BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3513
         (140 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KVN|X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta
           From Pseudomonas Aeruginosa
 pdb|3KVN|A Chain A, Crystal Structure Of The Full-Length Autotransporter Esta
           From Pseudomonas Aeruginosa
          Length = 632

 Score = 28.9 bits (63), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 51  LDAMNHMAHDAVEHAEEFVRKVWQASWNVCHFQHLPQW 88
           L  +  MAH  +   ++ +R  WQA W   ++Q++ QW
Sbjct: 322 LTLLPEMAHGTLRAYQDELRSQWQADWE--NWQNVGQW 357


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.464 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,273,943
Number of Sequences: 62578
Number of extensions: 158725
Number of successful extensions: 307
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 307
Number of HSP's gapped (non-prelim): 2
length of query: 140
length of database: 14,973,337
effective HSP length: 89
effective length of query: 51
effective length of database: 9,403,895
effective search space: 479598645
effective search space used: 479598645
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 46 (22.3 bits)