Diaphorina citri psyllid: psy3529


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MESSTQEIHKSLNTIIDYQTHHRLREAQGRKRAEDLNERAGRPALSLGARIAKIVPSAADAALIRLYPTGTQITNSRNLTVDANIRIHAPPSFMVAA
cccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
***S**EIHKSLNTIIDYQTHHRLREAQGRKRAEDLNERAGRPALSLGARIAKIVPSAADAALIRLYPTGTQITNSRNLTVDANIRIHAPPSFMVA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESSTQEIHKSLNTIIDYQTHHRLREAQGRKRAEDLNERAGRPALSLGARIAKIVPSAADAALIRLYPTGTQITNSRNLTVDANIRIHAPPSFMVAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048042 [BP]regulation of post-mating ovipositionprobableGO:2000241, GO:0048583, GO:0050795, GO:0043900, GO:0065007, GO:0051239, GO:0008150, GO:0050789, GO:0046662
GO:0061357 [BP]positive regulation of Wnt protein secretionprobableGO:0032880, GO:0070201, GO:0051223, GO:0050708, GO:0060341, GO:0051046, GO:0050714, GO:0051049, GO:0051050, GO:0051047, GO:0050794, GO:0061356, GO:0065007, GO:0032879, GO:0023051, GO:0048518, GO:0008150, GO:0051222, GO:0010646, GO:0050789, GO:0048522
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted