Query         psy3517
Match_columns 113
No_of_seqs    110 out of 180
Neff          2.4 
Searched_HMMs 46136
Date          Fri Aug 16 18:41:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3517.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3517hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2516|consensus              100.0 1.2E-32 2.5E-37  237.3  -2.6   61   53-113     2-63  (517)
  2 PF03901 Glyco_transf_22:  Alg9  97.4 0.00011 2.4E-09   59.0   2.3   49   61-109     8-60  (418)
  3 PF06567 Neural_ProG_Cyt:  Neur  45.2     6.2 0.00014   29.9  -0.3   15   68-82     82-96  (120)
  4 COG5228 POP2 mRNA deadenylase   42.6     8.2 0.00018   32.8  -0.0   17   90-106    38-58  (299)
  5 PF09436 DUF2016:  Domain of un  41.9     7.3 0.00016   26.8  -0.3   60   17-77      1-71  (72)
  6 COG2101 SPT15 TATA-box binding  39.3      13 0.00029   29.8   0.7   33   70-106    17-49  (185)
  7 PHA02889 hypothetical protein;  36.4      14 0.00029   30.6   0.4   25    1-26    109-133 (241)
  8 KOG0304|consensus               25.5      26 0.00056   29.2   0.3   11   97-107    31-41  (239)
  9 PHA02979 hypothetical protein;  18.5      60  0.0013   25.1   1.0   15   27-41     81-95  (140)
 10 PF06514 PsbU:  Photosystem II   18.4      54  0.0012   23.8   0.7   18   65-82     41-58  (93)

No 1  
>KOG2516|consensus
Probab=99.97  E-value=1.2e-32  Score=237.26  Aligned_cols=61  Identities=64%  Similarity=1.022  Sum_probs=56.2

Q ss_pred             HHHHHHHHHHHHHHcCCcchhhhhhhhhhhhhhhcC-CCCCCCCcccCCCCcccccccccCC
Q psy3517          53 DSVALAVATVHLAICPFTKVEESFNLQAMHDIFYHN-MNISAYDHLEFPGVVPRTFLGPLFI  113 (113)
Q Consensus        53 ~~ll~~~~~~hl~~aPyTKVEESFnlQAiHDiL~~~-~~l~~YDH~~FPGvVPRTFiG~l~l  113 (113)
                      +.++++++.+|++.|||||||||||+||||||++|+ .|+++|||++||||||||||||++|
T Consensus         2 ~~llv~v~~~hli~~PfTKVEESFnlQA~HDil~~~~~~~sqYDHleFPGVVpRTFigplvi   63 (517)
T KOG2516|consen    2 DILLVTVIGYHLIKAPFTKVEESFNLQAIHDILTYRWDDLSQYDHLEFPGVVPRTFIGPLVI   63 (517)
T ss_pred             cEEEEEeeeeeeeecCcchHhhhhhHHHHHHHHHhccchhhhcccccCCCcCccccccceee
Confidence            345566788999999999999999999999999998 8999999999999999999999875


No 2  
>PF03901 Glyco_transf_22:  Alg9-like mannosyltransferase family;  InterPro: IPR005599 Members of this family are glycosylphosphatidylinositol mannosyltransferase enzymes 2.4.1.- from EC [, ]. At least some members are localised in endoplasmic reticulum and involved in GPI anchor biosynthesis [, ]. In yeast the SMP3 (YOR149C) has been implemented in plasmid stability [].; GO: 0016757 transferase activity, transferring glycosyl groups, 0006506 GPI anchor biosynthetic process, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=97.35  E-value=0.00011  Score=59.03  Aligned_cols=49  Identities=16%  Similarity=0.215  Sum_probs=40.0

Q ss_pred             HHHHHHcCCc----chhhhhhhhhhhhhhhcCCCCCCCCcccCCCCccccccc
Q psy3517          61 TVHLAICPFT----KVEESFNLQAMHDIFYHNMNISAYDHLEFPGVVPRTFLG  109 (113)
Q Consensus        61 ~~hl~~aPyT----KVEESFnlQAiHDiL~~~~~l~~YDH~~FPGvVPRTFiG  109 (113)
                      .++++.|.++    |+||+||.|..+..+.+|.+...|||..+||+.++++.+
T Consensus         8 ~~R~~~a~~~~~~f~pDE~fq~~E~ah~~~~g~g~~tWE~~~~~~iRS~~~p~   60 (418)
T PF03901_consen    8 AFRLLNALFPQTSFHPDEYFQSLEPAHRLVFGYGYLTWEWSPFPGIRSWLFPL   60 (418)
T ss_pred             HHHHHHHHhccCCCCCCcccccHHhhhhhhcCccchhhhhccCCCCCChHHHH
Confidence            3455554444    999999999999888888999999999999998887754


No 3  
>PF06567 Neural_ProG_Cyt:  Neural chondroitin sulphate proteoglycan cytoplasmic domain;  InterPro: IPR009505 This entry represents the C-terminal cytoplasmic domain of vertebrate neural chondroitin sulphate proteoglycans that contain EGF modules. Evidence has been accumulated to support the idea that neural proteoglycans are involved in various cellular events including mitogenesis, differentiation, axonal outgrowth and synaptogenesis []. This domain contains a number of potential sites of phosphorylation by protein kinase C [].
Probab=45.24  E-value=6.2  Score=29.88  Aligned_cols=15  Identities=47%  Similarity=0.496  Sum_probs=12.5

Q ss_pred             CCcchhhhhhhhhhh
Q psy3517          68 PFTKVEESFNLQAMH   82 (113)
Q Consensus        68 PyTKVEESFnlQAiH   82 (113)
                      |--|=|||||||.-|
T Consensus        82 ~~~KEEes~NI~NS~   96 (120)
T PF06567_consen   82 SCLKEEESFNIQNSM   96 (120)
T ss_pred             ccccccccccccccC
Confidence            567999999999654


No 4  
>COG5228 POP2 mRNA deadenylase subunit [RNA processing and modification]
Probab=42.62  E-value=8.2  Score=32.80  Aligned_cols=17  Identities=65%  Similarity=1.118  Sum_probs=14.1

Q ss_pred             CCCCCCcc----cCCCCcccc
Q psy3517          90 NISAYDHL----EFPGVVPRT  106 (113)
Q Consensus        90 ~l~~YDH~----~FPGvVPRT  106 (113)
                      -+++|.|+    ||||||.|-
T Consensus        38 Li~rYn~vSmdTEFpGvvArP   58 (299)
T COG5228          38 LISRYNHVSMDTEFPGVVARP   58 (299)
T ss_pred             HHHhCCceeeccccCceeecc
Confidence            46888886    799999994


No 5  
>PF09436 DUF2016:  Domain of unknown function (DUF2016);  InterPro: IPR018560  This entry represents the N-terminal of proteins that contain a ubiquitin domain. 
Probab=41.85  E-value=7.3  Score=26.84  Aligned_cols=60  Identities=12%  Similarity=0.088  Sum_probs=36.6

Q ss_pred             cccccccccCceeeecCCCCccccC-----------CCCCCchHHHHHHHHHHHHHHHHHHcCCcchhhhhh
Q psy3517          17 MDSSLLLKYPSICICSDSSDVYYSD-----------YFPGIPVDLTMDSVALAVATVHLAICPFTKVEESFN   77 (113)
Q Consensus        17 ~~~~~~~~~~~~~v~s~~~~v~~~~-----------~~~~~~~~~~l~~ll~~~~~~hl~~aPyTKVEESFn   77 (113)
                      +|.-|....|++||-+.......+.           .|- +..-.+|.+...+.-.-.-..-||-.|||+..
T Consensus         1 ~D~aLq~~~P~v~vPr~g~l~~l~~~G~Rllva~nGv~l-Ev~r~WL~~~~~va~~~~~~~~PYG~v~e~~~   71 (72)
T PF09436_consen    1 RDMALQASFPTVMVPRFGALEPLERPGHRLLVASNGVFL-EVRRPWLHVIRPVALYPVATAIPYGEVTEALR   71 (72)
T ss_pred             CcHHHHhhCCEeecCCCCCCCccccCCcEEEEecCcEEE-EEechHHHHhHHhhcCCccccCCcccceeeec
Confidence            5777888899999988877665542           222 12223344433322122345679999999853


No 6  
>COG2101 SPT15 TATA-box binding protein (TBP), component of TFIID and TFIIIB [Transcription]
Probab=39.30  E-value=13  Score=29.81  Aligned_cols=33  Identities=21%  Similarity=0.390  Sum_probs=24.1

Q ss_pred             cchhhhhhhhhhhhhhhcCCCCCCCCcccCCCCcccc
Q psy3517          70 TKVEESFNLQAMHDIFYHNMNISAYDHLEFPGVVPRT  106 (113)
Q Consensus        70 TKVEESFnlQAiHDiL~~~~~l~~YDH~~FPGvVPRT  106 (113)
                      |+-++.+++|.+-..+    .=+.|+--+|||.|-|.
T Consensus        17 ~~L~~elDL~~~~~~l----~~aeYnP~qFpGlv~Rl   49 (185)
T COG2101          17 VDLGQELDLEEVALDL----PGAEYNPEQFPGLVYRL   49 (185)
T ss_pred             echhhhccHHHHHhhC----CCCccCHhHCCeeEEEe
Confidence            3456777777655544    23789999999999885


No 7  
>PHA02889 hypothetical protein; Provisional
Probab=36.39  E-value=14  Score=30.58  Aligned_cols=25  Identities=52%  Similarity=0.695  Sum_probs=21.6

Q ss_pred             CCcccccccccchhcccccccccccC
Q psy3517           1 MGKSQWDTLQDTEEINMDSSLLLKYP   26 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~   26 (113)
                      |||.| |.||..|.|-.|.|++.|-.
T Consensus       109 ~~kgq-dslq~iesi~idds~i~ke~  133 (241)
T PHA02889        109 MGKGQ-DSLQEIESIFIDDSLITKED  133 (241)
T ss_pred             cccCc-chhhheeEEEeccceeeehh
Confidence            67777 89999999999999998743


No 8  
>KOG0304|consensus
Probab=25.47  E-value=26  Score=29.20  Aligned_cols=11  Identities=64%  Similarity=1.102  Sum_probs=9.3

Q ss_pred             ccCCCCccccc
Q psy3517          97 LEFPGVVPRTF  107 (113)
Q Consensus        97 ~~FPGvVPRTF  107 (113)
                      .||||+|-||-
T Consensus        31 TEFPGvv~rp~   41 (239)
T KOG0304|consen   31 TEFPGVVARPI   41 (239)
T ss_pred             CcCCceeeecC
Confidence            48999999974


No 9  
>PHA02979 hypothetical protein; Provisional
Probab=18.51  E-value=60  Score=25.09  Aligned_cols=15  Identities=40%  Similarity=0.886  Sum_probs=11.5

Q ss_pred             ceeeecCCCCccccC
Q psy3517          27 SICICSDSSDVYYSD   41 (113)
Q Consensus        27 ~~~v~s~~~~v~~~~   41 (113)
                      -|||||+-++.-.+.
T Consensus        81 iiCI~Sdd~GLLihN   95 (140)
T PHA02979         81 IICICSDDCGLLIHN   95 (140)
T ss_pred             EEEEecccccEEEec
Confidence            489999988765543


No 10 
>PF06514 PsbU:  Photosystem II 12 kDa extrinsic protein (PsbU);  InterPro: IPR010527 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII extrinsic protein PsbU, which forms part of the OEC in cyanobacteria and red algae. PsbU acts to stabilise the oxygen-evolving machinery of PSII against heat-induced inactivation, which is crucial for cellular thermo-tolerance [].; GO: 0015979 photosynthesis, 0042549 photosystem II stabilization, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 3BZ1_U 3KZI_U 3PRQ_U 2AXT_u 3BZ2_U 4FBY_U 3PRR_U 1S5L_U 3A0H_U 3ARC_U ....
Probab=18.43  E-value=54  Score=23.77  Aligned_cols=18  Identities=22%  Similarity=0.591  Sum_probs=10.6

Q ss_pred             HHcCCcchhhhhhhhhhh
Q psy3517          65 AICPFTKVEESFNLQAMH   82 (113)
Q Consensus        65 ~~aPyTKVEESFnlQAiH   82 (113)
                      --+||.+|||-.++...-
T Consensus        41 ~naPY~sveDvl~ipgLs   58 (93)
T PF06514_consen   41 SNAPYKSVEDVLNIPGLS   58 (93)
T ss_dssp             HS---SSGGGGCCSTT--
T ss_pred             hCCCCCCHHHHHhccCCC
Confidence            347999999999985443


Done!