Query         psy3565
Match_columns 168
No_of_seqs    129 out of 170
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 19:53:58 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3565.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3565hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4477|consensus              100.0   3E-51 6.4E-56  341.6   5.1  161    5-166     2-212 (228)
  2 PF00641 zf-RanBP:  Zn-finger i  98.9 4.9E-10 1.1E-14   67.2   1.6   30   21-50      1-30  (30)
  3 smart00547 ZnF_RBZ Zinc finger  98.2 3.6E-07 7.7E-12   52.7   1.0   25   23-47      1-25  (26)
  4 KOG4198|consensus               93.0   0.059 1.3E-06   47.7   2.1   32   21-52    137-168 (280)
  5 KOG4345|consensus               89.3     0.1 2.2E-06   51.6  -0.2   49   22-70    183-236 (774)
  6 KOG4345|consensus               87.4    0.13 2.7E-06   51.0  -0.9   28   23-50      6-33  (774)
  7 cd00350 rubredoxin_like Rubred  73.4     2.5 5.3E-05   25.8   1.6   25   24-48      1-27  (33)
  8 PF05077 DUF678:  Protein of un  73.0     1.9 4.2E-05   31.9   1.2   11   36-46     55-65  (74)
  9 PRK14892 putative transcriptio  68.1       4 8.6E-05   31.2   2.0   44    6-50      1-54  (99)
 10 KOG3214|consensus               67.2     2.6 5.7E-05   33.1   0.9   45    6-50      1-59  (109)
 11 KOG4198|consensus               65.5     2.5 5.4E-05   37.7   0.5   32   21-52     61-92  (280)
 12 PF13248 zf-ribbon_3:  zinc-rib  64.6     3.2   7E-05   24.1   0.7   24   24-47      2-25  (26)
 13 PF00301 Rubredoxin:  Rubredoxi  61.0     5.1 0.00011   26.8   1.3   16   34-49     30-45  (47)
 14 KOG1995|consensus               58.7     5.3 0.00012   36.8   1.4   30   21-50    215-245 (351)
 15 cd00730 rubredoxin Rubredoxin;  56.8     6.9 0.00015   26.4   1.4   25   24-48      1-44  (50)
 16 cd00729 rubredoxin_SM Rubredox  55.2     8.2 0.00018   23.9   1.4   26   24-49      2-29  (34)
 17 PF13240 zinc_ribbon_2:  zinc-r  49.2     8.3 0.00018   22.2   0.7   21   27-47      2-22  (23)
 18 PRK04136 rpl40e 50S ribosomal   42.9      13 0.00028   25.6   1.0   25   22-46     12-36  (48)
 19 PF07797 DUF1639:  Protein of u  39.4     9.9 0.00021   26.3  -0.0   22    9-30     16-46  (50)
 20 COG4888 Uncharacterized Zn rib  36.2      25 0.00054   27.6   1.8   43    6-48      1-56  (104)
 21 PF12773 DZR:  Double zinc ribb  35.8      18 0.00039   22.9   0.8   23   27-49      1-23  (50)
 22 KOG0955|consensus               34.8      22 0.00048   37.0   1.6   30   20-50    256-285 (1051)
 23 PF05129 Elf1:  Transcription e  34.4      15 0.00034   26.7   0.4   33   15-47     13-55  (81)
 24 PF04313 HSDR_N:  Type I restri  34.2      41 0.00088   26.7   2.8   19  117-135   125-143 (194)
 25 cd04718 BAH_plant_2 BAH, or Br  33.2      22 0.00048   29.1   1.1   20   20-39     14-33  (148)
 26 PRK05452 anaerobic nitric oxid  32.0      30 0.00064   32.1   1.8   29   21-49    422-469 (479)
 27 PF07562 NCD3G:  Nine Cysteines  30.2      22 0.00048   23.6   0.6   25   21-45     22-49  (54)
 28 PF06153 DUF970:  Protein of un  28.2      56  0.0012   25.4   2.5   24  108-131    79-102 (109)
 29 PRK14559 putative protein seri  25.2      35 0.00075   33.5   1.1   23   26-48      3-25  (645)
 30 KOG0954|consensus               22.3      60  0.0013   33.3   2.1   49   21-74    309-357 (893)
 31 PF04810 zf-Sec23_Sec24:  Sec23  22.2      39 0.00085   21.3   0.6   14   23-36     23-36  (40)
 32 PF04071 zf-like:  Cysteine-ric  21.5      27 0.00059   26.2  -0.3   22   21-42     46-69  (86)
 33 smart00837 DPBB_1 Rare lipopro  21.4      96  0.0021   22.7   2.6   12  124-135    35-46  (87)
 34 KOG0956|consensus               20.5      48   0.001   33.9   1.0   30   21-50     45-74  (900)
 35 KOG0699|consensus               20.3      55  0.0012   31.4   1.4   16  122-137   492-507 (542)

No 1  
>KOG4477|consensus
Probab=100.00  E-value=3e-51  Score=341.65  Aligned_cols=161  Identities=46%  Similarity=0.629  Sum_probs=142.5

Q ss_pred             CCCCCCCchhhhhccC---CCCceeccccceeccccccceecCCCCCCCCCCCCCCCccchhhhhccCCcCCCCCCCCCC
Q psy3565           5 GMDRKTPTKRRRKQAK---DENYWDCSVCTYRNVAEAFKCSMCDVRKGTSTRKPRITPDLVAQVTQQYPVPATSKVGPKK   81 (168)
Q Consensus         5 ~m~~~~~~~r~kr~~k---~eg~WdCsvCt~rN~asA~KCv~C~tpk~~strk~r~~s~lvaQq~~qq~~~~~~~~~~~~   81 (168)
                      -||++++++|+||+++   ++|+|||++|||+|.|+||+|.+|++++|+++|+|++++||||||++|||++|++++++++
T Consensus         2 ~mgdkksptrpkr~akp~~Deg~WdCsvCTFrNsAeAfkC~vCdvRKGTSTRkpr~nsqlVaqQvtqq~~~p~q~kKEKk   81 (228)
T KOG4477|consen    2 RMGDKKSPTRPKRDAKPNDDEGKWDCSVCTFRNSAEAFKCFVCDVRKGTSTRKPRCNSQLVAQQVTQQTMVPKQVKKEKK   81 (228)
T ss_pred             CCccccCCCCccccCCCccccCceeeeeeeecchhhhhheeeecccccccccCCcchHHHHHHHHhhhhcCCCcchhHHH
Confidence            5999999999999999   8999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCc---cccch--h---hhhccCCcCCC---------------------------------CCCcCCCcCCCCceEEE
Q psy3565          82 EGGGK---EKSEN--R---KFKKHGRRKWN---------------------------------PPKLKHVDRTTAQTLEI  120 (168)
Q Consensus        82 ~~~~k---~k~~~--~---~~~k~~~~~~~---------------------------------rpRLKnVDRSSAq~~eV  120 (168)
                      .+.++   +|++.  +   ...|+|++++.                                 |||||||||||||+|+|
T Consensus        82 ~Kvekr~~eKset~ke~e~~stKkn~~kkt~~~Se~~r~P~~E~qe~~Sve~T~tkSks~~akrPrlKnvdrstaq~l~v  161 (228)
T KOG4477|consen   82 LKVEKRSLEKSETRKESEGVSTKKNKIKKTDIASEKPRTPVPEKQEEVSVEETPTKSKSATAKRPRLKNVDRSTAQDLKV  161 (228)
T ss_pred             HHHHHhhhhcchhhhhcccccccccccccCcccccccCCCCchhhchhccccccccccccccCCccccccccchhhhhhe
Confidence            77765   33321  1   23455555543                                 99999999999999999


Q ss_pred             EeCCeeEEEeeccCCcCCCCcccc-----ccchhcccccccc-ccccCCCCC
Q psy3565         121 TVNNLTVKVTEFKPKIKKSILDSD-----LSSVENDSQSESS-LNTKNGDIT  166 (168)
Q Consensus       121 TVg~vTViITefK~K~~~~~~~s~-----~~~~~~~~qs~ss-~~t~~g~~~  166 (168)
                      |||++|||||||++|+.+.++++.     +. +||++|++|+ ++|++|++-
T Consensus       162 tVg~~tviiTdfkekt~S~~~ss~~~~sn~~-~dq~~qssS~S~tT~qG~sr  212 (228)
T KOG4477|consen  162 TVGTKTVIITDFKEKTESNVNSSLVKESNKK-EDQIGQSSSDSLTTNQGESR  212 (228)
T ss_pred             eecceEEEEeeccccccCCcchhhhhhhccc-ccccCCccCCcccccccccc
Confidence            999999999999999999988774     34 6999999887 999999864


No 2  
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=98.91  E-value=4.9e-10  Score=67.22  Aligned_cols=30  Identities=33%  Similarity=0.774  Sum_probs=24.5

Q ss_pred             CCCceeccccceeccccccceecCCCCCCC
Q psy3565          21 DENYWDCSVCTYRNVAEAFKCSMCDVRKGT   50 (168)
Q Consensus        21 ~eg~WdCsvCt~rN~asA~KCv~C~tpk~~   50 (168)
                      ++|.|.|+.|+|.|.+++.+|++|++++|.
T Consensus         1 k~g~W~C~~C~~~N~~~~~~C~~C~~~rp~   30 (30)
T PF00641_consen    1 KEGDWKCPSCTFMNPASRSKCVACGAPRPG   30 (30)
T ss_dssp             -SSSEEETTTTEEEESSSSB-TTT--BTTB
T ss_pred             CCcCccCCCCcCCchHHhhhhhCcCCCCcC
Confidence            478999999999999999999999999873


No 3  
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=98.24  E-value=3.6e-07  Score=52.74  Aligned_cols=25  Identities=36%  Similarity=0.913  Sum_probs=24.0

Q ss_pred             CceeccccceeccccccceecCCCC
Q psy3565          23 NYWDCSVCTYRNVAEAFKCSMCDVR   47 (168)
Q Consensus        23 g~WdCsvCt~rN~asA~KCv~C~tp   47 (168)
                      |.|.|+.|+|.|.+.+..|.+|++|
T Consensus         1 g~W~C~~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        1 GDWECPACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             CcccCCCCCCcChhhhccccccCCc
Confidence            6899999999999999999999987


No 4  
>KOG4198|consensus
Probab=93.04  E-value=0.059  Score=47.74  Aligned_cols=32  Identities=22%  Similarity=0.713  Sum_probs=29.9

Q ss_pred             CCCceeccccceeccccccceecCCCCCCCCC
Q psy3565          21 DENYWDCSVCTYRNVAEAFKCSMCDVRKGTST   52 (168)
Q Consensus        21 ~eg~WdCsvCt~rN~asA~KCv~C~tpk~~st   52 (168)
                      ..|.|.|+-|.|.|.+.-.-|.-|+++++...
T Consensus       137 ~~GDW~Cp~C~fhNfarn~~C~rC~~~r~~~a  168 (280)
T KOG4198|consen  137 RSGDWECPGCNFHNFARNSECFRCGAKRPLAA  168 (280)
T ss_pred             cccCcccCCCCceeccccchhhhcCCcCcccc
Confidence            78999999999999999999999999998844


No 5  
>KOG4345|consensus
Probab=89.28  E-value=0.1  Score=51.56  Aligned_cols=49  Identities=10%  Similarity=0.100  Sum_probs=35.7

Q ss_pred             CCceeccccceeccccccceecCCCCCCCCC-CCC----CCCccchhhhhccCC
Q psy3565          22 ENYWDCSVCTYRNVAEAFKCSMCDVRKGTST-RKP----RITPDLVAQVTQQYP   70 (168)
Q Consensus        22 eg~WdCsvCt~rN~asA~KCv~C~tpk~~st-rk~----r~~s~lvaQq~~qq~   70 (168)
                      +..|+|.+|+|.||+.+.+|.+|+++.+... ..+    .....+|.|...++.
T Consensus       183 ~~eW~~lik~ass~pr~~r~~~~~~~~~~e~s~~~yesLEe~hifvl~~ilRrp  236 (774)
T KOG4345|consen  183 NDEWTELIKLASSEPRMHRSGNGGTGGGVEISEDPYESLEEFHIFVLAHILRRP  236 (774)
T ss_pred             HHHHHHHHHhhcccchhhhcccCCCCCCcccccccchhHHHHHHHHHHHHhhCC
Confidence            4469999999999999999999999988633 222    233455666655544


No 6  
>KOG4345|consensus
Probab=87.41  E-value=0.13  Score=50.96  Aligned_cols=28  Identities=25%  Similarity=0.582  Sum_probs=25.6

Q ss_pred             CceeccccceeccccccceecCCCCCCC
Q psy3565          23 NYWDCSVCTYRNVAEAFKCSMCDVRKGT   50 (168)
Q Consensus        23 g~WdCsvCt~rN~asA~KCv~C~tpk~~   50 (168)
                      -.|.|.+|+|+|++.+++|.||....|.
T Consensus         6 ~~W~~~~~~~~~lp~al~lS~~~~s~~~   33 (774)
T KOG4345|consen    6 EKWACELCDYMTLPMALVLSDFRRSTGA   33 (774)
T ss_pred             HHHHHHhhccccCchhhHHHHHHhccCC
Confidence            3699999999999999999999988774


No 7  
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=73.40  E-value=2.5  Score=25.80  Aligned_cols=25  Identities=28%  Similarity=0.748  Sum_probs=20.1

Q ss_pred             ceeccccceeccc--cccceecCCCCC
Q psy3565          24 YWDCSVCTYRNVA--EAFKCSMCDVRK   48 (168)
Q Consensus        24 ~WdCsvCt~rN~a--sA~KCv~C~tpk   48 (168)
                      .|-|.+|-|.-.+  .-..|..|++++
T Consensus         1 ~~~C~~CGy~y~~~~~~~~CP~Cg~~~   27 (33)
T cd00350           1 KYVCPVCGYIYDGEEAPWVCPVCGAPK   27 (33)
T ss_pred             CEECCCCCCEECCCcCCCcCcCCCCcH
Confidence            4999999988444  367999999875


No 8  
>PF05077 DUF678:  Protein of unknown function (DUF678);  InterPro: IPR007769 This family contains poxvirus proteins belonging to the A19 family. The proteins are of unknown function.
Probab=72.96  E-value=1.9  Score=31.88  Aligned_cols=11  Identities=27%  Similarity=0.839  Sum_probs=8.7

Q ss_pred             ccccceecCCC
Q psy3565          36 AEAFKCSMCDV   46 (168)
Q Consensus        36 asA~KCv~C~t   46 (168)
                      ...+.|.+|+.
T Consensus        55 ~~tLsCsACGS   65 (74)
T PF05077_consen   55 GNTLSCSACGS   65 (74)
T ss_pred             CCeEeehhccc
Confidence            57888999875


No 9  
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=68.12  E-value=4  Score=31.17  Aligned_cols=44  Identities=16%  Similarity=0.449  Sum_probs=30.3

Q ss_pred             CCCCCCchh-hhh-ccCCCCceeccccceecccc--------ccceecCCCCCCC
Q psy3565           6 MDRKTPTKR-RRK-QAKDENYWDCSVCTYRNVAE--------AFKCSMCDVRKGT   50 (168)
Q Consensus         6 m~~~~~~~r-~kr-~~k~eg~WdCsvCt~rN~as--------A~KCv~C~tpk~~   50 (168)
                      ||+.+..++ ++| ..+.+..++|+.|- .....        ...|..|+.-++.
T Consensus         1 MGkRk~~~k~~~k~k~klpt~f~CP~Cg-e~~v~v~~~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892          1 MGRRRKKRKKIIRPKPKLPKIFECPRCG-KVSISVKIKKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             CCCccccCCCCcccccCCCcEeECCCCC-CeEeeeecCCCcceEECCCCCCccCE
Confidence            886554443 344 33467889999998 33443        6789999998766


No 10 
>KOG3214|consensus
Probab=67.25  E-value=2.6  Score=33.12  Aligned_cols=45  Identities=16%  Similarity=0.483  Sum_probs=30.9

Q ss_pred             CCCCCCchhh----hhccCCCCceeccccceeccc----------cccceecCCCCCCC
Q psy3565           6 MDRKTPTKRR----RKQAKDENYWDCSVCTYRNVA----------EAFKCSMCDVRKGT   50 (168)
Q Consensus         6 m~~~~~~~r~----kr~~k~eg~WdCsvCt~rN~a----------sA~KCv~C~tpk~~   50 (168)
                      ||+.++.+|.    |++...+-+|.|.+|.-++..          .-..|.+|..--.+
T Consensus         1 MgkRk~K~k~~~k~r~~~~ldt~FnClfcnHek~v~~~~Dk~~~iG~~sC~iC~esFqt   59 (109)
T KOG3214|consen    1 MGKRKSKRKEPPKERRVEPLDTQFNCLFCNHEKSVSCTLDKKHNIGKASCRICEESFQT   59 (109)
T ss_pred             CCcccccccCCchhhhccchheeeccCccccccceeeeehhhcCcceeeeeehhhhhcc
Confidence            7876666643    455567888999999888753          34568888665433


No 11 
>KOG4198|consensus
Probab=65.47  E-value=2.5  Score=37.68  Aligned_cols=32  Identities=25%  Similarity=0.670  Sum_probs=28.6

Q ss_pred             CCCceeccccceeccccccceecCCCCCCCCC
Q psy3565          21 DENYWDCSVCTYRNVAEAFKCSMCDVRKGTST   52 (168)
Q Consensus        21 ~eg~WdCsvCt~rN~asA~KCv~C~tpk~~st   52 (168)
                      -.|-|.|..|++.|.+.-+.|-.|..++....
T Consensus        61 ~pgdw~c~~c~~~n~arr~~c~~c~~s~~~~~   92 (280)
T KOG4198|consen   61 RPGDWNCPLCGFHNSARRLLCFRCGFSKVPLD   92 (280)
T ss_pred             CCcccccCccchhhHHHhhhcceecccCCCcc
Confidence            56889999999999999999999999887643


No 12 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=64.62  E-value=3.2  Score=24.12  Aligned_cols=24  Identities=21%  Similarity=0.380  Sum_probs=21.4

Q ss_pred             ceeccccceeccccccceecCCCC
Q psy3565          24 YWDCSVCTYRNVAEAFKCSMCDVR   47 (168)
Q Consensus        24 ~WdCsvCt~rN~asA~KCv~C~tp   47 (168)
                      .+.|+.|-..|.+++.-|..|+++
T Consensus         2 ~~~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             cCCCcccCCcCCcccccChhhCCC
Confidence            367999999999999999999875


No 13 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=60.99  E-value=5.1  Score=26.79  Aligned_cols=16  Identities=19%  Similarity=0.760  Sum_probs=9.6

Q ss_pred             ccccccceecCCCCCC
Q psy3565          34 NVAEAFKCSMCDVRKG   49 (168)
Q Consensus        34 N~asA~KCv~C~tpk~   49 (168)
                      +.++...|..|+++|.
T Consensus        30 ~Lp~~w~CP~C~a~K~   45 (47)
T PF00301_consen   30 DLPDDWVCPVCGAPKS   45 (47)
T ss_dssp             GS-TT-B-TTTSSBGG
T ss_pred             HCCCCCcCcCCCCccc
Confidence            4577778999988763


No 14 
>KOG1995|consensus
Probab=58.68  E-value=5.3  Score=36.80  Aligned_cols=30  Identities=33%  Similarity=0.762  Sum_probs=27.5

Q ss_pred             CCCceecc-ccceeccccccceecCCCCCCC
Q psy3565          21 DENYWDCS-VCTYRNVAEAFKCSMCDVRKGT   50 (168)
Q Consensus        21 ~eg~WdCs-vCt~rN~asA~KCv~C~tpk~~   50 (168)
                      .++-|+|. .|-=+|++.-..|--|+++|+.
T Consensus       215 ~d~Dw~c~~~c~N~nfa~r~~cnrck~~Kp~  245 (351)
T KOG1995|consen  215 EDGDWDCPPSCGNRNFAWREECNRCKAPKPE  245 (351)
T ss_pred             ccccccccccccccccccccccccccCCCcc
Confidence            45669999 9999999999999999999986


No 15 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=56.78  E-value=6.9  Score=26.42  Aligned_cols=25  Identities=24%  Similarity=0.897  Sum_probs=19.0

Q ss_pred             ceeccccceec-------------------cccccceecCCCCC
Q psy3565          24 YWDCSVCTYRN-------------------VAEAFKCSMCDVRK   48 (168)
Q Consensus        24 ~WdCsvCt~rN-------------------~asA~KCv~C~tpk   48 (168)
                      .|-|.+|-|.=                   .+..+.|..|+.+|
T Consensus         1 ~y~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a~K   44 (50)
T cd00730           1 KYECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAGK   44 (50)
T ss_pred             CcCCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCCcH
Confidence            47888887753                   46677999998876


No 16 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=55.15  E-value=8.2  Score=23.90  Aligned_cols=26  Identities=38%  Similarity=0.921  Sum_probs=19.4

Q ss_pred             ceeccccceecccc--ccceecCCCCCC
Q psy3565          24 YWDCSVCTYRNVAE--AFKCSMCDVRKG   49 (168)
Q Consensus        24 ~WdCsvCt~rN~as--A~KCv~C~tpk~   49 (168)
                      .|-|.+|=|.=...  -..|.+|++++.
T Consensus         2 ~~~C~~CG~i~~g~~~p~~CP~Cg~~~~   29 (34)
T cd00729           2 VWVCPVCGYIHEGEEAPEKCPICGAPKE   29 (34)
T ss_pred             eEECCCCCCEeECCcCCCcCcCCCCchH
Confidence            59999998873322  359999999753


No 17 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=49.16  E-value=8.3  Score=22.16  Aligned_cols=21  Identities=24%  Similarity=0.512  Sum_probs=19.2

Q ss_pred             ccccceeccccccceecCCCC
Q psy3565          27 CSVCTYRNVAEAFKCSMCDVR   47 (168)
Q Consensus        27 CsvCt~rN~asA~KCv~C~tp   47 (168)
                      |+-|-.++...+.-|..|+++
T Consensus         2 Cp~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    2 CPNCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CcccCCCCCCcCcchhhhCCc
Confidence            888999999999999999875


No 18 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=42.92  E-value=13  Score=25.57  Aligned_cols=25  Identities=36%  Similarity=0.477  Sum_probs=23.0

Q ss_pred             CCceeccccceeccccccceecCCC
Q psy3565          22 ENYWDCSVCTYRNVAEAFKCSMCDV   46 (168)
Q Consensus        22 eg~WdCsvCt~rN~asA~KCv~C~t   46 (168)
                      ...|-|.-|--+|.+.|.+|--|+.
T Consensus        12 ~~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         12 FNKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             hcccchhcccCCCCccccccccCCC
Confidence            4578999999999999999999987


No 19 
>PF07797 DUF1639:  Protein of unknown function (DUF1639);  InterPro: IPR012438 This approximately 50-residue region is found in a number of sequences derived from hypothetical plant proteins. This region features a highly basic 5 amino-acid stretch towards its centre. 
Probab=39.36  E-value=9.9  Score=26.29  Aligned_cols=22  Identities=27%  Similarity=0.517  Sum_probs=18.0

Q ss_pred             CCCchhhhhccC---------CCCceecccc
Q psy3565           9 KTPTKRRRKQAK---------DENYWDCSVC   30 (168)
Q Consensus         9 ~~~~~r~kr~~k---------~eg~WdCsvC   30 (168)
                      .++++|||+.+|         -+|.|-|+|+
T Consensus        16 ~kpprRPkKRpk~Vqk~ld~lfPG~wL~~vt   46 (50)
T PF07797_consen   16 SKPPRRPKKRPKNVQKQLDSLFPGLWLSEVT   46 (50)
T ss_pred             CCCCCCCCcccHHHHHHHhhcCcchhhhhcC
Confidence            678888888877         6789988876


No 20 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=36.24  E-value=25  Score=27.60  Aligned_cols=43  Identities=21%  Similarity=0.492  Sum_probs=27.2

Q ss_pred             CCCCCCchh---hhhccCCCCceeccccceeccc----------cccceecCCCCC
Q psy3565           6 MDRKTPTKR---RRKQAKDENYWDCSVCTYRNVA----------EAFKCSMCDVRK   48 (168)
Q Consensus         6 m~~~~~~~r---~kr~~k~eg~WdCsvCt~rN~a----------sA~KCv~C~tpk   48 (168)
                      ||.++..+|   ++|+..=+-.|.|+.|--++..          ....|-.|+..-
T Consensus         1 MG~rr~krr~~ik~~~~~L~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~   56 (104)
T COG4888           1 MGRRRRKRRKIIKRRPQVLPKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSF   56 (104)
T ss_pred             CCcccccccccCcccCccCCceEecCccCCeeeeEEEEEecCceeEEEcccCcceE
Confidence            786665443   2233335667999999777665          345688886653


No 21 
>PF12773 DZR:  Double zinc ribbon
Probab=35.77  E-value=18  Score=22.95  Aligned_cols=23  Identities=26%  Similarity=0.512  Sum_probs=20.5

Q ss_pred             ccccceeccccccceecCCCCCC
Q psy3565          27 CSVCTYRNVAEAFKCSMCDVRKG   49 (168)
Q Consensus        27 CsvCt~rN~asA~KCv~C~tpk~   49 (168)
                      |+.|-..|.+.+.-|..|+++-+
T Consensus         1 Cp~Cg~~~~~~~~fC~~CG~~l~   23 (50)
T PF12773_consen    1 CPHCGTPNPDDAKFCPHCGTPLP   23 (50)
T ss_pred             CCCcCCcCCccccCChhhcCChh
Confidence            78899999999999999998866


No 22 
>KOG0955|consensus
Probab=34.78  E-value=22  Score=36.99  Aligned_cols=30  Identities=23%  Similarity=0.662  Sum_probs=23.5

Q ss_pred             CCCCceeccccceeccccccceecCCCCCCC
Q psy3565          20 KDENYWDCSVCTYRNVAEAFKCSMCDVRKGT   50 (168)
Q Consensus        20 k~eg~WdCsvCt~rN~asA~KCv~C~tpk~~   50 (168)
                      -+||+|-|.-|++- ......|++|....+-
T Consensus       256 ipeg~WlCr~Cl~s-~~~~v~c~~cp~~~gA  285 (1051)
T KOG0955|consen  256 IPEGQWLCRRCLQS-PQRPVRCLLCPSKGGA  285 (1051)
T ss_pred             CCCCcEeehhhccC-cCcccceEeccCCCCc
Confidence            38999999999974 3333899999877654


No 23 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=34.39  E-value=15  Score=26.71  Aligned_cols=33  Identities=21%  Similarity=0.619  Sum_probs=12.6

Q ss_pred             hhhccCCCCceeccccceecc----------ccccceecCCCC
Q psy3565          15 RRKQAKDENYWDCSVCTYRNV----------AEAFKCSMCDVR   47 (168)
Q Consensus        15 ~kr~~k~eg~WdCsvCt~rN~----------asA~KCv~C~tp   47 (168)
                      +|+..+-+-.++|++|-..|.          ...+.|.+|+..
T Consensus        13 kk~~~~l~~~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~   55 (81)
T PF05129_consen   13 KKKKPKLPKVFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGES   55 (81)
T ss_dssp             -------SS----TTT--SS-EEEEEETTTTEEEEEESSS--E
T ss_pred             cCcCCCCCceEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCe
Confidence            344445677899999985544          456788888654


No 24 
>PF04313 HSDR_N:  Type I restriction enzyme R protein N terminus (HSDR_N);  InterPro: IPR007409 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type I restriction endonucleases are components of prokaryotic DNA restriction-modification mechanisms that protects the organism against invading foreign DNA. Type I enzymes have three different subunits subunits - M (modification), S (specificity) and R (restriction) - that form multifunctional enzymes with restriction (3.1.21.3 from EC), methylase (2.1.1.72 from EC) and ATPase activities [, ]. The S subunit is required for both restriction and modification and is responsible for recognition of the DNA sequence specific for the system. The M subunit is necessary for modification, and the R subunit is required for restriction. These enzymes use S-Adenosyl-L-methionine (AdoMet) as the methyl group donor in the methylation reaction, and have a requirement for ATP. They recognise asymmetric DNA sequences split into two domains of specific sequence, one 3-4 bp long and another 4-5 bp long, separated by a nonspecific spacer 6-8 bp in length. Cleavage occurs a considerable distance from the recognition sites, rarely less than 400 bp away and up to 7000 bp away. Adenosyl residues are methylated, one on each strand of the recognition sequence. These enzymes are widespread in eubacteria and archaea. In enteric bacteria they have been subdivide into four families: types IA, IB, IC and ID.  Type III restriction endonucleases (3.1.21.5 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. Type III enzymes are hetero-oligomeric, multifunctional proteins composed of two subunits, Res and Mod. The Mod subunit recognises the DNA sequence specific for the system and is a modification methyltransferase; as such it is functionally equivalent to the M and S subunits of type I restriction endonuclease. Res is required for restriction, although it has no enzymatic activity on its own. Type III enzymes recognise short 5-6 bp long asymmetric DNA sequences and cleave 25-27 bp downstream to leave short, single-stranded 5' protrusions. They require the presence of two inversely oriented unmethylated recognition sites for restriction to occur. These enzymes methylate only one strand of the DNA, at the N-6 position of adenosyl residues, so newly replicated DNA will have only one strand methylated, which is sufficient to protect against restriction. Type III enzymes belong to the beta-subfamily of N6 adenine methyltransferases, containing the nine motifs that characterise this family, including motif I, the AdoMet binding pocket (FXGXG), and motif IV, the catalytic region (S/D/N (PP) Y/F) [, ]. This entry represents the N-terminal domain found in both the R subunit (HsdR) of type I enzymes and the Res subunit of type III enzymes. The type I enzyme represented is EcoRI, which recognises the DNA sequence 5'-GAATTC; the R protein (HsdR) is required for both nuclease and ATPase activity [, , ]. This domain is often found adjacent to a methylase domain (IPR002052 from INTERPRO) in restriction endonucleases or methylases. In one of the proteins, Q97RD0 from SWISSPROT, it is adjacent to a helicase domain (IPR011545 from INTERPRO) in a putative restriction endonuclease.; GO: 0003677 DNA binding, 0004519 endonuclease activity, 0006304 DNA modification; PDB: 2Y3T_B 2W74_B 2W00_B.
Probab=34.24  E-value=41  Score=26.69  Aligned_cols=19  Identities=26%  Similarity=0.452  Sum_probs=14.9

Q ss_pred             eEEEEeCCeeEEEeeccCC
Q psy3565         117 TLEITVNNLTVKVTEFKPK  135 (168)
Q Consensus       117 ~~eVTVg~vTViITefK~K  135 (168)
                      -+-+.|||++|+|.|+|--
T Consensus       125 D~vLfvNGlPl~~iE~K~~  143 (194)
T PF04313_consen  125 DIVLFVNGLPLAIIELKSP  143 (194)
T ss_dssp             EEEEEETTEEEEEEEE--T
T ss_pred             eEEEEECCeEEEEEEecCC
Confidence            4678999999999999865


No 25 
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=33.16  E-value=22  Score=29.08  Aligned_cols=20  Identities=20%  Similarity=0.546  Sum_probs=16.2

Q ss_pred             CCCCceeccccceecccccc
Q psy3565          20 KDENYWDCSVCTYRNVAEAF   39 (168)
Q Consensus        20 k~eg~WdCsvCt~rN~asA~   39 (168)
                      -.+|.|-|+.|.........
T Consensus        14 ~P~g~W~Cp~C~~~~~~~~~   33 (148)
T cd04718          14 VPEGDWICPFCEVEKSGQSA   33 (148)
T ss_pred             CCCCCcCCCCCcCCCCCCcc
Confidence            37899999999988765555


No 26 
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=32.01  E-value=30  Score=32.13  Aligned_cols=29  Identities=28%  Similarity=0.598  Sum_probs=23.2

Q ss_pred             CCCceeccccceecc-------------------ccccceecCCCCCC
Q psy3565          21 DENYWDCSVCTYRNV-------------------AEAFKCSMCDVRKG   49 (168)
Q Consensus        21 ~eg~WdCsvCt~rN~-------------------asA~KCv~C~tpk~   49 (168)
                      ....|-|.+|-|.=.                   |....|..|+.+|.
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~~k~  469 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKD  469 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCCcHH
Confidence            567899999988654                   44679999999874


No 27 
>PF07562 NCD3G:  Nine Cysteines Domain of family 3 GPCR;  InterPro: IPR011500 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  GPCR family 3 receptors (also known as family C) are structurally similar to other GPCRs, but do not show any significant sequence similarity and thus represent a distinct group. Structurally they are composed of four elements; an N-terminal signal sequence; a large hydrophilic extracellular agonist-binding region containing several conserved cysteine residues which could be involved in disulphide bonds; a shorter region containing seven transmembrane domains; and a C-terminal cytoplasmic domain of variable length []. Family 3 members include the metabotropic glutamate receptors, the extracellular calcium-sensing receptors, the gamma-amino-butyric acid (GABA) type B receptors, and the vomeronasal type-2 receptors [, , , ]. As these receptors regulate many important physiological processes they are potentially promising targets for drug development. This entry represents a conserved sequence, found in the extracellular region, that contains several highly-conserved Cys residues that are predicted to form disulphide bridges.; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 2E4X_B 2E4Y_A 2E4U_B 2E4V_B 2E4W_A.
Probab=30.24  E-value=22  Score=23.64  Aligned_cols=25  Identities=28%  Similarity=0.830  Sum_probs=14.1

Q ss_pred             CCCceecccc---ceeccccccceecCC
Q psy3565          21 DENYWDCSVC---TYRNVAEAFKCSMCD   45 (168)
Q Consensus        21 ~eg~WdCsvC---t~rN~asA~KCv~C~   45 (168)
                      ..==|+|.-|   +|.|...+..|+.|.
T Consensus        22 ~~CCw~C~~C~~~~is~~~~~~~C~~C~   49 (54)
T PF07562_consen   22 PSCCWDCVPCPEGEISNQTDSTSCTKCP   49 (54)
T ss_dssp             S-S--EEEE--TTEEEE--ETTEEEE--
T ss_pred             cceEEEeecCCCCcEECCCCccccccCC
Confidence            3345999999   478888899999995


No 28 
>PF06153 DUF970:  Protein of unknown function (DUF970);  InterPro: IPR010375 This is a family of uncharacterised bacterial proteins.; PDB: 3M05_A.
Probab=28.19  E-value=56  Score=25.44  Aligned_cols=24  Identities=21%  Similarity=0.192  Sum_probs=11.2

Q ss_pred             CCCcCCCCceEEEEeCCeeEEEee
Q psy3565         108 KHVDRTTAQTLEITVNNLTVKVTE  131 (168)
Q Consensus       108 KnVDRSSAq~~eVTVg~vTViITe  131 (168)
                      .+.+.-.....+|+||+-||.+.|
T Consensus        79 ~~~~~~~~~pveV~vGGATVFVl~  102 (109)
T PF06153_consen   79 ESGEMYIPYPVEVEVGGATVFVLD  102 (109)
T ss_dssp             ----------EEEEE--EEEEEEE
T ss_pred             CCcccccccceEEEEcccEEEEEE
Confidence            456677788999999999999976


No 29 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=25.23  E-value=35  Score=33.50  Aligned_cols=23  Identities=22%  Similarity=0.566  Sum_probs=18.8

Q ss_pred             eccccceeccccccceecCCCCC
Q psy3565          26 DCSVCTYRNVAEAFKCSMCDVRK   48 (168)
Q Consensus        26 dCsvCt~rN~asA~KCv~C~tpk   48 (168)
                      -|+-|-+.|.+.+.-|..|+++=
T Consensus         3 ~Cp~Cg~~n~~~akFC~~CG~~l   25 (645)
T PRK14559          3 ICPQCQFENPNNNRFCQKCGTSL   25 (645)
T ss_pred             cCCCCCCcCCCCCccccccCCCC
Confidence            48888888888888888888773


No 30 
>KOG0954|consensus
Probab=22.29  E-value=60  Score=33.29  Aligned_cols=49  Identities=24%  Similarity=0.445  Sum_probs=35.6

Q ss_pred             CCCceeccccceeccccccceecCCCCCCCCCCCCCCCccchhhhhccCCcCCC
Q psy3565          21 DENYWDCSVCTYRNVAEAFKCSMCDVRKGTSTRKPRITPDLVAQVTQQYPVPAT   74 (168)
Q Consensus        21 ~eg~WdCsvCt~rN~asA~KCv~C~tpk~~strk~r~~s~lvaQq~~qq~~~~~   74 (168)
                      .+|+|-|..|-..   .--.|+.|  |+.+--.|+.....--|+..--++.|.-
T Consensus       309 p~gpWlCr~Calg---~~ppCvLC--PkkGGamK~~~sgT~wAHvsCALwIPEV  357 (893)
T KOG0954|consen  309 PEGPWLCRTCALG---IEPPCVLC--PKKGGAMKPTKSGTKWAHVSCALWIPEV  357 (893)
T ss_pred             CCCCeeehhcccc---CCCCeeec--cccCCcccccCCCCeeeEeeeeecccee
Confidence            6799999999998   56689999  5555557777777766655555666543


No 31 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=22.15  E-value=39  Score=21.29  Aligned_cols=14  Identities=29%  Similarity=0.805  Sum_probs=9.6

Q ss_pred             Cceeccccceeccc
Q psy3565          23 NYWDCSVCTYRNVA   36 (168)
Q Consensus        23 g~WdCsvCt~rN~a   36 (168)
                      ..|-|.+|...|..
T Consensus        23 ~~w~C~~C~~~N~l   36 (40)
T PF04810_consen   23 KTWICNFCGTKNPL   36 (40)
T ss_dssp             TEEEETTT--EEE-
T ss_pred             CEEECcCCCCcCCC
Confidence            47999999999864


No 32 
>PF04071 zf-like:  Cysteine-rich small domain;  InterPro: IPR007212 This is a probable metal-binding domain. It is found in a probable precorrin-3B C17-methyltransferase from Methanobacterium thermoautotrophicum, that catalyses the methylation of C-17 in precorrin-3B to form precorrin-4.
Probab=21.53  E-value=27  Score=26.21  Aligned_cols=22  Identities=32%  Similarity=0.752  Sum_probs=16.8

Q ss_pred             CCC--ceeccccceecccccccee
Q psy3565          21 DEN--YWDCSVCTYRNVAEAFKCS   42 (168)
Q Consensus        21 ~eg--~WdCsvCt~rN~asA~KCv   42 (168)
                      +.|  -|||+-|++-..++....+
T Consensus        46 ~~G~~vw~C~~C~~~H~~e~~~~i   69 (86)
T PF04071_consen   46 KNGSKVWDCSDCTLPHRPENYDYI   69 (86)
T ss_pred             CCCCeeeECccCCCccCHHHHHHH
Confidence            456  7999999998887765544


No 33 
>smart00837 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-barrel. Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.
Probab=21.37  E-value=96  Score=22.70  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=10.1

Q ss_pred             CeeEEEeeccCC
Q psy3565         124 NLTVKVTEFKPK  135 (168)
Q Consensus       124 ~vTViITefK~K  135 (168)
                      .|+|.||||=|-
T Consensus        35 ~V~V~vtd~CP~   46 (87)
T smart00837       35 SITVTATNFCPP   46 (87)
T ss_pred             eEEEEEeccCCc
Confidence            699999999763


No 34 
>KOG0956|consensus
Probab=20.53  E-value=48  Score=33.88  Aligned_cols=30  Identities=23%  Similarity=0.711  Sum_probs=26.6

Q ss_pred             CCCceeccccceeccccccceecCCCCCCC
Q psy3565          21 DENYWDCSVCTYRNVAEAFKCSMCDVRKGT   50 (168)
Q Consensus        21 ~eg~WdCsvCt~rN~asA~KCv~C~tpk~~   50 (168)
                      ..|.|.|.-|.-+-.+.-+.|..|-..-+-
T Consensus        45 PtGpWfCrKCesqeraarvrCeLCP~kdGA   74 (900)
T KOG0956|consen   45 PTGPWFCRKCESQERAARVRCELCPHKDGA   74 (900)
T ss_pred             CCCchhhhhhhhhhhhccceeecccCcccc
Confidence            689999999999999999999999666544


No 35 
>KOG0699|consensus
Probab=20.26  E-value=55  Score=31.44  Aligned_cols=16  Identities=50%  Similarity=0.667  Sum_probs=13.0

Q ss_pred             eCCeeEEEeeccCCcC
Q psy3565         122 VNNLTVKVTEFKPKIK  137 (168)
Q Consensus       122 Vg~vTViITefK~K~~  137 (168)
                      -.|.|||||-||.|++
T Consensus       492 CDNMT~ii~~Fkrk~~  507 (542)
T KOG0699|consen  492 CDNMTVIITTFKRKSK  507 (542)
T ss_pred             CCcceEEEEEeccchh
Confidence            3589999999996654


Done!