHs
          have a catalytic zinc that resides between the
          catalytic and NAD(H)binding domains and a structural
          zinc in a lobe of the catalytic domain. The medium
          chain alcohol dehydrogenase family (MDR) has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form. The N-terminal region typically has an
          all-beta catalytic domain. These proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and have 2 tightly bound
          zinc atoms per subunit.
          Length = 344

 Score = 35.7 bits (83), Expect = 4e-04
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 21 PDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
               +LG E  G V EVG  V+  KVGD+V
Sbjct: 51 STPGFVLGHEFVGEVVEVGPEVRTLKVGDRV 81


>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol
          dehydrogenase.  Members of this protein family are
          mycothiol-dependent formaldehyde dehydrogenase (EC
          1.2.1.66). This protein is found, so far, only in the
          Actinobacteria (Mycobacterium sp., Streptomyces sp.,
          Corynebacterium sp., and related species), where
          mycothione replaces glutathione [Cellular processes,
          Detoxification].
          Length = 358

 Score = 35.9 bits (83), Expect = 4e-04
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 22 DLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          + P +LG E +G+VE VG+GV     GD V
Sbjct: 53 EFPFLLGHEAAGVVEAVGEGVTDVAPGDYV 82


>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent
          dehydrogenases [Amino acid transport and metabolism /
          General function prediction only].
          Length = 350

 Score = 35.4 bits (82), Expect = 6e-04
 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 15 GQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          G  P +P    ILG E  G V EVG  V+ FKVGD+V
Sbjct: 47 GGEPFVPPGDIILGHEFVGEVVEVGV-VRGFKVGDRV 82


>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate
           dehydrogenase.  6-hydroxyhexanoate dehydrogenase, an
           enzyme of the zinc-dependent alcohol dehydrogenase-like
           family of medium chain dehydrogenases/reductases
           catalyzes the conversion of 6-hydroxyhexanoate and
           NAD(+) to 6-oxohexanoate + NADH and H+.
           NAD(P)(H)-dependent oxidoreductases are the major
           enzymes in the interconversion of alcohols and
           aldehydes, or ketones.  Alcohol dehydrogenase in the
           liver converts ethanol and NAD+ to acetaldehyde and
           NADH, while in yeast and some other microorganisms ADH
           catalyzes the conversion acetaldehyde to ethanol in
           alcoholic fermentation.  ADH is a member of the medium
           chain alcohol dehydrogenase family (MDR), which has a
           NAD(P)(H)-binding domain in a Rossmann fold of a
           beta-alpha form.  The NAD(H)-binding region is comprised
           of 2 structurally similar halves, each of which contacts
           a mononucleotide.  A GxGxxG motif after the first
           mononucleotide contact half allows the close contact of
           the coenzyme with the ADH backbone.  The N-terminal
           catalytic domain has a distant homology to GroES.  These
           proteins typically form dimers (typically higher plants,
           mammals) or tetramers (yeast, bacteria), and have 2
           tightly bound zinc atoms per subunit, a catalytic zinc
           at the active site and a structural zinc in a lobe of
           the catalytic domain.  NAD(H)-binding occurs in the
           cleft between the catalytic  and coenzyme-binding
           domains, at the active site, and coenzyme binding
           induces a conformational closing of this cleft. Coenzyme
           binding typically precedes and contributes to substrate
           binding. In human ADH catalysis, the zinc ion helps
           coordinate the alcohol, followed by deprotonation of a
           histidine, the ribose of NAD, a serine, then the
           alcohol, which allows the transfer of a hydride to NAD+,
           creating NADH and a zinc-bound aldehyde or ketone. In
           yeast and some bacteria, the active site zinc binds an
           aldehyde, polarizing it, and leading to the reverse
           reaction.
          Length = 350

 Score = 35.3 bits (82), Expect = 6e-04
 Identities = 18/38 (47%), Positives = 21/38 (55%)

Query: 23  LPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
           LP +LG E+ G V  VG      KVGDKV   P +G G
Sbjct: 66  LPLVLGHEIVGEVVAVGPDAADVKVGDKVLVYPWIGCG 103


>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase.
          Length = 360

 Score = 34.5 bits (79), Expect = 0.001
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P + G E+ GIV ++G+ VK FK GD+V
Sbjct: 67 PIVPGHEIVGIVTKLGKNVKKFKEGDRV 94


>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active
          dehydrogenase/acetaldehyde-active reductase;
          Provisional.
          Length = 338

 Score = 34.6 bits (80), Expect = 0.001
 Identities = 17/26 (65%), Positives = 19/26 (73%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          ILG E  GIV+EVG GV   KVGD+V
Sbjct: 56 ILGHEGIGIVKEVGPGVTSLKVGDRV 81


>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone
           oxidoreductases.  Yhdh and yhfp-like putative quinone
           oxidoreductases (QOR). QOR catalyzes the conversion of a
           quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones
           are cyclic diones derived from aromatic compounds.
           Membrane bound QOR actin the respiratory chains of
           bacteria and mitochondria, while soluble QOR acts to
           protect from toxic quinones (e.g. DT-diaphorase) or as a
           soluble eye-lens protein in some vertebrates (e.g.
           zeta-crystalin). QOR reduces quinones through a
           semi-quinone intermediate via a NAD(P)H-dependent single
           electron transfer. QOR is a member of the medium chain
           dehydrogenase/reductase family, but lacks the
           zinc-binding sites of the prototypical alcohol
           dehydrogenases of this group.  NAD(P)(H)-dependent
           oxidoreductases are the major enzymes in the
           interconversion of alcohols and aldehydes, or ketones.
           Alcohol dehydrogenase in the liver converts ethanol and
           NAD+ to acetaldehyde and NADH, while in yeast and some
           other microorganisms ADH catalyzes the conversion
           acetaldehyde to ethanol in alcoholic fermentation.  ADH
           is a member of the medium chain alcohol dehydrogenase
           family (MDR), which has a NAD(P)(H)-binding domain in a
           Rossmann fold of a beta-alpha form.  The NAD(H)-binding
           region is comprised of 2 structurally similar halves,
           each of which contacts a mononucleotide.  A GxGxxG motif
           after the first mononucleotide contact half allows the
           close contact of the coenzyme with the ADH backbone.
           The N-terminal catalytic domain has a distant homology
           to GroES. These proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and have 2 tightly bound zinc atoms per
           subunit, a catalytic zinc at the active site and a
           structural zinc in a lobe of the catalytic domain.
           NAD(H) binding occurs in the cleft between the catalytic
           and coenzyme-binding domains at the active site, and
           coenzyme binding induces a conformational closing of
           this cleft. Coenzyme binding typically precedes and
           contributes to substrate binding. In human ADH
           catalysis, the zinc ion helps coordinate the alcohol,
           followed by deprotonation of  a histidine, the ribose of
           NAD, a serine, then the alcohol, which allows the
           transfer of a hydride to NAD+, creating NADH and a
           zinc-bound aldehyde or ketone. In yeast and some
           bacteria, the active site zinc binds an aldehyde,
           polarizing it, and leading to the reverse reaction.
          Length = 325

 Score = 34.1 bits (79), Expect = 0.001
 Identities = 12/66 (18%), Positives = 26/66 (39%), Gaps = 6/66 (9%)

Query: 3   AGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKV----FGKPILG 58
           + +N  +    +G      + P   G + +G V         F+ GD+V    +   +  
Sbjct: 37  SSLNYKDALAATGNGGVTRNYPHTPGIDAAGTVVSSDDP--RFREGDEVLVTGYDLGMNT 94

Query: 59  KGGYSQ 64
            GG+++
Sbjct: 95  DGGFAE 100


>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like.
          This group contains proteins identified as alcohol
          dehydrogenases and glutathione-dependant formaldehyde
          dehydrogenases (FDH) of the zinc-dependent/medium chain
          alcohol dehydrogenase family.  The MDR family uses
          NAD(H) as a cofactor in the interconversion of alcohols
          and aldehydes, or ketones.  FDH converts formaldehyde
          and NAD to formate and NADH. The initial step in this
          process the spontaneous formation of a
          S-(hydroxymethyl)glutathione adduct from formaldehyde
          and glutathione, followed by FDH-mediated oxidation
          (and detoxification) of the adduct to
          S-formylglutathione. The medium chain alcohol
          dehydrogenase family (MDR) has a NAD(P)(H)-binding
          domain in a Rossmann fold of a beta-alpha form. The
          N-terminal region typically has an all-beta catalytic
          domain. These proteins typically form dimers (typically
          higher plants, mammals) or tetramers (yeast, bacteria),
          and have 2 tightly bound zinc atoms per subunit.
          Length = 345

 Score = 33.8 bits (78), Expect = 0.002
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKVFG 53
          PA +G E  G+VEEVG  V   K GD V  
Sbjct: 54 PAPIGHEFVGVVEEVGSEVTSVKPGDFVIA 83


>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional.
          Length = 339

 Score = 33.2 bits (76), Expect = 0.004
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 3  AGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILGKG 60
          AGI   +++I  G  P     P ++G E  G+++ VG+GV   ++G++V   P++  G
Sbjct: 34 AGICGSDSHIYRGHNP-FAKYPRVIGHEFFGVIDAVGEGVDAARIGERVAVDPVISCG 90


>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase.
          Length = 357

 Score = 32.5 bits (74), Expect = 0.005
 Identities = 15/28 (53%), Positives = 16/28 (57%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKV 51
          P + G EV G V EVG  V  F VGD V
Sbjct: 64 PMVPGHEVVGEVVEVGSDVSKFTVGDIV 91


>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase;
          Provisional.
          Length = 347

 Score = 32.1 bits (73), Expect = 0.007
 Identities = 17/34 (50%), Positives = 18/34 (52%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPIL 57
          P  LG E SG VE VG GV     GD V   P+L
Sbjct: 54 PITLGHEFSGYVEAVGSGVDDLHPGDAVACVPLL 87


>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like
          proteins, child 1.  2-enoyl thioester reductase (ETR)
          like proteins. ETR catalyzes the NADPH-dependent
          conversion of trans-2-enoyl acyl carrier
          protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty
          acid synthesis. 2-enoyl thioester reductase activity
          has been linked in Candida tropicalis as essential in
          maintaining mitiochondrial respiratory function. This
          ETR family is a part of the medium chain
          dehydrogenase/reductase family, but lack the zinc
          coordination sites characteristic of the 2-enoyl
          thioester reductase (ETR) like proteins. ETR catalyzes
          the NADPH-dependent dependent conversion of
          trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA)
          to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl
          thioester reductase activity has been linked in
          Candida tropicalis as essential in maintaining
          mitiochondrial respiratory function. This ETR family is
          a part of the medium chain dehydrogenase/reductase
          family, but lack the zinc coordination sites
          characteristic of the alcohol dehydrogenases in this
          family. NAD(P)(H)-dependent oxidoreductases are the
          major enzymes in the interconversion of alcohols and
          aldehydes, or ketones.  Alcohol dehydrogenase in the
          liver converts ethanol and NAD+ to acetaldehyde and
          NADH, while in yeast and some other microorganisms ADH
          catalyzes the conversion acetaldehyde to ethanol in
          alcoholic fermentation.   ADH is a member of the medium
          chain alcohol dehydrogenase family (MDR), which has a
          NAD(P)(H)-binding domain in a Rossmann fold of a
          beta-alpha form.  The NAD(H)-binding region is
          comprised of 2 structurally similar halves, each of
          which contacts a mononucleotide.  The N-terminal
          catalytic domain has a distant homology to GroES.
          These proteins typically form dimers (typically higher
          plants, mammals) or tetramers (yeast, bacteria), and
          have 2 tightly bound zinc atoms per subunit, a
          catalytic zinc at the active site and a structural zinc
          in a lobe of the catalytic domain.  NAD(H) binding
          occurs in the cleft between the catalytic and
          coenzyme-binding domains at the active site, and
          coenzyme binding induces a conformational closing of
          this cleft. Coenzyme binding typically precedes and
          contributes to substrate binding. Candida tropicalis
          enoyl thioester reductase (Etr1p) catalyzes the
          NADPH-dependent reduction of trans-2-enoyl thioesters
          in mitochondrial fatty acid synthesis. Etr1p forms
          homodimers, with each subunit containing a
          nucleotide-binding Rossmann fold domain and a catalytic
          domain.
          Length = 324

 Score = 32.2 bits (74), Expect = 0.008
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHF-KVGDKV 51
          AA INP +     GQY +   LP   G E SG V   G G      +G +V
Sbjct: 39 AAPINPSDLGFLKGQYGSTKALPVPPGFEGSGTVVAAGGGPLAQSLIGKRV 89


>gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase.
          Length = 375

 Score = 30.8 bits (69), Expect = 0.027
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 24 PAILGTEVSGIVEEVGQGVKHFKVGDKVFGKPILG 58
          P I G E+ GI  +VG+ V  FK GD+V    I+G
Sbjct: 61 PIIPGHEIVGIATKVGKNVTKFKEGDRVGVGVIIG 95


>gnl|CDD|235409 PRK05325, PRK05325, hypothetical protein; Provisional.
          Length = 401

 Score = 29.0 bits (66), Expect = 0.091
 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%)

Query: 36 EEVGQGVKHFKVGDKVFGKPILGKGG 61
          E VG G   F VGD++ G+P  G GG
Sbjct: 60 EGVGPGNGEFVVGDRI-GRPQGGGGG 84


>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles
          the zinc-dependent alcohol dehydrogenases (ADH).  This
          group contains the hypothetical TM0436 alcohol
          dehydrogenase from Thermotoga maritima,  proteins
          annotated as 5-exo-alcohol dehydrogenase, and other
          members of the medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           MDR, which contains the zinc-dependent alcohol
          dehydrogenase (ADH-Zn) and related proteins, is a
          diverse group of proteins related to the first
          identified member, class I mammalian ADH.  MDRs display
          a broad range of activities and are distinguished from
          the smaller short chain dehydrogenases (~ 250 amino
          acids vs. the ~ 350 amino acids of the MDR).  The MDR
          proteins have 2 domains: a C-terminal NAD(P)
          binding-Rossmann fold domain of a beta-alpha form and
          an N-terminal catalytic domain with distant homology to
          GroES.  The MDR group contains a host of activities,
          including the founding alcohol dehydrogenase (ADH),
          quinone reductase, sorbitol dehydrogenase, formaldehyde
          dehydrogenase, butanediol DH, ketose reductase,
          cinnamyl reductase, and numerous others. The
          zinc-dependent alcohol dehydrogenases (ADHs) catalyze
          the NAD(P)(H)-dependent interconversion of alcohols to
          aldehydes or ketones. Active site zinc has a catalytic
          role, while structural zinc aids in stability.
          Length = 361

 Score = 29.1 bits (66), Expect = 0.092
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 7/44 (15%)

Query: 14 SGQYPNLPDLPAILGTEVSGIVEEVGQGV------KHFKVGDKV 51
          +G+ P +P LP ILG E  G V  +G GV      +  KVGD+V
Sbjct: 46 AGRRPRVP-LPIILGHEGVGRVVALGGGVTTDVAGEPLKVGDRV 88


>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase
           (MDR)/zinc-dependent alcohol dehydrogenase-like family. 
           This group is a member of the medium chain
           dehydrogenases/reductase (MDR)/zinc-dependent alcohol
           dehydrogenase-like family, but lacks the zinc-binding
           sites of the zinc-dependent alcohol dehydrogenases. The
           medium chain dehydrogenases/reductase
           (MDR)/zinc-dependent alcohol dehydrogenase-like family,
           which contains the zinc-dependent alcohol dehydrogenase
           (ADH-Zn) and related proteins, is a diverse group of
           proteins related to the first identified member, class I
           mammalian ADH.  MDRs display a broad range of activities
           and are distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P)-binding Rossmann fold domain of a
           beta-alpha form and an N-terminal catalytic domain with
           distant homology to GroES.  The MDR group contains a
           host of activities, including the founding alcohol
           dehydrogenase (ADH), quinone reductase, sorbitol
           dehydrogenase, formaldehyde dehydrogenase, butanediol
           DH, ketose reductase, cinnamyl reductase, and numerous
           others. The zinc-dependent alcohol dehydrogenases (ADHs)
           catalyze the  NAD(P)(H)-dependent interconversion of
           alcohols to aldehydes or ketones.  Active site zinc has
           a catalytic role, while structural zinc aids in
           stability.  ADH-like proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and generally have 2 tightly bound zinc atoms
           per subunit. The active site zinc is coordinated by a
           histidine, two cysteines, and a water molecule. The
           second zinc seems to play a structural role, affects
           subunit interactions, and is typically coordinated by 4
           cysteines.
          Length = 350

 Score = 27.3 bits (61), Expect = 0.40
 Identities = 17/69 (24%), Positives = 26/69 (37%), Gaps = 19/69 (27%)

Query: 2   AAGINPVETYIRSGQY-------------------PNLPDLPAILGTEVSGIVEEVGQGV 42
           A G+N  +   R G Y                         P I G ++ G V  VG+GV
Sbjct: 37  ACGVNNTDINTREGWYSTEVDGATDSTGAGEAGWWGGTLSFPRIQGADIVGRVVAVGEGV 96

Query: 43  KHFKVGDKV 51
              ++G++V
Sbjct: 97  DTARIGERV 105


>gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase.
           L-sorbose-1-phosphate reductase, a member of the MDR
           family, catalyzes the NADPH-dependent conversion of
           l-sorbose 1-phosphate to d-glucitol 6-phosphate in the
           metabolism of L-sorbose to  (also converts d-fructose
           1-phosphate to d-mannitol 6-phosphate).  The medium
           chain dehydrogenases/reductase (MDR)/zinc-dependent
           alcohol dehydrogenase-like family, which contains the
           zinc-dependent alcohol dehydrogenase (ADH-Zn) and
           related proteins, is a diverse group of proteins related
           to the first identified member, class I mammalian ADH.
           MDRs display a broad range of activities and are
           distinguished from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of an
           beta-alpha form and an N-terminal catalytic domain with
           distant homology to GroES.  The MDR group contains a
           host of activities, including the founding alcohol
           dehydrogenase (ADH), quinone reductase, sorbitol
           dehydrogenase, formaldehyde dehydrogenase, butanediol
           DH, ketose reductase, cinnamyl reductase, and numerous
           others. The zinc-dependent alcohol  dehydrogenases
           (ADHs) catalyze the  NAD(P)(H)-dependent interconversion
           of alcohols to aldehydes or ketones. Active site zinc
           has a catalytic role, while structural zinc aids in
           stability.
          Length = 410

 Score = 27.0 bits (60), Expect = 0.48
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 17  YPNLPDLPAILGTEVSGIVEEVGQGVKH-FKVGDKVFGKPILG-KGGYS 63
             +L   P ILG E +G + +VG+  +  +K G +   +P L    G S
Sbjct: 56  PNDLAKEPVILGHEFAGTILKVGKKWQGKYKPGQRFVIQPALILPDGPS 104


>gnl|CDD|236089 PRK07761, PRK07761, DNA polymerase III subunit beta; Validated.
          Length = 376

 Score = 27.1 bits (61), Expect = 0.50
 Identities = 11/23 (47%), Positives = 12/23 (52%), Gaps = 6/23 (26%)

Query: 7   PVETYIRSGQYPNLPDLPAILGT 29
           PVE       YP LP+LP   GT
Sbjct: 110 PVE------DYPTLPELPEATGT 126


>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase,
          glutathione-independent.  Members of this family
          represent a distinct clade within the larger family of
          zinc-dependent dehydrogenases of medium chain alcohols,
          a family that also includes the so-called
          glutathione-dependent formaldehyde dehydrogenase.
          Members of this protein family have a tightly bound NAD
          that can act as a true cofactor, rather than a
          cosubstrate in dehydrogenase reactions, in dismutase
          reactions for some aldehydes. The name given to this
          family, however, is formaldehyde dehydrogenase,
          glutathione-independent [Central intermediary
          metabolism, One-carbon metabolism].
          Length = 393

 Score = 26.7 bits (59), Expect = 0.64
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          +LG E++G V E G+ V+  K+GD V
Sbjct: 64 VLGHEITGEVIEKGRDVEFIKIGDIV 89


>gnl|CDD|225339 COG2718, COG2718, Uncharacterized conserved protein [Function
          unknown].
          Length = 423

 Score = 26.6 bits (59), Expect = 0.72
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 32 SGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
           G    VG G   F VGD++  +P  G GG
Sbjct: 69 GGERHHVGPGNDEFAVGDRI-ERPQGGGGG 97


>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family.
           This group contains members identified as related to
          zinc-dependent alcohol dehydrogenase and other members
          of the MDR family, including threonine dehydrogenase.
          The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          includes various activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.  ADH-like proteins typically
          form dimers (typically higher plants, mammals) or
          tetramers (yeast, bacteria), and generally have 2
          tightly bound zinc atoms per subunit. The active site
          zinc is coordinated by a histidine, two cysteines, and
          a water molecule. The second zinc seems to play a
          structural role, affects subunit interactions, and is
          typically coordinated by 4 cysteines.
          Length = 319

 Score = 26.4 bits (59), Expect = 0.78
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 4/40 (10%)

Query: 2  AAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQG 41
           AGI   +  I  G YP     P + G E  GIVEE  + 
Sbjct: 33 LAGICNTDLEIYKGYYP----FPGVPGHEFVGIVEEGPEA 68


>gnl|CDD|218005 pfam04285, DUF444, Protein of unknown function (DUF444).
          Bacterial protein of unknown function. One family
          member is predicted to contain a von Willebrand factor
          (vWF) type A domain (Smart:VWA).
          Length = 421

 Score = 26.3 bits (58), Expect = 0.98
 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 1/30 (3%)

Query: 32 SGIVEEVGQGVKHFKVGDKVFGKPILGKGG 61
           G  + VG G    +VGD +  +   G G 
Sbjct: 69 GGRRKHVGPGDDESQVGDVI-ARDPGGGGS 97


>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family.  This
          group has the characteristic catalytic and structural
          zinc-binding sites of the zinc-dependent alcohol
          dehydrogenases of the MDR family. The medium chain
          dehydrogenases/reductase (MDR)/zinc-dependent alcohol
          dehydrogenase-like family, which contains the
          zinc-dependent alcohol dehydrogenase (ADH-Zn) and
          related proteins, is a diverse group of proteins
          related to the first identified member, class I
          mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P)-binding Rossmann fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.
          Length = 350

 Score = 26.2 bits (58), Expect = 1.0
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 24 PAILGTEVSGIVEEVGQGVKH--FKVGDKVFGKPI 56
          P I G E  G V E+G+G +    KVGD+V  + I
Sbjct: 63 PMIPGHEFVGRVVELGEGAEERGVKVGDRVISEQI 97


>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase.  Glucose
          dehydrogenase (GlcDH), a member of the medium chain
          dehydrogenase/zinc-dependent alcohol dehydrogenase-like
          family, catalyzes the NADP(+)-dependent oxidation of
          glucose to gluconate, the first step in the
          Entner-Doudoroff pathway, an alternative to or
          substitute for glycolysis or the pentose phosphate
          pathway. The medium chain dehydrogenases/reductase
          (MDR)/zinc-dependent alcohol dehydrogenase-like family,
          which contains the zinc-dependent alcohol dehydrogenase
          (ADH-Zn) and related proteins, is a diverse group of
          proteins related to the first identified member, class
          I mammalian ADH.  MDRs display a broad range of
          activities and are distinguished from the smaller short
          chain dehydrogenases  (~ 250 amino acids vs. the ~ 350
          amino acids of the MDR).  The MDR proteins have 2
          domains: a C-terminal NAD(P) binding-Rossman fold
          domain of a beta-alpha form and an N-terminal catalytic
          domain with distant homology  to GroES.  The MDR group
          contains a host of activities, including the founding
          alcohol dehydrogenase (ADH), quinone reductase,
          sorbitol dehydrogenase, formaldehyde dehydrogenase,
          butanediol DH, ketose reductase, cinnamyl reductase,
          and numerous others. The zinc-dependent alcohol
          dehydrogenases (ADHs) catalyze the  NAD(P)(H)-dependent
          interconversion of alcohols to aldehydes or ketones.
          Active site zinc has a catalytic role, while structural
          zinc aids in stability.
          Length = 355

 Score = 25.3 bits (56), Expect = 2.0
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%)

Query: 26 ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          +LG E  G+VEEVG G      GD V
Sbjct: 60 VLGHEALGVVEEVGDG-SGLSPGDLV 84


>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated.
          Length = 632

 Score = 25.3 bits (56), Expect = 2.3
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 1/19 (5%)

Query: 18  PNLPDLP-AILGTEVSGIV 35
           PNLP+   A+ G E +GI 
Sbjct: 91  PNLPETHFALWGGEAAGIA 109


>gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family
          protein.  Members of this model form a distinct subset
          of the larger family of oxidoreductases that includes
          zinc-binding alcohol dehydrogenases and NADPH:quinone
          reductases (pfam00107). The gene neighborhood of
          members of this family is not conserved and it appears
          that no members are characterized. The sequence of the
          family includes 6 invariant cysteine residues and one
          invariant histidine. It appears that no member is
          characterized [Energy metabolism, Fermentation].
          Length = 329

 Score = 24.9 bits (54), Expect = 3.1
 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 5/35 (14%)

Query: 22 DLPA-----ILGTEVSGIVEEVGQGVKHFKVGDKV 51
          DLP        G EV G V   G     F VGD+V
Sbjct: 50 DLPVHRPRVTPGHEVVGEVAGRGADAGGFAVGDRV 84


>gnl|CDD|220557 pfam10086, DUF2324, Putative membrane peptidase family (DUF2324).
           This domain, found in various hypothetical bacterial
           proteins, has no known function. This family appears to
           be related to the prenyl protease 2 family pfam02517,
           suggesting this family may be peptidases.
          Length = 222

 Score = 24.6 bits (54), Expect = 3.6
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 5/47 (10%)

Query: 20  LPDLPAILGTEVSGIVEEVGQ--GVKHFKVGDKVFGKPI---LGKGG 61
            P L A+ G   +GI EE G+  G ++        G  +   LG GG
Sbjct: 59  HPLLYALYGALTAGIFEETGRYLGFRYLLKRRGGDGDALAYGLGHGG 105


>gnl|CDD|193512 cd03892, M20_peptT, M20 Peptidase T specifically cleaves
           tripeptides.  Peptidase M20 family, Peptidase T (peptT;
           tripeptide aminopeptidase; tripeptidase) subfamily. PepT
           acts only on tripeptide substrates, and is thus called a
           tripeptidase. It catalyzes the release of N-terminal
           amino acids with hydrophobic side chains from
           tripeptides with high specificity; dipeptides,
           tetrapeptides or tripeptides with the N-terminus blocked
           are not cleaved. Tripeptidases are known to function at
           the final stage of proteolysis in lactococcal bacteria
           and release amino acids from tripeptides produced during
           the digestion of milk proteins such as casein.
          Length = 401

 Score = 24.3 bits (54), Expect = 4.6
 Identities = 9/18 (50%), Positives = 12/18 (66%), Gaps = 2/18 (11%)

Query: 36  EEVGQGVKHFKVGDKVFG 53
           EE+G+G  HF V  + FG
Sbjct: 172 EEIGRGADHFDV--EKFG 187


>gnl|CDD|235484 PRK05469, PRK05469, peptidase T; Provisional.
          Length = 408

 Score = 24.3 bits (54), Expect = 5.0
 Identities = 8/18 (44%), Positives = 10/18 (55%), Gaps = 2/18 (11%)

Query: 36  EEVGQGVKHFKVGDKVFG 53
           EE+G+G   F V    FG
Sbjct: 174 EEIGRGADKFDVEK--FG 189


>gnl|CDD|190325 pfam02488, EMA, Merozoite Antigen.  This family represents the
           immunodominant surface antigen of Theileria parasites
           including equi merozoite antigen-1 (EMA-1) and equi
           merozoite antigen-2 (EMA-2). The protein shows variation
           at a putative glycosylation site, a potential mechanism
           for host immune response evasion.
          Length = 251

 Score = 23.9 bits (52), Expect = 6.2
 Identities = 11/32 (34%), Positives = 13/32 (40%), Gaps = 5/32 (15%)

Query: 36  EEVGQGVKH-----FKVGDKVFGKPILGKGGY 62
              G G K+     FKV    FGK  +G G  
Sbjct: 129 AAFGSGKKYTFKAPFKVSKVTFGKKDVGDGDN 160


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.315    0.141    0.415 

Gapped
Lambda     K      H
   0.267   0.0902    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,443,670
Number of extensions: 258998
Number of successful extensions: 281
Number of sequences better than 10.0: 1
Number of HSP's gapped: 270
Number of HSP's successfully gapped: 112
Length of query: 64
Length of database: 10,937,602
Length adjustment: 35
Effective length of query: 29
Effective length of database: 9,385,212
Effective search space: 272171148
Effective search space used: 272171148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (23.9 bits)