Diaphorina citri psyllid: psy3569


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MNEPRCQIKRNKQFNAAVYPQIWYWVKCVYLLLSAYQIRSGYPTRILGNFLCKNYNYLNKFLFKGSLFPFSYISQAQVPVPFLVMLILQFALIVVDRTLYLRKFILGKIVFQFLLVFGVHAWMFFILPAVTERQFNAAVYPQIWYWVKCVYLLLSAYQIRSGYPTRILGNFLCKNYNYLNKFLFKGFMMVPFVFELRALMDWMWTDTSMTLWDWLKMEDIYAHIFQLK
cccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc
******Q*KRNKQFNAAVYPQIWYWVKCVYLLLSAYQIRSGYPTRILGNFLCKNYNYLNKFLFKGSLFPFSYISQAQVPVPFLVMLILQFALIVVDRTLYLRKFILGKIVFQFLLVFGVHAWMFFILPAVTERQFNAAVYPQIWYWVKCVYLLLSAYQIRSGYPTRILGNFLCKNYNYLNKFLFKGFMMVPFVFELRALMDWMWTDTSMTLWDWLKMEDIYAHIFQLK
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEPRCQIKRNKQFNAAVYPQIWYWVKCVYLLLSAYQIRSGYPTRILGNFLCKNYNYLNKFLFKGSLFPFSYISQAQVPVPFLVMLILQFALIVVDRTLYLRKFILGKIVFQFLLVFGVHAWMFFILPAVTERQFNAAVYPQIWYWVKCVYLLLSAYQIRSGYPTRILGNFLCKNYNYLNKFLFKGFMMVPFVFELRALMDWMWTDTSMTLWDWLKMEDIYAHIFQLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Piezo-type mechanosensitive ion channel component 2 Component of mechanosensitive channel required for rapidly adaptating mechanically activated (MA) currents in DRG neurons. Overexpression in multiple cell lines generates robust mechanosensitive cation currents that are non-selective, exhibit a linear current voltage relationship, and are sensitive to ruthenium red and gadolinium.confidentQ8CD54
Piezo-type mechanosensitive ion channel component 2 Component of mechanosensitive channel required for rapidly adaptating mechanically activated (MA) currents in DRG neurons.confidentQ9H5I5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008381 [MF]mechanically-gated ion channel activityprobableGO:0022891, GO:0015075, GO:0022892, GO:0005215, GO:0005216, GO:0022833, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022803, GO:0022839, GO:0022838
GO:0005261 [MF]cation channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009612 [BP]response to mechanical stimulusprobableGO:0009628, GO:0050896, GO:0008150, GO:0009605
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted