Query         psy357
Match_columns 132
No_of_seqs    167 out of 1395
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:01:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy357.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/357hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3526|consensus              100.0 4.7E-31   1E-35  214.7   5.6  122    1-132    91-212 (629)
  2 cd04059 Peptidases_S8_Protein_  99.9 1.6E-21 3.6E-26  153.3   8.1   88   43-132     1-88  (297)
  3 PTZ00262 subtilisin-like prote  99.7 7.1E-17 1.5E-21  139.3   6.4   76   40-132   284-382 (639)
  4 cd07484 Peptidases_S8_Thermita  99.6 2.2E-15 4.7E-20  116.7   6.2   72   42-132     1-72  (260)
  5 cd07489 Peptidases_S8_5 Peptid  99.3 3.5E-12 7.5E-17  101.5   5.6   63   70-132     2-72  (312)
  6 cd07475 Peptidases_S8_C5a_Pept  99.2 2.1E-11 4.6E-16   98.0   4.3   58   72-132     1-86  (346)
  7 cd04077 Peptidases_S8_PCSK9_Pr  99.2 1.7E-11 3.7E-16   94.7   3.3   66   52-132     1-67  (255)
  8 cd07485 Peptidases_S8_Fervidol  99.1 7.6E-11 1.7E-15   92.2   4.1   60   72-132     1-65  (273)
  9 cd04843 Peptidases_S8_11 Pepti  99.0   3E-10 6.5E-15   89.9   5.2   37   68-104     2-39  (277)
 10 cd07483 Peptidases_S8_Subtilis  99.0 2.5E-10 5.4E-15   90.6   4.4   24   81-104     1-24  (291)
 11 KOG3525|consensus               99.0 4.3E-10 9.3E-15   94.2   5.2   84   45-132     1-84  (431)
 12 cd07479 Peptidases_S8_SKI-1_li  99.0 3.4E-10 7.3E-15   88.3   3.2   49   74-132     1-49  (255)
 13 cd07497 Peptidases_S8_14 Pepti  99.0 5.4E-10 1.2E-14   89.9   4.4   24   80-103     1-24  (311)
 14 cd04852 Peptidases_S8_3 Peptid  98.9 6.3E-10 1.4E-14   88.5   4.0   30   73-102    22-51  (307)
 15 cd07491 Peptidases_S8_7 Peptid  98.9 1.1E-09 2.4E-14   85.3   3.9   51   80-132     2-53  (247)
 16 cd07494 Peptidases_S8_10 Pepti  98.8 4.4E-09 9.6E-14   84.0   5.6   34   67-101     7-40  (298)
 17 cd07480 Peptidases_S8_12 Pepti  98.8 2.3E-09   5E-14   85.0   3.8   48   76-132     3-50  (297)
 18 cd07476 Peptidases_S8_thiazoli  98.8 3.6E-09 7.7E-14   83.3   3.5   31   73-103     2-32  (267)
 19 cd07474 Peptidases_S8_subtilis  98.8 4.3E-09 9.3E-14   82.6   3.9   53   80-132     1-66  (295)
 20 cd04842 Peptidases_S8_Kp43_pro  98.8 4.7E-09   1E-13   82.2   3.6   28   76-103     2-29  (293)
 21 cd07493 Peptidases_S8_9 Peptid  98.8 5.5E-09 1.2E-13   81.2   3.5   46   82-132     1-51  (261)
 22 cd07473 Peptidases_S8_Subtilis  98.7 7.5E-09 1.6E-13   79.8   3.8   24   81-104     2-25  (259)
 23 cd07481 Peptidases_S8_Bacillop  98.7 1.1E-08 2.3E-13   79.7   4.4   25   80-104     1-25  (264)
 24 cd07478 Peptidases_S8_CspA-lik  98.7 8.2E-09 1.8E-13   87.0   3.9   24   78-101     1-24  (455)
 25 cd07496 Peptidases_S8_13 Pepti  98.7 9.5E-09 2.1E-13   80.8   3.7   31   82-114     1-31  (285)
 26 cd07492 Peptidases_S8_8 Peptid  98.7 2.1E-08 4.5E-13   76.0   3.9   48   82-132     1-48  (222)
 27 cd07490 Peptidases_S8_6 Peptid  98.6 4.4E-08 9.5E-13   75.3   4.1   47   82-132     1-47  (254)
 28 cd04848 Peptidases_S8_Autotran  98.6 4.1E-08 8.8E-13   75.1   3.8   50   79-132     1-50  (267)
 29 cd07487 Peptidases_S8_1 Peptid  98.6 4.2E-08 9.1E-13   75.5   3.8   48   80-132     1-48  (264)
 30 cd07498 Peptidases_S8_15 Pepti  98.6 4.3E-08 9.3E-13   75.0   3.5   44   83-132     1-44  (242)
 31 cd07482 Peptidases_S8_Lantibio  98.5 1.5E-07 3.1E-12   73.7   4.4   24   82-105     1-24  (294)
 32 cd07477 Peptidases_S8_Subtilis  98.4 1.6E-07 3.5E-12   70.9   3.5   44   82-132     1-44  (229)
 33 cd05562 Peptidases_S53_like Pe  98.4 1.3E-07 2.8E-12   74.9   2.8   21   77-97      1-21  (275)
 34 PF00082 Peptidase_S8:  Subtila  98.2 5.2E-07 1.1E-11   69.8   1.6   46   84-132     1-50  (282)
 35 COG1404 AprE Subtilisin-like s  98.1 4.5E-06 9.8E-11   67.9   5.7   59   68-132   127-187 (508)
 36 KOG4266|consensus               97.9 1.2E-05 2.7E-10   70.0   4.2   36   67-102   187-222 (1033)
 37 KOG1153|consensus               97.8   2E-05 4.2E-10   66.3   3.2   45   79-132   217-261 (501)
 38 cd00306 Peptidases_S8_S53 Pept  97.6 8.5E-05 1.8E-09   55.0   3.7   45   83-132     1-48  (241)
 39 cd04857 Peptidases_S8_Tripepti  97.4 0.00012 2.7E-09   61.3   3.3   36   66-101     6-43  (412)
 40 cd05561 Peptidases_S8_4 Peptid  97.3 0.00013 2.8E-09   56.3   2.3   22   83-104     1-22  (239)
 41 cd04847 Peptidases_S8_Subtilis  97.3 0.00017 3.7E-09   56.9   2.5   27   84-110     2-28  (291)
 42 KOG1114|consensus               92.0     0.1 2.3E-06   48.1   2.3   34   68-101    66-101 (1304)
 43 COG4934 Predicted protease [Po  33.8      27 0.00058   33.5   1.8   32   69-100   216-248 (1174)
 44 PF08195 TRI9:  TRI9 protein;    24.6      20 0.00044   20.2  -0.3   10    2-11     12-21  (43)

No 1  
>KOG3526|consensus
Probab=99.97  E-value=4.7e-31  Score=214.70  Aligned_cols=122  Identities=66%  Similarity=1.114  Sum_probs=114.5

Q ss_pred             CCCCCceeEEEeccceeeecccCcCCcccccccceeeccCCCCCCCCCCcccccccCCCCCCCccccCChHHHHhcCCCC
Q psy357            1 MVHMEQVHQAVQQSGFKRVKRGYKPLKVENLVPDIVMKESQDPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGVTG   80 (132)
Q Consensus         1 ~~~~~~v~~~~~q~~~~r~kR~~~~~~~~~~~p~~~~~~~~~p~Dp~~~~QW~L~~~g~~~~~~g~~i~~~~aw~~~~~g   80 (132)
                      |..+|+|+-++||..+.|.||+++++..          ....-+||+|.+||||.|+||.+|+++.|+|+.+||.+|++|
T Consensus        91 l~~dp~v~~a~qq~gf~r~krgyrp~~~----------fd~~~~dplf~~qwylkntgqaggk~rldlnv~~awa~g~tg  160 (629)
T KOG3526|consen   91 LHNDPEVKMALQQEGFDRKKRGYRPINE----------FDINMNDPLFTKQWYLKNTGQAGGKPRLDLNVAEAWALGYTG  160 (629)
T ss_pred             hccChhHhhhhhccccchhhccCCchhh----------hccccCCcccceeeeeecccccCCcccccccHHHHHhhcccC
Confidence            4578999999999999999999988753          223457999999999999999999999999999999999999


Q ss_pred             CceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           81 RNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        81 ~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      |+|++||+|+|||+.||||+.|+...+||||.++|+-|+|+|.++..|+|||
T Consensus       161 knvttaimddgvdymhpdlk~nynaeasydfssndpfpyprytddwfnshgt  212 (629)
T KOG3526|consen  161 KNVTTAIMDDGVDYMHPDLKSNYNAEASYDFSSNDPFPYPRYTDDWFNSHGT  212 (629)
T ss_pred             CCceEEeecCCchhcCcchhcccCceeecccccCCCCCCCcccchhhhccCc
Confidence            9999999999999999999999999999999999999999999999999998


No 2  
>cd04059 Peptidases_S8_Protein_convertases_Kexins_Furin-like Peptidase S8 family domain in Protein convertases. Protein convertases, whose members include furins and kexins, are members of the peptidase S8 or Subtilase clan of proteases. They have an Asp/His/Ser catalytic triad that is not homologous to trypsin. Kexins are involved in the activation of peptide hormones, growth factors, and viral proteins.  Furin cleaves cell surface vasoactive peptides and proteins involved in cardiovascular tissue remodeling in the TGN, at cell surface, or in endosomes but rarely in the ER.  Furin also plays a key role in blood pressure regulation though the activation of transforming growth factor (TGF)-beta. High specificity is seen for cleavage after dibasic (Lys-Arg or Arg-Arg) or multiple basic residues in protein convertases.  There is also strong sequence conservation.
Probab=99.85  E-value=1.6e-21  Score=153.34  Aligned_cols=88  Identities=59%  Similarity=1.108  Sum_probs=80.2

Q ss_pred             CCCCCCCcccccccCCCCCCCccccCChHHHHhcCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCC
Q psy357           43 PSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRY  122 (132)
Q Consensus        43 p~Dp~~~~QW~L~~~g~~~~~~g~~i~~~~aw~~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~  122 (132)
                      ||||++.+||+|++.++.+++.+.+|++..+|+.+++|++|+|||||+||+..||||++++....+|+|..++.++.|..
T Consensus         1 ~~dp~~~~qw~l~~~~~~~~~~~~~~~~~~~w~~g~~G~gv~VaViDtGv~~~h~~l~~~~~~~~~~~~~~~~~~~~~~~   80 (297)
T cd04059           1 PNDPLFPYQWYLKNTGQAGGTPGLDLNVTPAWEQGITGKGVTVAVVDDGLEITHPDLKDNYDPEASYDFNDNDPDPTPRY   80 (297)
T ss_pred             CCCcccccccccccCCCCCCCCCCCcccHHHHhCCCCCcceEEEEEeCCcccCCHhHhhcccccccccccCCCCCCCCcc
Confidence            79999999999999999999999999999999999999999999999999999999999987778999998877776654


Q ss_pred             CCCCCCCCCC
Q psy357          123 TDDWFNRWNN  132 (132)
Q Consensus       123 ~~~~~~~HGT  132 (132)
                        .+.++|||
T Consensus        81 --~~~~gHGT   88 (297)
T cd04059          81 --DDDNSHGT   88 (297)
T ss_pred             --ccccccCc
Confidence              24569998


No 3  
>PTZ00262 subtilisin-like protease; Provisional
Probab=99.67  E-value=7.1e-17  Score=139.29  Aligned_cols=76  Identities=22%  Similarity=0.295  Sum_probs=63.1

Q ss_pred             CCCCCCCCCCcccccccCCCCCCCccccCChHHHHhc--CCCCCceEEEEeeCCCCCCChhhhcccCC------------
Q psy357           40 SQDPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQ--GVTGRNITTAIMDDGVDYMHMDLKNNYNA------------  105 (132)
Q Consensus        40 ~~~p~Dp~~~~QW~L~~~g~~~~~~g~~i~~~~aw~~--~~~g~~V~VaViDtGid~~HpDL~~~~~~------------  105 (132)
                      .+.+|||++..||+|..           ++++++|+.  +.+|++|+|||||||||++||||+++++.            
T Consensus       284 ~~~~ND~~~~~qWgLd~-----------i~~~~aw~~~~~~~g~gV~VAVIDTGID~~HPDL~~ni~~n~~el~GrdgiD  352 (639)
T PTZ00262        284 KYQFNDEGRNLQWGLDL-----------TRLDETQELIEPHEVNDTNICVIDSGIDYNHPDLHDNIDVNVKELHGRKGID  352 (639)
T ss_pred             ccccCCCCcccCcCcch-----------hCchHHHHHhhccCCCCcEEEEEccCCCCCChhhhhhcccccccccCccccc
Confidence            46799999999999986           778999985  45789999999999999999999988743            


Q ss_pred             ---------CCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357          106 ---------KASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus       106 ---------~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                               ..||||++++.+|+      +.++|||
T Consensus       353 dD~nG~vdd~~G~nfVd~~~~P~------D~~GHGT  382 (639)
T PTZ00262        353 DDNNGNVDDEYGANFVNNDGGPM------DDNYHGT  382 (639)
T ss_pred             cccCCcccccccccccCCCCCCC------CCCCcch
Confidence                     24678887776663      4579998


No 4  
>cd07484 Peptidases_S8_Thermitase_like Peptidase S8 family domain in Thermitase-like proteins. Thermitase is a non-specific, trypsin-related serine protease with a very high specific activity.  It contains a subtilisin like domain. The tertiary structure of thermitase is similar to that of subtilisin BPN'.  It contains a Asp/His/Ser catalytic triad. Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) clan include endopeptidases and  exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin.  The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid
Probab=99.59  E-value=2.2e-15  Score=116.67  Aligned_cols=72  Identities=35%  Similarity=0.631  Sum_probs=60.8

Q ss_pred             CCCCCCCCcccccccCCCCCCCccccCChHHHHhcCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCC
Q psy357           42 DPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPR  121 (132)
Q Consensus        42 ~p~Dp~~~~QW~L~~~g~~~~~~g~~i~~~~aw~~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~  121 (132)
                      +|+||+|.+||+|..           ++++.+|..+ +|++|+|||||+||+.+||+|... ....+++|.+.+.++.  
T Consensus         1 ~~~~~~~~~~w~~~~-----------~~~~~~~~~~-~G~gv~I~viDsGi~~~h~~l~~~-~~~~~~~~~~~~~~~~--   65 (260)
T cd07484           1 TPNDPYYSYQWNLDQ-----------IGAPKAWDIT-GGSGVTVAVVDTGVDPTHPDLLKV-KFVLGYDFVDNDSDAM--   65 (260)
T ss_pred             CCCCcCcccCCCccc-----------cChHHHHhhc-CCCCCEEEEEeCCCCCCCcccccC-CcccceeccCCCCCCC--
Confidence            589999999999986           8899999998 999999999999999999998554 3457889987765532  


Q ss_pred             CCCCCCCCCCC
Q psy357          122 YTDDWFNRWNN  132 (132)
Q Consensus       122 ~~~~~~~~HGT  132 (132)
                          +..+|||
T Consensus        66 ----d~~~HGT   72 (260)
T cd07484          66 ----DDNGHGT   72 (260)
T ss_pred             ----CCCCcHH
Confidence                3468998


No 5  
>cd07489 Peptidases_S8_5 Peptidase S8 family domain, uncharacterized subfamily 5. gap in seq This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=99.30  E-value=3.5e-12  Score=101.53  Aligned_cols=63  Identities=29%  Similarity=0.530  Sum_probs=47.6

Q ss_pred             hHHHHhcCCCCCceEEEEeeCCCCCCChhhhcccCC----CCceeccCCCC----CCCCCCCCCCCCCCCC
Q psy357           70 VEAAWAQGVTGRNITTAIMDDGVDYMHMDLKNNYNA----KASYDFSSNDP----HPYPRYTDDWFNRWNN  132 (132)
Q Consensus        70 ~~~aw~~~~~g~~V~VaViDtGid~~HpDL~~~~~~----~~~~df~~~d~----~p~p~~~~~~~~~HGT  132 (132)
                      +..+|+.+++|++|+|||||+||+++||+|++++..    ..+|||+.++.    .+.+.....+.++|||
T Consensus         2 v~~~~~~g~tG~gv~VaViDsGid~~hp~l~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~d~~gHGT   72 (312)
T cd07489           2 VDKLHAEGITGKGVKVAVVDTGIDYTHPALGGCFGPGCKVAGGYDFVGDDYDGTNPPVPDDDPMDCQGHGT   72 (312)
T ss_pred             hhhHHhCCCCCCCCEEEEEECCCCCCChhhhcCCCCCceeccccccCCcccccccCCCCCCCCCCCCCcHH
Confidence            688999999999999999999999999999987643    45678875542    2222222234579998


No 6  
>cd07475 Peptidases_S8_C5a_Peptidase Peptidase S8 family domain in Streptococcal C5a peptidases. Streptococcal C5a peptidase (SCP), is a highly specific protease and adhesin/invasin.  The subtilisin-like protease domain is located at the N-terminus and contains a protease-associated domain inserted into a loop.  There are three fibronectin type III (Fn) domains at the C-terminus. SCP binds to integrins with the help of Arg-Gly-Asp motifs which are thought to stabilize conformational changes required for substrate binding.  Peptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intr
Probab=99.17  E-value=2.1e-11  Score=97.95  Aligned_cols=58  Identities=22%  Similarity=0.434  Sum_probs=46.1

Q ss_pred             HHHhcCC-CCCceEEEEeeCCCCCCChhhhcccCCC---------------------------CceeccCCCCCCCCCCC
Q psy357           72 AAWAQGV-TGRNITTAIMDDGVDYMHMDLKNNYNAK---------------------------ASYDFSSNDPHPYPRYT  123 (132)
Q Consensus        72 ~aw~~~~-~g~~V~VaViDtGid~~HpDL~~~~~~~---------------------------~~~df~~~d~~p~p~~~  123 (132)
                      ++|+.+. +|++|+||||||||+++||+|.++....                           .+|||++++.++.+   
T Consensus         1 ~~w~~~~~~G~gv~VaViDtGv~~~hp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---   77 (346)
T cd07475           1 PLWDKGGYKGEGMVVAVIDSGVDPTHDAFRLDDDSKAKYSEEFEAKKKKAGIGYGKYYNEKVPFAYNYADNNDDILD---   77 (346)
T ss_pred             ChhhhcCCCCCCcEEEEEeCCCCCCChhHccCCCcccccchhhhhhhhcccCCCCcccccCCCeeEcCCCCCCccCC---
Confidence            3799876 8999999999999999999998765443                           36888888777654   


Q ss_pred             CCCCCCCCC
Q psy357          124 DDWFNRWNN  132 (132)
Q Consensus       124 ~~~~~~HGT  132 (132)
                      ..+..+|||
T Consensus        78 ~~~~~~HGT   86 (346)
T cd07475          78 EDDGSSHGM   86 (346)
T ss_pred             CCCCCCcHH
Confidence            234579998


No 7  
>cd04077 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 family domain in ProteinaseK-like proteins. The peptidase S8 or Subtilase clan of proteases have a Asp/His/Ser catalytic triad that is not homologous to trypsin. This CD contains several members of this clan including: PCSK9 (Proprotein convertase subtilisin/kexin type 9), Proteinase_K, Proteinase_T, and other subtilisin-like serine proteases.  PCSK9 posttranslationally regulates hepatic low-density lipoprotein receptors (LDLRs) by binding to LDLRs on the cell surface, leading to their degradation. The binding site of PCSK9 has been localized to the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR. Characterized Proteinases K are secreted endopeptidases with a high degree of sequence conservation.  Proteinases K are not substrate-specific and function in a wide variety of species in different pathways. It can hydrolyze keratin and other proteins with subtilisin-like specificity. The number of calcium-binding moti
Probab=99.16  E-value=1.7e-11  Score=94.73  Aligned_cols=66  Identities=23%  Similarity=0.411  Sum_probs=49.4

Q ss_pred             cccccCCCCCCCccccCChHH-HHhcCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCC
Q psy357           52 WYLKNTGQNGGKAKLDLNVEA-AWAQGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRW  130 (132)
Q Consensus        52 W~L~~~g~~~~~~g~~i~~~~-aw~~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~H  130 (132)
                      |+|..+.+..      ..... +|..+++|++|+|||||+||+.+||+|+++..  .+++|...+.       ..+.++|
T Consensus         1 w~l~~~~~~~------~~~~~~~~~~~~~G~gv~VaViDsGi~~~h~~~~~~~~--~~~~~~~~~~-------~~d~~~H   65 (255)
T cd04077           1 WGLDRISQRD------LPLDGTYYYDSSTGSGVDVYVLDTGIRTTHVEFGGRAI--WGADFVGGDP-------DSDCNGH   65 (255)
T ss_pred             CCccccCCCC------CCCCCceEecCCCCCCcEEEEEcCCCCCCChhhhCCee--eeeecCCCCC-------CCCCCcc
Confidence            8887654421      22233 67778999999999999999999999999864  5788877543       2345799


Q ss_pred             CC
Q psy357          131 NN  132 (132)
Q Consensus       131 GT  132 (132)
                      ||
T Consensus        66 GT   67 (255)
T cd04077          66 GT   67 (255)
T ss_pred             HH
Confidence            98


No 8  
>cd07485 Peptidases_S8_Fervidolysin_like Peptidase S8 family domain in Fervidolysin. Fervidolysin found in Fervidobacterium pennivorans is an extracellular subtilisin-like keratinase.  It is contains a signal peptide, a propeptide, and a catalytic region. The tertiary structure of fervidolysin is similar to that of subtilisin.  It contains a Asp/His/Ser catalytic triad and is a member of the peptidase S8 (subtilisin and kexin) family. The catalytic triad is similar to that found in trypsin-like proteases, but it does not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin.  The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid has the same role here as the histidine base.   Howev
Probab=99.09  E-value=7.6e-11  Score=92.23  Aligned_cols=60  Identities=30%  Similarity=0.331  Sum_probs=41.7

Q ss_pred             HHHhcCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCC-----CCCCCCCCCCCCC
Q psy357           72 AAWAQGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPY-----PRYTDDWFNRWNN  132 (132)
Q Consensus        72 ~aw~~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~-----p~~~~~~~~~HGT  132 (132)
                      ++|..+++|++|+||||||||+.+||+|+++.. ..+|+...+...+.     +.....+.++|||
T Consensus         1 ~aw~~g~~G~gv~IaviDtGid~~Hp~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~gHGT   65 (273)
T cd07485           1 AAWEFGTGGPGIIVAVVDTGVDGTHPDLQGNGD-GDGYDPAVNGYNFVPNVGDIDNDVSVGGGHGT   65 (273)
T ss_pred             CccccccCCCCcEEEEEeCCCCCCChhhccCCC-CCCcccccCCcccccccCCcCCCCCCCCCCHH
Confidence            479999999999999999999999999999832 23444433333222     0111234579998


No 9  
>cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=99.03  E-value=3e-10  Score=89.93  Aligned_cols=37  Identities=27%  Similarity=0.424  Sum_probs=33.3

Q ss_pred             CChHHHHhcCC-CCCceEEEEeeCCCCCCChhhhcccC
Q psy357           68 LNVEAAWAQGV-TGRNITTAIMDDGVDYMHMDLKNNYN  104 (132)
Q Consensus        68 i~~~~aw~~~~-~g~~V~VaViDtGid~~HpDL~~~~~  104 (132)
                      |++.+||+... .|++|+|+|||+||+.+||||++++.
T Consensus         2 i~~~~aw~~~~g~G~gV~VaviDtGid~~Hpdl~~~~~   39 (277)
T cd04843           2 INARYAWTKPGGSGQGVTFVDIEQGWNLNHEDLVGNGI   39 (277)
T ss_pred             CChHHHHHhcCCCCCcEEEEEecCCCCCCChhhccccc
Confidence            89999999853 48999999999999999999999864


No 10 
>cd07483 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 family domain in Subtilisin_Novo-like proteins. Subtilisins are a group of alkaline proteinases originating from different strains of Bacillus subtilis.  Novo is one of the strains that produced enzymes belonging to this group.  The enzymes obtained from the Novo and BPN' strains are identical.  The Carlsburg and Novo subtilisins are thought to have arisen from a common ancestral protein.  They have similar peptidase and esterase activities, pH profiles, catalyze transesterification reactions, and are both inhibited by diispropyl fluorophosphate, though they differ in 85 positions in the amino acid sequence.  Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a cat
Probab=99.02  E-value=2.5e-10  Score=90.55  Aligned_cols=24  Identities=38%  Similarity=0.607  Sum_probs=22.2

Q ss_pred             CceEEEEeeCCCCCCChhhhcccC
Q psy357           81 RNITTAIMDDGVDYMHMDLKNNYN  104 (132)
Q Consensus        81 ~~V~VaViDtGid~~HpDL~~~~~  104 (132)
                      ++|+|||||||||++||||+++++
T Consensus         1 ~~V~VaviDtGid~~Hpdl~~~~~   24 (291)
T cd07483           1 KTVIVAVLDSGVDIDHEDLKGKLW   24 (291)
T ss_pred             CceEEEEEeCCCCCCChhhhhhhh
Confidence            589999999999999999999875


No 11 
>KOG3525|consensus
Probab=99.00  E-value=4.3e-10  Score=94.23  Aligned_cols=84  Identities=38%  Similarity=0.692  Sum_probs=75.4

Q ss_pred             CCCCCcccccccCCCCCCCccccCChHHHHhcCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCC
Q psy357           45 DPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTD  124 (132)
Q Consensus        45 Dp~~~~QW~L~~~g~~~~~~g~~i~~~~aw~~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~  124 (132)
                      ||++..||||.+.+    ..+.++++..+|..+++|++++|+|+|+|+...||++..++.+..+|+++.++.+|.|..+.
T Consensus         1 ~~~~~~~w~l~~~~----~~~~d~~v~~~~~~~~~g~~~~~~i~ddgl~~~h~~~~~~~~~~~s~d~~~~~~~p~~~~~~   76 (431)
T KOG3525|consen    1 DPMSIHMWYLNAQE----FPGSDLNVQNAWCKGYTGTRVSVTILDDGLECSHPDLRNNYDPLGSYDVNRHDNDPEPRCDG   76 (431)
T ss_pred             CCCccceEEecCCc----cccccceeeeccccCCCCCceEEEEeeccccccCcccccccCcceeEeeecCCCCcccccCC
Confidence            68899999997643    34578999999999999999999999999999999999999999999999999999988776


Q ss_pred             CCCCCCCC
Q psy357          125 DWFNRWNN  132 (132)
Q Consensus       125 ~~~~~HGT  132 (132)
                      ...+.|||
T Consensus        77 ~~~~~~g~   84 (431)
T KOG3525|consen   77 TNENKHGT   84 (431)
T ss_pred             CCccccCC
Confidence            55678886


No 12 
>cd07479 Peptidases_S8_SKI-1_like Peptidase S8 family domain in SKI-1-like proteins. SKI-1 (type I membrane-bound subtilisin-kexin-isoenzyme) proteins are secretory Ca2+-dependent serine proteinases cleave at nonbasic residues: Thr, Leu, and Lys.  SKI-1s play a critical role in the regulation of the synthesis and metabolism of cholesterol and fatty acid metabolism.   Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme tem
Probab=98.97  E-value=3.4e-10  Score=88.34  Aligned_cols=49  Identities=22%  Similarity=0.338  Sum_probs=37.1

Q ss_pred             HhcCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           74 WAQGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        74 w~~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      |+++++|++|+|||||+||+..||||++..   ...+|.+..       ...+..+|||
T Consensus         1 W~~g~tG~gv~VaviDsGv~~~hp~l~~~~---~~~~~~~~~-------~~~d~~gHGT   49 (255)
T cd07479           1 WQLGYTGAGVKVAVFDTGLAKDHPHFRNVK---ERTNWTNEK-------TLDDGLGHGT   49 (255)
T ss_pred             CCCCCCCCCCEEEEEeCCCCCCCcchhccc---cccccCCCC-------CCCCCCCcHH
Confidence            888999999999999999999999998643   344554322       1124568998


No 13 
>cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.97  E-value=5.4e-10  Score=89.92  Aligned_cols=24  Identities=46%  Similarity=0.671  Sum_probs=22.3

Q ss_pred             CCceEEEEeeCCCCCCChhhhccc
Q psy357           80 GRNITTAIMDDGVDYMHMDLKNNY  103 (132)
Q Consensus        80 g~~V~VaViDtGid~~HpDL~~~~  103 (132)
                      |++|+|||||||||.+||||+++.
T Consensus         1 G~gV~VaViDTGid~~HPdl~~~~   24 (311)
T cd07497           1 GEGVVIAIVDTGVDYSHPDLDIYG   24 (311)
T ss_pred             CCCeEEEEEeCCcCCCChhHhccc
Confidence            789999999999999999998764


No 14 
>cd04852 Peptidases_S8_3 Peptidase S8 family domain, uncharacterized subfamily 3. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.95  E-value=6.3e-10  Score=88.48  Aligned_cols=30  Identities=17%  Similarity=0.265  Sum_probs=26.3

Q ss_pred             HHhcCCCCCceEEEEeeCCCCCCChhhhcc
Q psy357           73 AWAQGVTGRNITTAIMDDGVDYMHMDLKNN  102 (132)
Q Consensus        73 aw~~~~~g~~V~VaViDtGid~~HpDL~~~  102 (132)
                      +|..+++|++|+||||||||++.||+|++.
T Consensus        22 ~~~~~~~G~gv~VaViDtGid~~hp~f~~~   51 (307)
T cd04852          22 LLGAANAGEGIIIGVLDTGIWPEHPSFADV   51 (307)
T ss_pred             cccccCCCCccEEEEEeCCCCCCCcCcccC
Confidence            344588999999999999999999999764


No 15 
>cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.90  E-value=1.1e-09  Score=85.28  Aligned_cols=51  Identities=22%  Similarity=0.218  Sum_probs=35.9

Q ss_pred             CCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCC-CCCCCCCCCC
Q psy357           80 GRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRY-TDDWFNRWNN  132 (132)
Q Consensus        80 g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~-~~~~~~~HGT  132 (132)
                      +++|+|||||||||.+||||++++..  +++|...+.++.... ...+.++|||
T Consensus         2 ~~~V~VaVIDsGvd~~hpdl~~~i~~--~~~~~~~~~~~~~~~~~~~d~~gHGT   53 (247)
T cd07491           2 LKRIKVALIDDGVDILDSDLQGKIIG--GKSFSPYEGDGNKVSPYYVSADGHGT   53 (247)
T ss_pred             CCCCEEEEECCCcCCCchhhcccccc--CCCCCCCCCCcccCCCCCCCCCCcHH
Confidence            68999999999999999999999754  566665433221111 1124579998


No 16 
>cd07494 Peptidases_S8_10 Peptidase S8 family domain, uncharacterized subfamily 10. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.85  E-value=4.4e-09  Score=83.97  Aligned_cols=34  Identities=26%  Similarity=0.460  Sum_probs=31.1

Q ss_pred             cCChHHHHhcCCCCCceEEEEeeCCCCCCChhhhc
Q psy357           67 DLNVEAAWAQGVTGRNITTAIMDDGVDYMHMDLKN  101 (132)
Q Consensus        67 ~i~~~~aw~~~~~g~~V~VaViDtGid~~HpDL~~  101 (132)
                      .|++..+|+.+++|++|+||||||||+..|| |+.
T Consensus         7 ~l~~~~~~~~G~~G~Gv~VaViDTGv~~~h~-~~~   40 (298)
T cd07494           7 LLNATRVHQRGITGRGVRVAMVDTGFYAHPF-FES   40 (298)
T ss_pred             hcChhHHHhcCCCCCCcEEEEEeCCCcCCch-hhc
Confidence            4889999999999999999999999999998 554


No 17 
>cd07480 Peptidases_S8_12 Peptidase S8 family domain, uncharacterized subfamily 12. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.84  E-value=2.3e-09  Score=84.96  Aligned_cols=48  Identities=17%  Similarity=0.241  Sum_probs=37.7

Q ss_pred             cCCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           76 QGVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        76 ~~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      .+++|++|+|||||+||+.+||||+++..  ..++|.+...       ..+.++|||
T Consensus         3 ~~~tG~gv~VaVlDsGv~~~hp~l~~~~~--~~~~~~~~~~-------~~d~~gHGT   50 (297)
T cd07480           3 SPFTGAGVRVAVLDTGIDLTHPAFAGRDI--TTKSFVGGED-------VQDGHGHGT   50 (297)
T ss_pred             CCCCCCCCEEEEEcCCCCCCChhhcCCcc--cCcccCCCCC-------CCCCCCcHH
Confidence            46899999999999999999999998864  4667765432       124579998


No 18 
>cd07476 Peptidases_S8_thiazoline_oxidase_subtilisin-like_protease Peptidase S8 family domain in Thiazoline oxidase/subtilisin-like proteases. Thiazoline oxidase/subtilisin-like protease is produced by the symbiotic bacteria Prochloron spp. that inhabit didemnid family ascidians.  The cyclic peptides of the patellamide class found in didemnid extracts are now known to be synthesized by the Prochloron spp.  The prepatellamide is heterocyclized to form thiazole and oxazoline rings and the peptide is cleaved to form the two cyclic patellamides A and C.  Subtilases, or subtilisin-like serine proteases, have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution).
Probab=98.80  E-value=3.6e-09  Score=83.29  Aligned_cols=31  Identities=32%  Similarity=0.342  Sum_probs=28.8

Q ss_pred             HHhcCCCCCceEEEEeeCCCCCCChhhhccc
Q psy357           73 AWAQGVTGRNITTAIMDDGVDYMHMDLKNNY  103 (132)
Q Consensus        73 aw~~~~~g~~V~VaViDtGid~~HpDL~~~~  103 (132)
                      +|..+++|++|+|||||+||+.+||+|+++.
T Consensus         2 lw~~g~~g~gV~VaViDsGid~~hp~l~~~~   32 (267)
T cd07476           2 LFAFGGGDPRITIAILDGPVDRTHPCFRGAN   32 (267)
T ss_pred             ceeccCCCCCeEEEEeCCCcCCCChhhCCCc
Confidence            6999999999999999999999999999853


No 19 
>cd07474 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 family domain in Vpr-like proteins. The maturation of the peptide antibiotic (lantibiotic) subtilin in Bacillus subtilis ATCC 6633 includes posttranslational modifications of the propeptide and proteolytic cleavage of the leader peptide.  Vpr was identified as one of the proteases,  along with WprA, that are capable of processing subtilin.    Asp, Ser, His triadPeptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.80  E-value=4.3e-09  Score=82.61  Aligned_cols=53  Identities=28%  Similarity=0.504  Sum_probs=39.1

Q ss_pred             CCceEEEEeeCCCCCCChhhhcc----cCCCCceeccCCCCCCCCCCC---------CCCCCCCCC
Q psy357           80 GRNITTAIMDDGVDYMHMDLKNN----YNAKASYDFSSNDPHPYPRYT---------DDWFNRWNN  132 (132)
Q Consensus        80 g~~V~VaViDtGid~~HpDL~~~----~~~~~~~df~~~d~~p~p~~~---------~~~~~~HGT  132 (132)
                      |++|+|||||+||+++||+|++.    .....+|+|.....++.+...         ..+.++|||
T Consensus         1 G~gV~VaViDsGi~~~hp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HGT   66 (295)
T cd07474           1 GKGVKVAVIDTGIDYTHPDLGGPGFPNDKVKGGYDFVDDDYDPMDTRPYPSPLGDASAGDATGHGT   66 (295)
T ss_pred             CCCCEEEEEECCcCCCCcccccCCCCCCceeeeeECccCCCCcccccccccccccCCCCCCCCcHH
Confidence            79999999999999999999832    122468999887666554222         124679998


No 20 
>cd04842 Peptidases_S8_Kp43_protease Peptidase S8 family domain in Kp43 proteases. Kp43 proteases are members of the peptidase S8 or Subtilase clan of proteases. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution). Kp43 is topologically similar to kexin and furin both of which are proprotein convertases, but differ in amino acids sequence and the position of its C-terminal barrel.  Kp43 has 3 Ca2+ binding sites that differ from the corresponding sites in the other known subtilisin-like proteases.  KP-43 protease is known to be an oxidation-resistant protease when compared with the other subtilisin-like proteases
Probab=98.78  E-value=4.7e-09  Score=82.17  Aligned_cols=28  Identities=25%  Similarity=0.400  Sum_probs=25.5

Q ss_pred             cCCCCCceEEEEeeCCCCCCChhhhccc
Q psy357           76 QGVTGRNITTAIMDDGVDYMHMDLKNNY  103 (132)
Q Consensus        76 ~~~~g~~V~VaViDtGid~~HpDL~~~~  103 (132)
                      ++++|++|+|||||+||+++||||++..
T Consensus         2 ~g~tG~gv~VaviDtGi~~~hp~l~~~~   29 (293)
T cd04842           2 LGLTGKGQIVGVADTGLDTNHCFFYDPN   29 (293)
T ss_pred             CCcCCcCCEEEEEecCCCCCCCcccCCC
Confidence            5789999999999999999999998753


No 21 
>cd07493 Peptidases_S8_9 Peptidase S8 family domain, uncharacterized subfamily 9. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.76  E-value=5.5e-09  Score=81.17  Aligned_cols=46  Identities=24%  Similarity=0.359  Sum_probs=36.9

Q ss_pred             ceEEEEeeCCCCCCChhhh-----cccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           82 NITTAIMDDGVDYMHMDLK-----NNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        82 ~V~VaViDtGid~~HpDL~-----~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      ||+||||||||+.+||+|+     .+.....++||+++..++     ..+.++|||
T Consensus         1 Gv~VaviDsGi~~~h~~~~~~~~~~~~~i~~~~~~~~~~~~~-----~~~~~~HGT   51 (261)
T cd07493           1 GITIAVIDAGFPKVHEAFAFKHLFKNLRILGEYDFVDNSNNT-----NYTDDDHGT   51 (261)
T ss_pred             CCEEEEEccCCCccCcchhhhccccCCceeeeecCccCCCCC-----CCCCCCchh
Confidence            6899999999999999995     445556799999887655     124579998


No 22 
>cd07473 Peptidases_S8_Subtilisin_like Peptidase S8 family domain in Subtilisin-like proteins. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.75  E-value=7.5e-09  Score=79.80  Aligned_cols=24  Identities=46%  Similarity=0.764  Sum_probs=22.3

Q ss_pred             CceEEEEeeCCCCCCChhhhcccC
Q psy357           81 RNITTAIMDDGVDYMHMDLKNNYN  104 (132)
Q Consensus        81 ~~V~VaViDtGid~~HpDL~~~~~  104 (132)
                      ++|+|||||+||+++||+|+++++
T Consensus         2 ~~v~V~iiDtGid~~h~~l~~~~~   25 (259)
T cd07473           2 GDVVVAVIDTGVDYNHPDLKDNMW   25 (259)
T ss_pred             CCCEEEEEeCCCCCCChhhccccc
Confidence            689999999999999999999765


No 23 
>cd07481 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 family domain in BacillopeptidaseF-like proteins. Bacillus subtilis produces and secretes proteases and other types of exoenzymes at the end of the exponential phase of growth. The ones that make up this group is known as bacillopeptidase F, encoded by bpr,  a serine protease with high esterolytic activity which is inhibited by PMSF.  Like other members of the peptidases S8 family these have a Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity.
Probab=98.74  E-value=1.1e-08  Score=79.73  Aligned_cols=25  Identities=48%  Similarity=0.786  Sum_probs=23.1

Q ss_pred             CCceEEEEeeCCCCCCChhhhcccC
Q psy357           80 GRNITTAIMDDGVDYMHMDLKNNYN  104 (132)
Q Consensus        80 g~~V~VaViDtGid~~HpDL~~~~~  104 (132)
                      |++|+|||||+||+++||+|++++.
T Consensus         1 G~GV~VaViDsGi~~~hp~l~~~~~   25 (264)
T cd07481           1 GTGIVVANIDTGVDWTHPALKNKYR   25 (264)
T ss_pred             CCCcEEEEEeCCCCCCChhHhhccc
Confidence            7999999999999999999999753


No 24 
>cd07478 Peptidases_S8_CspA-like Peptidase S8 family domain in CspA-like proteins. GSP (germination-specific protease) converts the spore peptidoglycan hydrolase (SleC) precursor to an active enzyme during germination of Clostridium perfringens S40 spores.  Analysis of an enzyme fraction of GSP showed that it was composed of a gene cluster containing the processed forms of products of cspA, cspB, and cspC which are positioned in a tandem array just upstream of the 5' end of sleC. The amino acid sequences deduced from the nucleotide sequences of the csp genes showed significant similarity and showed a high degree of homology with those of the catalytic domain and the oxyanion binding region of subtilisin-like serine proteases.   Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure 
Probab=98.73  E-value=8.2e-09  Score=86.96  Aligned_cols=24  Identities=38%  Similarity=0.934  Sum_probs=22.4

Q ss_pred             CCCCceEEEEeeCCCCCCChhhhc
Q psy357           78 VTGRNITTAIMDDGVDYMHMDLKN  101 (132)
Q Consensus        78 ~~g~~V~VaViDtGid~~HpDL~~  101 (132)
                      ++|++|+|||||||||+.||||+.
T Consensus         1 ltG~GV~VaVIDtGId~~hp~F~~   24 (455)
T cd07478           1 LTGKGVLVGIIDTGIDYLHPEFRN   24 (455)
T ss_pred             CCCCceEEEEEECCCCCCCHHHcc
Confidence            479999999999999999999984


No 25 
>cd07496 Peptidases_S8_13 Peptidase S8 family domain, uncharacterized subfamily 13. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.72  E-value=9.5e-09  Score=80.85  Aligned_cols=31  Identities=35%  Similarity=0.605  Sum_probs=27.5

Q ss_pred             ceEEEEeeCCCCCCChhhhcccCCCCceeccCC
Q psy357           82 NITTAIMDDGVDYMHMDLKNNYNAKASYDFSSN  114 (132)
Q Consensus        82 ~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~  114 (132)
                      +|+||||||||+.+||+|++++.  .+|||+.+
T Consensus         1 gV~VaviDtGi~~~Hp~l~~~~~--~g~d~~~~   31 (285)
T cd07496           1 GVVVAVLDTGVLFHHPDLAGVLL--PGYDFISD   31 (285)
T ss_pred             CCEEEEecCCCCCCCcchhhccc--cCcccccC
Confidence            68999999999999999999874  58999754


No 26 
>cd07492 Peptidases_S8_8 Peptidase S8 family domain, uncharacterized subfamily 8. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.66  E-value=2.1e-08  Score=76.02  Aligned_cols=48  Identities=19%  Similarity=0.043  Sum_probs=31.1

Q ss_pred             ceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           82 NITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        82 ~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      +|+|||||+||+++||+|++++..  .++|..+.... ......+.++|||
T Consensus         1 gV~VaViDsGi~~~h~~l~~~~~~--~~~~~~~~~~~-~~~~~~d~~gHGT   48 (222)
T cd07492           1 GVRVAVIDSGVDTDHPDLGNLALD--GEVTIDLEIIV-VSAEGGDKDGHGT   48 (222)
T ss_pred             CCEEEEEeCCCCCCChhhhccccc--ccccccccccc-CCCCCCCCCCcHH
Confidence            689999999999999999998754  33332211110 0111234679998


No 27 
>cd07490 Peptidases_S8_6 Peptidase S8 family domain, uncharacterized subfamily 6. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.60  E-value=4.4e-08  Score=75.34  Aligned_cols=47  Identities=26%  Similarity=0.212  Sum_probs=31.9

Q ss_pred             ceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           82 NITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        82 ~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      ||+|||||+||+.+||||.+++..  ..+|..+...+.+  ...+.++|||
T Consensus         1 GV~VaviDsGv~~~hp~l~~~~~~--~~~~~~~~~~~~~--~~~d~~~HGT   47 (254)
T cd07490           1 GVTVAVLDTGVDADHPDLAGRVAQ--WADFDENRRISAT--EVFDAGGHGT   47 (254)
T ss_pred             CCEEEEEeCCCCCCCcchhcccCC--ceeccCCCCCCCC--CCCCCCCcHH
Confidence            699999999999999999998743  3445432211111  1234579998


No 28 
>cd04848 Peptidases_S8_Autotransporter_serine_protease_like Peptidase S8 family domain in Autotransporter serine proteases. Autotransporter serine proteases belong to Peptidase S8 or Subtilase family. Subtilases, or subtilisin-like serine proteases, have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution).  Autotransporters are a superfamily of outer membrane/secreted proteins of gram-negative bacteria.  The presence of these subtilisin-like domains in these autotransporters are may enable them to be auto-catalytic and may also serve to allow them to act as a maturation protease cleaving other outer membrane proteins at the cell surface.
Probab=98.59  E-value=4.1e-08  Score=75.14  Aligned_cols=50  Identities=14%  Similarity=0.268  Sum_probs=35.7

Q ss_pred             CCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           79 TGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        79 ~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      +|++|+|||||+||+.+||+|++.+.....+.+..+...+    ...+.++|||
T Consensus         1 tG~gv~VaiiDsG~~~~h~~l~~~~~~~~~~~~~~~~~~~----~~~~~~~HGT   50 (267)
T cd04848           1 TGAGVKVGVIDSGIDLSHPEFAGRVSEASYYVAVNDAGYA----SNGDGDSHGT   50 (267)
T ss_pred             CCCceEEEEEeCCCCCCCccccCcccccccccccccccCC----CCCCCCChHH
Confidence            5899999999999999999999998654444444332111    1124579998


No 29 
>cd07487 Peptidases_S8_1 Peptidase S8 family domain, uncharacterized subfamily 1. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.59  E-value=4.2e-08  Score=75.52  Aligned_cols=48  Identities=29%  Similarity=0.301  Sum_probs=33.3

Q ss_pred             CCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           80 GRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        80 g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      |++|+|||||+||+..||+|.++...  .+++.....   +.....+.++|||
T Consensus         1 G~gv~VaviDsGv~~~h~~l~~~~~~--~~~~~~~~~---~~~~~~d~~~HGT   48 (264)
T cd07487           1 GKGITVAVLDTGIDAPHPDFDGRIIR--FADFVNTVN---GRTTPYDDNGHGT   48 (264)
T ss_pred             CCCcEEEEEeCCCCCCCccccccccc--ccccccccc---CCCCCCCCCCchH
Confidence            79999999999999999999998753  444443211   1111224568998


No 30 
>cd07498 Peptidases_S8_15 Peptidase S8 family domain, uncharacterized subfamily 15. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=98.58  E-value=4.3e-08  Score=74.99  Aligned_cols=44  Identities=27%  Similarity=0.416  Sum_probs=34.6

Q ss_pred             eEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           83 ITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        83 V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      |+|||||+||+.+||+|+.+.....+|+|...+..+      .+.++|||
T Consensus         1 V~VaviDsGi~~~hp~l~~~~~~~~~~~~~~~~~~~------~~~~~HGT   44 (242)
T cd07498           1 VVVAIIDTGVDLNHPDLSGKPKLVPGWNFVSNNDPT------SDIDGHGT   44 (242)
T ss_pred             CEEEEecCCCCCCChhhccCcCccCCccccCCCCCC------CCCCCCHH
Confidence            789999999999999999965556788887655421      24569998


No 31 
>cd07482 Peptidases_S8_Lantibiotic_specific_protease Peptidase S8 family domain in Lantiobiotic (lanthionine-containing antibiotics) specific proteases. Lantiobiotic (lanthionine-containing antibiotics) specific proteases are very similar in structure to serine proteases.  Lantibiotics are ribosomally synthesised antimicrobial agents derived from ribosomally synthesised peptides with antimicrobial activities against Gram-positive bacteria. The proteases that cleave the N-terminal leader peptides from lantiobiotics include:  epiP, nsuP, mutP, and nisP.  EpiP, from Staphylococcus, is thought to cleave matured epidermin. NsuP, a dehydratase from Streptococcus and NisP, a membrane-anchored subtilisin-like serine protease from Lactococcus cleave nisin.  MutP is highly similar to epiP and nisP and is thought to process the prepeptide mutacin III of S. mutans. Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) clan include endopeptidases and  exopeptidases. The S8 family h
Probab=98.49  E-value=1.5e-07  Score=73.68  Aligned_cols=24  Identities=42%  Similarity=0.686  Sum_probs=21.4

Q ss_pred             ceEEEEeeCCCCCCChhhhcccCC
Q psy357           82 NITTAIMDDGVDYMHMDLKNNYNA  105 (132)
Q Consensus        82 ~V~VaViDtGid~~HpDL~~~~~~  105 (132)
                      +|+||||||||+.+||+|++++..
T Consensus         1 ~V~VaviDtGi~~~hp~l~~~~~~   24 (294)
T cd07482           1 KVTVAVIDSGIDPDHPDLKNSISS   24 (294)
T ss_pred             CcEEEEEeCCCCCCChhHhhcccc
Confidence            589999999999999999987643


No 32 
>cd07477 Peptidases_S8_Subtilisin_subset Peptidase S8 family domain in Subtilisin proteins. This group is composed of many different subtilisins: Pro-TK-subtilisin, subtilisin Carlsberg, serine protease Pb92 subtilisin, and BPN subtilisins just to name a few. Pro-TK-subtilisin is a serine protease from the hyperthermophilic archaeon Thermococcus kodakaraensis and consists of a signal peptide, a propeptide, and a mature domain.  TK-subtilisin is matured from pro-TK-subtilisin upon autoprocessing and degradation of the propeptide. Unlike other subtilisins though, the folding of the unprocessed form of pro-TK-subtilisin is induced by Ca2+ binding which is almost completed prior to autoprocessing. Ca2+ is required for activity unlike the bacterial subtilisins. The propeptide is not required for folding of the mature domain unlike the bacterial subtilases because of the stability produced from Ca2+ binding.  Subtilisin Carlsberg is extremely similar in structure to subtilisin BPN'/Novo thoug
Probab=98.44  E-value=1.6e-07  Score=70.93  Aligned_cols=44  Identities=27%  Similarity=0.368  Sum_probs=33.7

Q ss_pred             ceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           82 NITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        82 ~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      +|+|||||+||+.+||+|+.++.  .+++|......     ...+..+|||
T Consensus         1 gv~V~iiDsGv~~~h~~l~~~~~--~~~~~~~~~~~-----~~~~~~~HGT   44 (229)
T cd07477           1 GVKVAVIDTGIDSSHPDLKLNIV--GGANFTGDDNN-----DYQDGNGHGT   44 (229)
T ss_pred             CCEEEEEcCCCCCCChhHhcccc--CcccccCCCCC-----CCCCCCCCHH
Confidence            68999999999999999999874  47777776431     1124568998


No 33 
>cd05562 Peptidases_S53_like Peptidase domain in the S53 family. Members of the peptidase S53 (sedolisin) family include endopeptidases and exopeptidases. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of Asn in subtilisin. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Characterized sedolisins include Kumamolisin, an extracellular calcium-dependent thermostable endopeptidase from Bacillus. The enzyme is synthesized with a 188 amino acid N-terminal preprotein region which is cleaved after the extraction into the extracellular space with low pH. One kumamolysin paralog, kumamolisin-As, is believed to be a collagenase. TPP1 is a serine protease that functi
Probab=98.43  E-value=1.3e-07  Score=74.86  Aligned_cols=21  Identities=33%  Similarity=0.594  Sum_probs=18.9

Q ss_pred             CCCCCceEEEEeeCCCCCCCh
Q psy357           77 GVTGRNITTAIMDDGVDYMHM   97 (132)
Q Consensus        77 ~~~g~~V~VaViDtGid~~Hp   97 (132)
                      +++|++|+||||||||+..||
T Consensus         1 g~tG~gv~vaviDtGvd~~~~   21 (275)
T cd05562           1 GVDGTGIKIGVISDGFDGLGD   21 (275)
T ss_pred             CCCCCceEEEEEeCCcccccc
Confidence            579999999999999999655


No 34 
>PF00082 Peptidase_S8:  Subtilase family This is family S8 in the peptidase classification. ;  InterPro: IPR000209 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase families S8 (subfamilies S8A (subtilisin) and S8B (kexin)) and S53 (sedolisin) both of which are members of clan SB. The subtilisin family is the second largest serine protease family characterised to date. Over 200 subtilises are presently known, more than 170 of which with their complete amino acid sequence []. It is widespread, being found in eubacteria, archaebacteria, eukaryotes and viruses []. The vast majority of the family are endopeptidases, although there is an exopeptidase, tripeptidyl peptidase [, ]. Structures have been determined for several members of the subtilisin family: they exploit the same catalytic triad as the chymotrypsins, although the residues occur in a different order (HDS in chymotrypsin and DHS in subtilisin), but the structures show no other similarity [, ]. Some subtilisins are mosaic proteins, while others contain N- and C-terminal extensions that show no sequence similarity to any other known protein []. Based on sequence homology, a subdivision into six families has been proposed [].  The proprotein-processing endopeptidases kexin, furin and related enzymes form a distinct subfamily known as the kexin subfamily (S8B). These preferentially cleave C-terminally to paired basic amino acids. Members of this subfamily can be identified by subtly different motifs around the active site [, ]. Members of the kexin family, along with endopeptidases R, T and K from the yeast Tritirachium and cuticle-degrading peptidase from Metarhizium, require thiol activation. This can be attributed to the presence of Cys-173 near to the active histidine [].Only 1 viral member of the subtilisin family is known, a 56kDa protease from herpes virus 1, which infects the channel catfish [].  Sedolisins (serine-carboxyl peptidases) are proteolytic enzymes whose fold resembles that of subtilisin; however, they are considerably larger, with the mature catalytic domains containing approximately 375 amino acids. The defining features of these enzymes are a unique catalytic triad, Ser-Glu-Asp, as well as the presence of an aspartic acid residue in the oxyanion hole. High-resolution crystal structures have now been solved for sedolisin from Pseudomonas sp. 101, as well as for kumamolisin from a thermophilic bacterium, Bacillus sp. MN-32. Mutations in the human gene leads to a fatal neurodegenerative disease []. ; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 3EIF_A 1XF1_B 3F7M_A 3F7O_B 2QTW_B 2W2O_A 3GCX_A 3P5B_A 3M0C_B 2XTJ_A ....
Probab=98.21  E-value=5.2e-07  Score=69.85  Aligned_cols=46  Identities=30%  Similarity=0.550  Sum_probs=34.2

Q ss_pred             EEEEeeCCCCCCChhhh-cccCCC---CceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           84 TTAIMDDGVDYMHMDLK-NNYNAK---ASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        84 ~VaViDtGid~~HpDL~-~~~~~~---~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      +|||||+||+.+||+|+ +++...   .+|+|.++.....+   ..+.++|||
T Consensus         1 ~V~viDtGid~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~HGT   50 (282)
T PF00082_consen    1 KVAVIDTGIDPNHPDFSSGNFIWSKVPGGYNFVDGNPNPSP---SDDDNGHGT   50 (282)
T ss_dssp             EEEEEESBBTTTSTTTTCTTEEEEEEEEEEETTTTBSTTTS---SSTSSSHHH
T ss_pred             CEEEEcCCcCCCChhHccCCcccccccceeeccCCCCCcCc---cccCCCccc
Confidence            69999999999999999 776533   38999987632222   234568997


No 35 
>COG1404 AprE Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones]
Probab=98.13  E-value=4.5e-06  Score=67.88  Aligned_cols=59  Identities=37%  Similarity=0.466  Sum_probs=47.2

Q ss_pred             CChHHHHhc--CCCCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           68 LNVEAAWAQ--GVTGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        68 i~~~~aw~~--~~~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      +.....|..  +++|++|+|+|||+||+..||+|..+...  .++|+..+..+    ...+.++|||
T Consensus       127 ~~~~~~~~~~~~~~g~gv~~~vid~gv~~~~~~~~~~~~~--~~~~~~~~~~~----~~~d~~~hGt  187 (508)
T COG1404         127 ISVGALVANGAGLTGKGVTVAVIDTGVDASHPDLAGSAVA--GGDFVDGDPEP----PFLDDNGHGT  187 (508)
T ss_pred             cccccccccccCCCCCCeEEEEeccCCCCCChhhhccccc--ccccccCCCCC----CCCCCCCCcc
Confidence            566778886  88999999999999999999999998743  48888877664    1124578998


No 36 
>KOG4266|consensus
Probab=97.89  E-value=1.2e-05  Score=70.03  Aligned_cols=36  Identities=31%  Similarity=0.569  Sum_probs=33.1

Q ss_pred             cCChHHHHhcCCCCCceEEEEeeCCCCCCChhhhcc
Q psy357           67 DLNVEAAWAQGVTGRNITTAIMDDGVDYMHMDLKNN  102 (132)
Q Consensus        67 ~i~~~~aw~~~~~g~~V~VaViDtGid~~HpDL~~~  102 (132)
                      .+.++-+|++|++|++|+|||.|||+..+||-|++-
T Consensus       187 ~l~Ad~LWk~GyTGa~VkvAiFDTGl~~~HPHFrnv  222 (1033)
T KOG4266|consen  187 MLGADHLWKKGYTGAKVKVAIFDTGLRADHPHFRNV  222 (1033)
T ss_pred             HhchhhHHhccccCCceEEEEeecccccCCccccch
Confidence            467889999999999999999999999999999864


No 37 
>KOG1153|consensus
Probab=97.76  E-value=2e-05  Score=66.25  Aligned_cols=45  Identities=22%  Similarity=0.344  Sum_probs=34.6

Q ss_pred             CCCceEEEEeeCCCCCCChhhhcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           79 TGRNITTAIMDDGVDYMHMDLKNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        79 ~g~~V~VaViDtGid~~HpDL~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      .|++|+.-|+||||++.||||+++...  |-++..++.       +.|+|||||
T Consensus       217 aG~gvtaYv~DTGVni~H~dFegRa~w--Ga~i~~~~~-------~~D~nGHGT  261 (501)
T KOG1153|consen  217 AGKGVTAYVLDTGVNIEHPDFEGRAIW--GATIPPKDG-------DEDCNGHGT  261 (501)
T ss_pred             cCCCeEEEEecccccccccccccceec--ccccCCCCc-------ccccCCCcc
Confidence            699999999999999999999998632  334443322       236799998


No 38 
>cd00306 Peptidases_S8_S53 Peptidase domain in the S8 and S53 families. Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) family include endopeptidases and  exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin.  The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid has the same role here as the histidine base.   However, the aspartic acid residue that acts as an electrophile is quite different.  In S53, it follows glutamic acid, while in S8 it precedes histidine. The stability of these enzymes may be enhanced by calcium; some members hav
Probab=97.56  E-value=8.5e-05  Score=55.02  Aligned_cols=45  Identities=31%  Similarity=0.300  Sum_probs=29.1

Q ss_pred             eEEEEeeCCCCCCChhh---hcccCCCCceeccCCCCCCCCCCCCCCCCCCCC
Q psy357           83 ITTAIMDDGVDYMHMDL---KNNYNAKASYDFSSNDPHPYPRYTDDWFNRWNN  132 (132)
Q Consensus        83 V~VaViDtGid~~HpDL---~~~~~~~~~~df~~~d~~p~p~~~~~~~~~HGT  132 (132)
                      |+|||||+||+.+||+|   ....  ..++++......+.   ...+..+|||
T Consensus         1 v~VaiiD~G~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~---~~~~~~~HGt   48 (241)
T cd00306           1 VTVAVIDTGVDPDHPDLDGLFGGG--DGGNDDDDNENGPT---DPDDGNGHGT   48 (241)
T ss_pred             CEEEEEeCCCCCCCcchhccccCc--ccccccccCcCCCC---CCCCCCCcHH
Confidence            68999999999999986   2222  24555555433321   1224569997


No 39 
>cd04857 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptidase S8 family domain in Tripeptidyl aminopeptidases_II. Tripeptidyl aminopeptidases II are member of the peptidase S8 or Subtilase family. Subtilases, or subtilisin-like serine proteases, have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution).  Tripeptidyl aminopeptidase II removes tripeptides from the free N terminus of oligopeptides as well as having endoproteolytic activity.  Some tripeptidyl aminopeptidases have been shown to cleave tripeptides and small peptides, e.g. angiotensin II and glucagon, while others are believed to be involved in MHC I processing.
Probab=97.41  E-value=0.00012  Score=61.26  Aligned_cols=36  Identities=25%  Similarity=0.260  Sum_probs=30.5

Q ss_pred             ccCChHHHHhc--CCCCCceEEEEeeCCCCCCChhhhc
Q psy357           66 LDLNVEAAWAQ--GVTGRNITTAIMDDGVDYMHMDLKN  101 (132)
Q Consensus        66 ~~i~~~~aw~~--~~~g~~V~VaViDtGid~~HpDL~~  101 (132)
                      ..+++...+++  .+.|++|+|||||||||..||.|+-
T Consensus         6 ~~~~~~~f~~~~p~~dgr~v~iai~dtgvd~~~~~lq~   43 (412)
T cd04857           6 KETGALRFLQKYPEYDGRGVLIAILDTGVDPGAPGLQV   43 (412)
T ss_pred             chhhHHHHHHHCcCCCCCCcEEEEecCCCCCCCCcccc
Confidence            34677777775  5789999999999999999999964


No 40 
>cd05561 Peptidases_S8_4 Peptidase S8 family domain, uncharacterized subfamily 4. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=97.32  E-value=0.00013  Score=56.31  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=20.2

Q ss_pred             eEEEEeeCCCCCCChhhhcccC
Q psy357           83 ITTAIMDDGVDYMHMDLKNNYN  104 (132)
Q Consensus        83 V~VaViDtGid~~HpDL~~~~~  104 (132)
                      |+||||||||+.+||+|++++.
T Consensus         1 V~VavIDsGvd~~hp~l~~~~~   22 (239)
T cd05561           1 VRVGMIDTGIDTAHPALSAVVI   22 (239)
T ss_pred             CEEEEEeCCCCCCCcccccCcc
Confidence            7999999999999999988764


No 41 
>cd04847 Peptidases_S8_Subtilisin_like_2 Peptidase S8 family domain in Subtilisin-like proteins. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=97.27  E-value=0.00017  Score=56.85  Aligned_cols=27  Identities=15%  Similarity=0.188  Sum_probs=22.4

Q ss_pred             EEEEeeCCCCCCChhhhcccCCCCcee
Q psy357           84 TTAIMDDGVDYMHMDLKNNYNAKASYD  110 (132)
Q Consensus        84 ~VaViDtGid~~HpDL~~~~~~~~~~d  110 (132)
                      +||||||||+..||||++++.....++
T Consensus         2 ~VaviDtGi~~~hp~l~~~~~~~~~~~   28 (291)
T cd04847           2 IVCVLDSGINRGHPLLAPALAEDDLDS   28 (291)
T ss_pred             EEEEecCCCCCCChhhhhhhccccccc
Confidence            799999999999999999986543333


No 42 
>KOG1114|consensus
Probab=92.04  E-value=0.1  Score=48.06  Aligned_cols=34  Identities=29%  Similarity=0.332  Sum_probs=26.3

Q ss_pred             CChHHHHhc--CCCCCceEEEEeeCCCCCCChhhhc
Q psy357           68 LNVEAAWAQ--GVTGRNITTAIMDDGVDYMHMDLKN  101 (132)
Q Consensus        68 i~~~~aw~~--~~~g~~V~VaViDtGid~~HpDL~~  101 (132)
                      +.+...-..  .|.|++|+|||+|||||..-|-|.-
T Consensus        66 t~a~~FL~kyPeYDGRgV~IaIlDtGvDP~apGl~v  101 (1304)
T KOG1114|consen   66 TGAYEFLKKYPEYDGRGVTIAILDTGVDPSAPGLQV  101 (1304)
T ss_pred             hhHHHHHHhCcCCCCCceEEEEeecCCCCCCCCceE
Confidence            444444443  4789999999999999999998864


No 43 
>COG4934 Predicted protease [Posttranslational modification, protein turnover, chaperones]
Probab=33.79  E-value=27  Score=33.47  Aligned_cols=32  Identities=41%  Similarity=0.590  Sum_probs=22.6

Q ss_pred             ChHHHHhcCCCCCceEEEEee-CCCCCCChhhh
Q psy357           69 NVEAAWAQGVTGRNITTAIMD-DGVDYMHMDLK  100 (132)
Q Consensus        69 ~~~~aw~~~~~g~~V~VaViD-tGid~~HpDL~  100 (132)
                      |+..+.+.+.+|||++||||| =|-....-||.
T Consensus       216 nit~l~~~g~tGkG~tIaIid~yG~p~~~~dl~  248 (1174)
T COG4934         216 NITALYESGATGKGETIAIIDAYGDPYNNQDLY  248 (1174)
T ss_pred             ceeecccCCCCCCCcEEEEEeccCCcccHHHHH
Confidence            344555557889999999999 66665555543


No 44 
>PF08195 TRI9:  TRI9 protein;  InterPro: IPR013265 This entry contains putative genes, of 129 bp, from the Trichothecene gene cluster of Fusarium sporotrichioides and Gibberella zeae (Fusarium graminearum) that encode a predicted protein of 43 amino acids whose function is unknown [, ].
Probab=24.65  E-value=20  Score=20.22  Aligned_cols=10  Identities=10%  Similarity=-0.310  Sum_probs=7.9

Q ss_pred             CCCCceeEEE
Q psy357            2 VHMEQVHQAV   11 (132)
Q Consensus         2 ~~~~~v~~~~   11 (132)
                      ..+|+|-|+|
T Consensus        12 ~~dp~vswle   21 (43)
T PF08195_consen   12 DMDPDVSWLE   21 (43)
T ss_pred             cCCCCccHHH
Confidence            4578899987


Done!