BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy3643
(153 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1FHL|A Chain A, Crystal Structure Of Beta-1,4-Galactanase From Aspergillus
Aculeatus At 293k
pdb|1FOB|A Chain A, Crystal Structure Of Beta-1,4-Galactanase From Aspergillus
Aculeatus At 100k
Length = 334
Score = 27.7 bits (60), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 7/61 (11%)
Query: 53 DPKCADPFDNSSIPINDCKVEPELSHLPGIRATMCRKIRQKVHGEWRYYRGCAWLGEPGI 112
+P A P D SSIP + + L L + + G YY AW+G G+
Sbjct: 255 NPAYAFPSDLSSIPFSVAGQQEFLEKLAAV-------VEATTDGLGVYYWEPAWIGNAGL 307
Query: 113 G 113
G
Sbjct: 308 G 308
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.137 0.474
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,986,490
Number of Sequences: 62578
Number of extensions: 192832
Number of successful extensions: 504
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 502
Number of HSP's gapped (non-prelim): 3
length of query: 153
length of database: 14,973,337
effective HSP length: 90
effective length of query: 63
effective length of database: 9,341,317
effective search space: 588502971
effective search space used: 588502971
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 47 (22.7 bits)