Diaphorina citri psyllid: psy364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
VPDSGVQLEGEAQGPAEPTPGVVEGEKTPATAPAQDGGAAPGPDTQQTPSQDDTEKASAFSPDQRYLKFEEEIGRGSFKTVYRGLDTQTGVAVAWCELQEKKLNKAERARFREEAEMLKGLQHPNIVSFYGYWEVTLTKRKYIELYYV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccEEEEEEEEc
*****************************************************************YLKFEEEIGRGSFKTVYRGLDTQTGVAVAWCELQEKKLN******FREEAEMLKGLQHPNIVSFYGYWEVTLTKRKYIELYYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VPDSGVQLEGEAQGPAEPTPGVVEGEKTPATAPAQDGGAAPGPDTQQTPSQDDTEKASAFSPDQRYLKFEEEIGRGSFKTVYRGLDTQTGVAVAWxxxxxxxxxxxxxxxxxxxxxMLKGLQHPNIVSFYGYWEVTLTKRKYIELYYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase WNK1 Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L.confidentQ9H4A3
Serine/threonine-protein kinase WNK1 Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L.confidentQ9JIH7
Serine/threonine-protein kinase WNK1 Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L.confidentP83741

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030291 [MF]protein serine/threonine kinase inhibitor activityprobableGO:0019210, GO:0019207, GO:0019887, GO:0030234, GO:0004860, GO:0003674, GO:0004857
GO:0019870 [MF]potassium channel inhibitor activityprobableGO:0016247, GO:0003674, GO:0015459, GO:0008200, GO:0016248
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0090004 [BP]positive regulation of establishment of protein localization to plasma membraneprobableGO:0051130, GO:0070201, GO:0032879, GO:0060341, GO:0051128, GO:0032880, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0090003, GO:0050789, GO:0048522
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0010765 [BP]positive regulation of sodium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0043270, GO:0065007, GO:0002028, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:2000688 [BP]positive regulation of rubidium ion transmembrane transporter activityprobableGO:0032414, GO:0032411, GO:0032412, GO:0051050, GO:0022898, GO:0008150, GO:0050794, GO:0010959, GO:0050789, GO:0032409, GO:0065007, GO:0034762, GO:0044093, GO:0051049, GO:0048518, GO:0034765, GO:2000680, GO:0032879, GO:2000686, GO:0065009, GO:0043269
GO:2000682 [BP]positive regulation of rubidium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0043270, GO:0065007, GO:0048518, GO:0008150, GO:2000680, GO:0032879, GO:0050789, GO:0043269
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0019902 [MF]phosphatase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0010800 [BP]positive regulation of peptidyl-threonine phosphorylationprobableGO:0019220, GO:0080090, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0009893, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0010799, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0006821 [BP]chloride transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0090188 [BP]negative regulation of pancreatic juice secretionprobableGO:0051051, GO:0051046, GO:0051048, GO:0044058, GO:0051241, GO:0060457, GO:0090186, GO:0044057, GO:0065007, GO:0008150, GO:0051239, GO:0051049, GO:0048519, GO:0032879, GO:0050789
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071901 [BP]negative regulation of protein serine/threonine kinase activityprobableGO:0033673, GO:0051348, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0071900, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0043549, GO:0044092, GO:0048519, GO:0065009, GO:0006469, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0045859, GO:0042326, GO:0008150, GO:0042325, GO:0032269, GO:0032268, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0010923 [BP]negative regulation of phosphatase activityprobableGO:0051336, GO:0019220, GO:0051346, GO:0019222, GO:0065009, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T4H, chain A
Confidence level:very confident
Coverage over the Query: 58-148
View the alignment between query and template
View the model in PyMOL
Template: 1UU3, chain A
Confidence level:probable
Coverage over the Query: 63-148
View the alignment between query and template
View the model in PyMOL