BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3643
         (153 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1FHL|A Chain A, Crystal Structure Of Beta-1,4-Galactanase From Aspergillus
           Aculeatus At 293k
 pdb|1FOB|A Chain A, Crystal Structure Of Beta-1,4-Galactanase From Aspergillus
           Aculeatus At 100k
          Length = 334

 Score = 27.7 bits (60), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 7/61 (11%)

Query: 53  DPKCADPFDNSSIPINDCKVEPELSHLPGIRATMCRKIRQKVHGEWRYYRGCAWLGEPGI 112
           +P  A P D SSIP +    +  L  L  +       +     G   YY   AW+G  G+
Sbjct: 255 NPAYAFPSDLSSIPFSVAGQQEFLEKLAAV-------VEATTDGLGVYYWEPAWIGNAGL 307

Query: 113 G 113
           G
Sbjct: 308 G 308


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.474 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,986,490
Number of Sequences: 62578
Number of extensions: 192832
Number of successful extensions: 504
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 502
Number of HSP's gapped (non-prelim): 3
length of query: 153
length of database: 14,973,337
effective HSP length: 90
effective length of query: 63
effective length of database: 9,341,317
effective search space: 588502971
effective search space used: 588502971
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 47 (22.7 bits)