Diaphorina citri psyllid: psy3618


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MVEDEVRAEDAKNRIKNGEEARLEDVNTDDENDEDSEEDILKRDFSSATLDDHFDKTVLPKVMQVKNFGRSGRTKYSHLVDQDTTQFDSPWLSETSQNHKFHLNQAAGMKQVFVKPSLSKRKPSKSSTSSSSRSNH
ccHHHHHHHHHHHHHccccHHHHHHHcccccccccccHHHHHccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccc
************************DVNTDDENDEDSEEDILKRDFSSATLDDHFDKTVLPKVMQVKNFGRSGRTKYSHLVDQDTTQFDSPWLSE******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxRLEDVNTDDENDEDSEEDILKRDFSSATLDDHFDKTVLPKVMQVKNFGRSGRTKYSHLVDQDTTQFDSPWLSETSQNHKFHLNQAAGMKQVFVKPSLSKRKPSKSSTSSSSRSNH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microfibrillar-associated protein 1 Component of the elastin-associated microfibrils.confidentP55080
Microfibrillar-associated protein 1 Component of the elastin-associated microfibrils.confidentQ5EA98
Microfibrillar-associated protein 1 Component of the elastin-associated microfibrils.confidentQ9CQU1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0001527 [CC]microfibrilprobableGO:0043205, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0010389 [BP]regulation of G2/M transition of mitotic cell cycleprobableGO:0007346, GO:0051726, GO:0010564, GO:0050794, GO:1901987, GO:0065007, GO:1901990, GO:0008150, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted