Query         psy363
Match_columns 59
No_of_seqs    53 out of 55
Neff          4.4 
Searched_HMMs 46136
Date          Fri Aug 16 21:37:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy363.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/363hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3526|consensus               99.7 3.1E-18 6.7E-23  130.5   4.5   55    3-57    572-628 (629)
  2 PF01483 P_proprotein:  Proprot  85.8     2.2 4.8E-05   24.6   4.2   23    3-25     65-87  (87)
  3 PF03677 UPF0137:  Uncharacteri  64.7    0.25 5.4E-06   35.7  -4.8   24   13-36    100-123 (243)
  4 smart00212 UBCc Ubiquitin-conj  40.0      28  0.0006   21.7   2.1   21   16-36     26-46  (145)
  5 KOG2960|consensus               39.4      24 0.00052   26.3   2.0   21   10-30    192-214 (328)
  6 cd00195 UBCc Ubiquitin-conjuga  38.1      32 0.00069   21.3   2.2   20   17-36     27-46  (141)
  7 COG4718 Phage-related protein   36.5      39 0.00085   21.9   2.4   28    3-30     22-55  (111)
  8 PTZ00390 ubiquitin-conjugating  34.1      44 0.00095   21.7   2.4   21   16-36     29-49  (152)
  9 PLN00172 ubiquitin conjugating  33.2      42  0.0009   21.6   2.2   21   16-36     28-48  (147)
 10 COG4935 Regulatory P domain of  32.7      91   0.002   21.6   3.9   27    3-30    103-129 (177)
 11 cd03409 Chelatase_Class_II Cla  30.2      23 0.00049   20.2   0.5   13   22-34      3-16  (101)
 12 PRK07688 thiamine/molybdopteri  20.5      79  0.0017   23.0   1.9   20   12-31    308-327 (339)

No 1  
>KOG3526|consensus
Probab=99.72  E-value=3.1e-18  Score=130.47  Aligned_cols=55  Identities=42%  Similarity=0.741  Sum_probs=51.6

Q ss_pred             eeEEEeCCCCCceeEEEEEEEEEeecCCCCCCCCCC--CCCcchHHHHHHHHHhhhh
Q psy363            3 ALQISFNSQEPNHGFIKEWTLMIHGTRDPPYSSLPV--SDPHSKLAIVKKAHQDRLK   57 (59)
Q Consensus         3 ~L~v~~~~~~~~~G~l~eWtL~LhGT~~~PY~~~~~--~~~~sKL~ivkkah~~~~~   57 (59)
                      +|+++|+|.+++.|+|+||+||||||+++||+-+.|  ++++|||++|||||+++.+
T Consensus       572 ~learf~gp~~~~g~lkew~lmlhgt~eapy~~i~piv~~~~skla~vkkah~ek~~  628 (629)
T KOG3526|consen  572 RLEARFQGPGAHAGTLKEWELMLHGTREAPYNLIEPIVGQTNSKLATVKKAHLEKRS  628 (629)
T ss_pred             EEEEeccCCcccccchhheeeeeeccccCcccccccccccchhhHHHHHHHhhhhhc
Confidence            699999999999999999999999999999977766  9999999999999998865


No 2  
>PF01483 P_proprotein:  Proprotein convertase P-domain;  InterPro: IPR002884 This domain, termed the P domain is approximately 150 amino acids in length and C-terminal to a serine endopeptidase domain which belong to MEROPS peptidase family S8 (clan SB), subfamily S8B (kexin). The domain is primarily associated with the calcium-dependent serine endopeptidases, kex2/subtilisin proprotein convertases (PCs), which have been identified in all eukaryotes [] and in the gammaproteobacteria, Nostoc (cyanobacteria) and in Streptomyces avermitilis. The P domain appears necessary for folding and maintaining the endopeptidase catalytic domain and to regulate its calcium and acidic pH dependence. In addition, contained within the middle of the P domain in most PC family members is the cognate integrin binding RGD sequence [], which may be required for intracellular compartmentalization and maintenance of enzyme stability within the ER. The integrity of the RGD sequence of proprotein convertase PC1 is critical for its zymogen and C-terminal processing and for its cellular trafficking [, ]. The carboxy-terminal tail provides uniqueness to each PC family member being the least conserved region of all convertases [].; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1P8J_E 1OT5_B 2ID4_A 1R64_A 3HJR_A.
Probab=85.84  E-value=2.2  Score=24.61  Aligned_cols=23  Identities=17%  Similarity=0.518  Sum_probs=16.2

Q ss_pred             eeEEEeCCCCCceeEEEEEEEEE
Q psy363            3 ALQISFNSQEPNHGFIKEWTLMI   25 (59)
Q Consensus         3 ~L~v~~~~~~~~~G~l~eWtL~L   25 (59)
                      +|+|.........|.|+.|+|.|
T Consensus        65 ~L~v~D~~~~~~~G~l~~w~L~~   87 (87)
T PF01483_consen   65 TLRVTDRNSPGDTGTLNSWSLTF   87 (87)
T ss_dssp             EEEEEEBSSTTS-EEEEEEEEEE
T ss_pred             EEEEEECCCCCCcEEEEEEEEEC
Confidence            46665535667889999999975


No 3  
>PF03677 UPF0137:  Uncharacterised protein family (UPF0137);  InterPro: IPR005350 This family of bacterial proteins includes a number of plasmid-encoded virulence proteins.
Probab=64.67  E-value=0.25  Score=35.71  Aligned_cols=24  Identities=29%  Similarity=0.682  Sum_probs=21.5

Q ss_pred             CceeEEEEEEEEEeecCCCCCCCC
Q psy363           13 PNHGFIKEWTLMIHGTRDPPYSSL   36 (59)
Q Consensus        13 ~~~G~l~eWtL~LhGT~~~PY~~~   36 (59)
                      -..|++..|-+..+||++.||+-+
T Consensus       100 y~egtFSaWl~l~ygnrqt~YN~L  123 (243)
T PF03677_consen  100 YREGTFSAWLILTYGNRQTPYNFL  123 (243)
T ss_pred             CccchHHHHHHHHHccccCchHHH
Confidence            457999999999999999999766


No 4  
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues. Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved  cysteine residue of UBC homologues. This pathway functions in regulating many fundamental processes required for cell viability.TSG101 is one of several UBC homologues that lacks this active site cysteine.
Probab=40.03  E-value=28  Score=21.72  Aligned_cols=21  Identities=33%  Similarity=0.518  Sum_probs=17.7

Q ss_pred             eEEEEEEEEEeecCCCCCCCC
Q psy363           16 GFIKEWTLMIHGTRDPPYSSL   36 (59)
Q Consensus        16 G~l~eWtL~LhGT~~~PY~~~   36 (59)
                      +-+.+|..++.|.++.||.+.
T Consensus        26 ~~~~~w~~~i~gp~~~~y~g~   46 (145)
T smart00212       26 DNLLEWTGTIVGPPGTPYEGG   46 (145)
T ss_pred             CChheEEEEEEcCCCCCcCCc
Confidence            357899999999999999654


No 5  
>KOG2960|consensus
Probab=39.41  E-value=24  Score=26.28  Aligned_cols=21  Identities=33%  Similarity=0.729  Sum_probs=17.5

Q ss_pred             CCCCceeEEEEEEEEE--eecCC
Q psy363           10 SQEPNHGFIKEWTLMI--HGTRD   30 (59)
Q Consensus        10 ~~~~~~G~l~eWtL~L--hGT~~   30 (59)
                      |.....|++..|+|+-  ||||+
T Consensus       192 g~~rvaGVVTNWtLV~qnHgtQs  214 (328)
T KOG2960|consen  192 GEVRVAGVVTNWTLVTQNHGTQS  214 (328)
T ss_pred             CceEEEEEEeeeEEeeeccCccc
Confidence            4556779999999985  99998


No 6  
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain. This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3.  This pathway regulates many fundamental cellular processes.  There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD.
Probab=38.13  E-value=32  Score=21.35  Aligned_cols=20  Identities=35%  Similarity=0.615  Sum_probs=16.5

Q ss_pred             EEEEEEEEEeecCCCCCCCC
Q psy363           17 FIKEWTLMIHGTRDPPYSSL   36 (59)
Q Consensus        17 ~l~eWtL~LhGT~~~PY~~~   36 (59)
                      -+.+|.+.|+|-.+.||.+.
T Consensus        27 ~~~~w~~~i~g~~~t~y~g~   46 (141)
T cd00195          27 NLLEWHGTIRGPPDTPYEGG   46 (141)
T ss_pred             ChhEEEEEEecCCCCCccCC
Confidence            46789999999989888653


No 7  
>COG4718 Phage-related protein [Function unknown]
Probab=36.54  E-value=39  Score=21.91  Aligned_cols=28  Identities=14%  Similarity=0.367  Sum_probs=19.3

Q ss_pred             eeEEEeCCCCCce------eEEEEEEEEEeecCC
Q psy363            3 ALQISFNSQEPNH------GFIKEWTLMIHGTRD   30 (59)
Q Consensus         3 ~L~v~~~~~~~~~------G~l~eWtL~LhGT~~   30 (59)
                      ...|+|-+...|.      -.++.|.|.+.|+++
T Consensus        22 V~~v~fGDGYeQr~~~GLN~~l~t~~vt~~~~~~   55 (111)
T COG4718          22 VRTVRFGDGYEQRRAAGLNNDLKTWSVTFRVTKE   55 (111)
T ss_pred             EEEEEcCCChhhhcccccCcccceeEEEEEeeHH
Confidence            4556665443332      468889999999988


No 8  
>PTZ00390 ubiquitin-conjugating enzyme; Provisional
Probab=34.15  E-value=44  Score=21.69  Aligned_cols=21  Identities=19%  Similarity=0.577  Sum_probs=17.6

Q ss_pred             eEEEEEEEEEeecCCCCCCCC
Q psy363           16 GFIKEWTLMIHGTRDPPYSSL   36 (59)
Q Consensus        16 G~l~eWtL~LhGT~~~PY~~~   36 (59)
                      .-+.+|...+.|-.+.||.+.
T Consensus        29 ~d~~~w~~~i~GP~~tpY~gg   49 (152)
T PTZ00390         29 GNYRHFKILMEGPDGTPYEGG   49 (152)
T ss_pred             CCccEEEEEEEcCCCCCCcCc
Confidence            357889999999999999654


No 9  
>PLN00172 ubiquitin conjugating enzyme; Provisional
Probab=33.23  E-value=42  Score=21.59  Aligned_cols=21  Identities=33%  Similarity=0.572  Sum_probs=17.7

Q ss_pred             eEEEEEEEEEeecCCCCCCCC
Q psy363           16 GFIKEWTLMIHGTRDPPYSSL   36 (59)
Q Consensus        16 G~l~eWtL~LhGT~~~PY~~~   36 (59)
                      .-+.+|...|.|-.+.||.+.
T Consensus        28 ~nl~~w~~~i~GP~~tpyegg   48 (147)
T PLN00172         28 ENLFRWTASIIGPSDSPYAGG   48 (147)
T ss_pred             CChheEEEEEECCCCCCCCCC
Confidence            358899999999999999653


No 10 
>COG4935 Regulatory P domain of the subtilisin-like proprotein convertases and other proteases [Posttranslational modification, protein turnover, chaperones]
Probab=32.72  E-value=91  Score=21.64  Aligned_cols=27  Identities=19%  Similarity=0.380  Sum_probs=19.7

Q ss_pred             eeEEEeCCCCCceeEEEEEEEEEeecCC
Q psy363            3 ALQISFNSQEPNHGFIKEWTLMIHGTRD   30 (59)
Q Consensus         3 ~L~v~~~~~~~~~G~l~eWtL~LhGT~~   30 (59)
                      +|+|...... +.|.|.-|.|.|.|-..
T Consensus       103 ~L~V~D~~~g-~~Gtf~sW~l~l~~~~~  129 (177)
T COG4935         103 RLEVQDLAGG-HTGTFHSWGLKLGGEST  129 (177)
T ss_pred             EEEEEecCCC-ceeEEEEeEEeeeeecc
Confidence            4666544333 88999999999997653


No 11 
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=30.25  E-value=23  Score=20.15  Aligned_cols=13  Identities=31%  Similarity=0.588  Sum_probs=9.8

Q ss_pred             EEEEeecCCC-CCC
Q psy363           22 TLMIHGTRDP-PYS   34 (59)
Q Consensus        22 tL~LhGT~~~-PY~   34 (59)
                      -|+=|||+.+ ||+
T Consensus         3 llv~HGs~~~s~~~   16 (101)
T cd03409           3 LVVGHGSPYKDPYK   16 (101)
T ss_pred             EEEECCCCCCccHH
Confidence            4677999998 654


No 12 
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated
Probab=20.51  E-value=79  Score=22.97  Aligned_cols=20  Identities=30%  Similarity=0.507  Sum_probs=16.8

Q ss_pred             CCceeEEEEEEEEEeecCCC
Q psy363           12 EPNHGFIKEWTLMIHGTRDP   31 (59)
Q Consensus        12 ~~~~G~l~eWtL~LhGT~~~   31 (59)
                      .-.-..|+....++|||.++
T Consensus       308 ~~~~~~~~~gr~~i~g~~~~  327 (339)
T PRK07688        308 EKRLVLFKDGRVLVHGTKDI  327 (339)
T ss_pred             CeEEEEEcCCCEEEECCCCH
Confidence            34558889999999999996


Done!