Query         psy3653
Match_columns 202
No_of_seqs    221 out of 1696
Neff          8.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:12:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3653.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3653hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2272|consensus              100.0   3E-40 6.6E-45  253.6  -1.9  194    9-202    10-254 (332)
  2 KOG1701|consensus              100.0 9.7E-37 2.1E-41  249.6   1.3  170   13-200   276-462 (468)
  3 KOG2272|consensus              100.0 1.4E-33 3.1E-38  216.9  -1.5  164   18-199    84-311 (332)
  4 KOG1044|consensus               99.9   1E-27 2.2E-32  202.8   6.2  175    7-202    16-192 (670)
  5 KOG1703|consensus               99.9 1.7E-27 3.6E-32  206.6   3.1  160   20-197   317-478 (479)
  6 KOG1044|consensus               99.9 1.5E-24 3.3E-29  183.7   2.5  161   18-197    76-247 (670)
  7 KOG1701|consensus               99.9 7.9E-25 1.7E-29  179.8  -3.1  117   67-202   275-394 (468)
  8 KOG1703|consensus               99.9 2.8E-22 6.2E-27  174.0   4.5  165   20-202   256-422 (479)
  9 KOG4577|consensus               99.8 6.1E-21 1.3E-25  149.8  -2.0  121   60-199    27-152 (383)
 10 KOG4577|consensus               99.8 4.1E-20 8.9E-25  145.2  -0.9   97   21-118    48-148 (383)
 11 PF00412 LIM:  LIM domain;  Int  99.6 6.5E-16 1.4E-20   96.4   4.1   56  146-201     1-58  (58)
 12 PF00412 LIM:  LIM domain;  Int  99.4 2.2E-13 4.7E-18   84.9   2.1   44   22-65     15-58  (58)
 13 KOG1700|consensus               99.3   2E-12 4.3E-17  100.1   2.0  136   65-200     6-166 (200)
 14 KOG1700|consensus               99.1 1.4E-11   3E-16   95.4   1.4  107   13-119     9-162 (200)
 15 smart00132 LIM Zinc-binding do  98.8 3.3E-09   7E-14   60.2   2.4   36  145-180     1-38  (39)
 16 smart00132 LIM Zinc-binding do  98.6   4E-08 8.7E-13   55.6   2.1   36   68-103     1-38  (39)
 17 KOG0490|consensus               97.5 2.6E-05 5.7E-10   61.7   0.1   90   21-112    11-107 (235)
 18 KOG0490|consensus               97.3 8.1E-05 1.8E-09   58.8   0.9  109   72-198     2-117 (235)
 19 KOG1702|consensus               97.1 5.4E-05 1.2E-09   57.8  -2.1   57  144-200     5-62  (264)
 20 KOG1702|consensus               96.6 0.00051 1.1E-08   52.5   0.1   60   67-126     5-65  (264)
 21 PF08394 Arc_trans_TRASH:  Arch  91.6   0.071 1.5E-06   29.6   0.5   32  146-180     1-34  (37)
 22 PF14835 zf-RING_6:  zf-RING of  91.0     0.2 4.3E-06   31.4   2.1   48   34-81      8-55  (65)
 23 PF14446 Prok-RING_1:  Prokaryo  89.2    0.33 7.1E-06   29.3   2.0   38  142-179     4-51  (54)
 24 KOG2462|consensus               82.8    0.81 1.8E-05   37.0   1.8  129   31-184   128-258 (279)
 25 PF07503 zf-HYPF:  HypF finger;  82.3    0.46 9.9E-06   26.0   0.2   32   13-44      1-32  (35)
 26 PF06677 Auto_anti-p27:  Sjogre  81.1     1.2 2.5E-05   25.4   1.6   28   29-60     13-40  (41)
 27 PF11781 RRN7:  RNA polymerase   81.1     1.2 2.5E-05   24.6   1.5   25   34-62      9-33  (36)
 28 PF01258 zf-dskA_traR:  Prokary  78.4    0.39 8.5E-06   26.3  -0.9   28  172-199     6-33  (36)
 29 TIGR00622 ssl1 transcription f  78.3     2.1 4.5E-05   30.0   2.4   26   13-46      3-28  (112)
 30 PF10367 Vps39_2:  Vacuolar sor  77.8     1.6 3.5E-05   29.7   1.8   29  143-171    78-108 (109)
 31 PF13240 zinc_ribbon_2:  zinc-r  77.1     1.7 3.6E-05   21.4   1.2    9  146-154     2-10  (23)
 32 PF14835 zf-RING_6:  zf-RING of  77.1     3.8 8.3E-05   25.7   3.1   31  130-160    27-57  (65)
 33 COG2191 Formylmethanofuran deh  75.7     1.3 2.9E-05   34.2   1.0   31   34-64    173-203 (206)
 34 COG1645 Uncharacterized Zn-fin  75.1     1.9 4.2E-05   31.0   1.6   22   35-61     30-51  (131)
 35 PF14471 DUF4428:  Domain of un  74.2     2.5 5.5E-05   25.2   1.7   28  172-200     2-30  (51)
 36 PF02069 Metallothio_Pro:  Prok  74.1     2.1 4.7E-05   25.6   1.4   27   36-62     10-37  (52)
 37 PF06827 zf-FPG_IleRS:  Zinc fi  71.5     1.8 3.8E-05   22.5   0.6   15  144-158     2-16  (30)
 38 PF12674 Zn_ribbon_2:  Putative  71.5     1.5 3.3E-05   28.8   0.4   29   35-63      2-35  (81)
 39 COG2191 Formylmethanofuran deh  71.1     1.4 3.1E-05   34.0   0.2   30  170-199   173-202 (206)
 40 PF06906 DUF1272:  Protein of u  68.6     4.2 9.1E-05   24.7   1.8   45   35-79      7-54  (57)
 41 PF10235 Cript:  Microtubule-as  68.2     3.3 7.1E-05   27.8   1.4   42   29-78     40-81  (90)
 42 PF10367 Vps39_2:  Vacuolar sor  67.6     4.7  0.0001   27.4   2.2   27   35-61     80-107 (109)
 43 PF09943 DUF2175:  Uncharacteri  65.6     1.8 3.8E-05   29.7  -0.3   27  145-171     4-32  (101)
 44 PF12773 DZR:  Double zinc ribb  64.5     3.7 8.1E-05   23.9   1.0   12  143-154    12-23  (50)
 45 PF14634 zf-RING_5:  zinc-RING   59.0     5.6 0.00012   22.6   1.1   39   36-74      2-44  (44)
 46 PRK14890 putative Zn-ribbon RN  58.8     5.4 0.00012   24.5   1.0   36   35-74      9-44  (59)
 47 PRK00420 hypothetical protein;  58.4     6.2 0.00013   27.7   1.4   25   34-62     24-48  (112)
 48 PF13834 DUF4193:  Domain of un  58.3       4 8.7E-05   27.8   0.4   29   32-60     69-98  (99)
 49 PF13248 zf-ribbon_3:  zinc-rib  58.1     6.6 0.00014   19.7   1.1    7   36-42      5-11  (26)
 50 COG4357 Zinc finger domain con  54.9     2.1 4.6E-05   28.9  -1.3   53   69-121    38-91  (105)
 51 PRK00432 30S ribosomal protein  54.0     7.6 0.00016   23.0   1.1   26   11-41     20-45  (50)
 52 KOG2462|consensus               53.8       4 8.6E-05   33.1  -0.2   36   68-103   217-254 (279)
 53 cd02249 ZZ Zinc finger, ZZ typ  53.7      11 0.00023   21.7   1.7   11  145-155     2-12  (46)
 54 PF10083 DUF2321:  Uncharacteri  52.8     5.3 0.00012   29.6   0.4   49  131-181    28-80  (158)
 55 PF00645 zf-PARP:  Poly(ADP-rib  52.6     4.7  0.0001   26.3   0.0   13  142-154     6-18  (82)
 56 smart00291 ZnF_ZZ Zinc-binding  52.2      13 0.00028   21.2   1.8   12  144-155     5-16  (44)
 57 PF03854 zf-P11:  P-11 zinc fin  52.0     5.6 0.00012   23.3   0.3   29  126-154    10-46  (50)
 58 PF11571 Med27:  Mediator compl  51.2     5.2 0.00011   26.8   0.1   16   61-76     49-64  (90)
 59 cd00162 RING RING-finger (Real  51.0     5.3 0.00012   21.8   0.1   39   36-74      2-43  (45)
 60 TIGR02098 MJ0042_CXXC MJ0042 f  50.8     3.9 8.5E-05   22.4  -0.5   10   34-43     26-35  (38)
 61 PF07754 DUF1610:  Domain of un  50.7      12 0.00025   18.6   1.3    9  146-154     1-9   (24)
 62 PRK14559 putative protein seri  50.7      20 0.00044   33.0   3.8   21  133-153    17-37  (645)
 63 PRK14559 putative protein seri  50.0      16 0.00034   33.7   3.0   10   67-76     28-37  (645)
 64 PF08271 TF_Zn_Ribbon:  TFIIB z  49.6     6.6 0.00014   22.2   0.4   11   34-44     20-30  (43)
 65 KOG0320|consensus               49.2       5 0.00011   30.5  -0.3   50   30-79    128-180 (187)
 66 PF13920 zf-C3HC4_3:  Zinc fing  49.2      17 0.00037   21.0   2.1   42   35-77      4-48  (50)
 67 PF07191 zinc-ribbons_6:  zinc-  47.8     4.4 9.5E-05   25.8  -0.6   24   53-76     16-40  (70)
 68 smart00504 Ubox Modified RING   47.6      13 0.00029   22.4   1.5   29  125-153    15-45  (63)
 69 PF08274 PhnA_Zn_Ribbon:  PhnA   47.4     9.8 0.00021   20.0   0.8   10   14-23      5-14  (30)
 70 COG4847 Uncharacterized protei  46.8     5.9 0.00013   26.7  -0.2   30  144-173     7-38  (103)
 71 PF10886 DUF2685:  Protein of u  44.5      13 0.00027   22.4   1.0   24  144-167     2-26  (54)
 72 COG2888 Predicted Zn-ribbon RN  42.0      12 0.00026   23.0   0.7   11   35-45     11-21  (61)
 73 PRK06266 transcription initiat  41.7      11 0.00024   28.6   0.6   27   13-44    119-147 (178)
 74 PF13717 zinc_ribbon_4:  zinc-r  41.3      11 0.00023   20.6   0.3    8   12-19      3-10  (36)
 75 PF06689 zf-C4_ClpX:  ClpX C4-t  40.3      27 0.00058   19.6   1.9   29  171-199     3-33  (41)
 76 COG5152 Uncharacterized conser  40.2     5.8 0.00013   30.7  -1.1   45   34-79    197-243 (259)
 77 PF04570 DUF581:  Protein of un  39.6      18  0.0004   22.1   1.2   27  171-197    18-47  (58)
 78 cd02340 ZZ_NBR1_like Zinc fing  39.5      24 0.00053   20.0   1.7   11  145-155     2-12  (43)
 79 PF12760 Zn_Tnp_IS1595:  Transp  39.1      13 0.00027   21.4   0.4   14   28-42     14-27  (46)
 80 PF02150 RNA_POL_M_15KD:  RNA p  38.9      11 0.00024   20.4   0.2    7   13-19      3-9   (35)
 81 COG2075 RPL24A Ribosomal prote  38.6      22 0.00048   22.3   1.5   21  171-191     5-28  (66)
 82 COG0068 HypF Hydrogenase matur  37.4      24 0.00051   32.7   2.0   84   10-102   100-183 (750)
 83 smart00659 RPOLCX RNA polymera  37.4      21 0.00045   20.5   1.1   11   34-44      3-13  (44)
 84 smart00834 CxxC_CXXC_SSSS Puta  37.3      12 0.00025   20.6   0.1    9  145-153     7-15  (41)
 85 PF09723 Zn-ribbon_8:  Zinc rib  36.6      12 0.00026   21.1   0.0   11  170-180     6-16  (42)
 86 TIGR00373 conserved hypothetic  35.4      14 0.00031   27.4   0.3   27   13-44    111-139 (158)
 87 PF00569 ZZ:  Zinc finger, ZZ t  34.1      25 0.00053   20.2   1.1   12  144-155     5-17  (46)
 88 cd02336 ZZ_RSC8 Zinc finger, Z  34.1      36 0.00077   19.6   1.8   29  171-199     2-32  (45)
 89 cd02341 ZZ_ZZZ3 Zinc finger, Z  33.9      39 0.00084   19.8   2.0   11  145-155     2-13  (48)
 90 PF13639 zf-RING_2:  Ring finge  33.7      14  0.0003   20.7   0.0   26  145-170     2-30  (44)
 91 KOG1813|consensus               32.7      27 0.00058   28.8   1.5   44   34-78    242-287 (313)
 92 TIGR02605 CxxC_CxxC_SSSS putat  32.6      16 0.00035   21.4   0.2   10  144-153     6-15  (52)
 93 PF05864 Chordopox_RPO7:  Chord  32.3     9.9 0.00021   23.1  -0.8   16   34-49      5-20  (63)
 94 PF01286 XPA_N:  XPA protein N-  31.7      22 0.00047   19.3   0.6   12   35-46      5-16  (34)
 95 PF09297 zf-NADH-PPase:  NADH p  31.6      20 0.00044   18.7   0.4   26   12-41      4-29  (32)
 96 PHA03082 DNA-dependent RNA pol  31.5      10 0.00022   23.1  -0.8   15   34-48      5-19  (63)
 97 KOG0978|consensus               31.4     6.4 0.00014   36.3  -2.5   45   34-79    644-691 (698)
 98 PF00096 zf-C2H2:  Zinc finger,  31.3      21 0.00046   16.6   0.5   12   34-45      1-12  (23)
 99 COG0266 Nei Formamidopyrimidin  31.0      30 0.00064   28.3   1.5   28  142-169   244-271 (273)
100 cd02335 ZZ_ADA2 Zinc finger, Z  30.7      44 0.00095   19.4   1.8   10  145-154     2-11  (49)
101 PF12647 RNHCP:  RNHCP domain;   30.5 1.3E+02  0.0028   20.3   4.2   11   92-102     4-14  (92)
102 COG1998 RPS31 Ribosomal protei  30.0      25 0.00054   20.8   0.6   28    9-40     17-44  (51)
103 PF10764 Gin:  Inhibitor of sig  29.7      47   0.001   19.2   1.8   11  170-180    19-29  (46)
104 PRK14714 DNA polymerase II lar  29.4      70  0.0015   31.9   3.8    9  145-153   711-719 (1337)
105 PF14255 Cys_rich_CPXG:  Cystei  28.8      26 0.00057   20.9   0.6    8  146-153     3-10  (52)
106 PLN03208 E3 ubiquitin-protein   28.6      44 0.00096   25.8   2.0    9  172-180    71-79  (193)
107 COG1996 RPC10 DNA-directed RNA  28.4      23 0.00049   20.9   0.3   11  143-153    24-34  (49)
108 PF12677 DUF3797:  Domain of un  26.9      52  0.0011   19.4   1.6   26  144-169    14-42  (49)
109 PF04945 YHS:  YHS domain;  Int  26.8      12 0.00026   21.5  -1.1   31  147-180     4-37  (47)
110 PHA00626 hypothetical protein   26.7      33 0.00072   20.8   0.8   38   13-50      2-40  (59)
111 PRK00807 50S ribosomal protein  26.6      50  0.0011   19.6   1.6   20  172-191     4-26  (52)
112 PF13923 zf-C3HC4_2:  Zinc fing  26.4      43 0.00093   18.1   1.2   12  188-199    17-28  (39)
113 COG0068 HypF Hydrogenase matur  26.3      34 0.00073   31.8   1.1   82   68-180   103-184 (750)
114 TIGR00143 hypF [NiFe] hydrogen  26.2      42  0.0009   31.4   1.8   84   10-102    67-150 (711)
115 PF14803 Nudix_N_2:  Nudix N-te  26.1      32  0.0007   18.5   0.6    9   36-44      3-11  (34)
116 smart00531 TFIIE Transcription  26.0      23  0.0005   25.9   0.0   11   34-44    124-134 (147)
117 PF08209 Sgf11:  Sgf11 (transcr  25.4      19 0.00042   19.3  -0.3   16  170-185     5-20  (33)
118 TIGR00686 phnA alkylphosphonat  25.0      42  0.0009   23.3   1.2   29   13-46      4-32  (109)
119 PF02591 DUF164:  Putative zinc  25.0      26 0.00057   20.9   0.2   13   67-79     23-35  (56)
120 KOG1734|consensus               25.0      54  0.0012   26.8   1.9   43  124-171   210-262 (328)
121 cd02338 ZZ_PCMF_like Zinc fing  25.0      50  0.0011   19.2   1.4   11  145-155     2-13  (49)
122 PF00130 C1_1:  Phorbol esters/  24.9      50  0.0011   19.1   1.4   13  143-155    11-23  (53)
123 PF07649 C1_3:  C1-like domain;  24.8      38 0.00083   17.3   0.8   12   34-45      1-12  (30)
124 PF10571 UPF0547:  Uncharacteri  24.8      48   0.001   16.7   1.1    8   14-21      3-10  (26)
125 PF13894 zf-C2H2_4:  C2H2-type   24.6      34 0.00073   15.6   0.5   11   34-44      1-11  (24)
126 PRK00398 rpoP DNA-directed RNA  24.0      18 0.00039   20.7  -0.7   28  144-180     4-32  (46)
127 PF13719 zinc_ribbon_5:  zinc-r  23.8      34 0.00074   18.6   0.5    7   69-75      5-11  (37)
128 PF01844 HNH:  HNH endonuclease  23.7      32 0.00069   19.2   0.3   20  181-200    25-44  (47)
129 PF11077 DUF2616:  Protein of u  23.6      46   0.001   25.2   1.3   36   31-66    137-172 (173)
130 PF12898 Stc1:  Stc1 domain;  I  23.4      13 0.00028   24.5  -1.5   27  171-197    52-82  (84)
131 KOG3002|consensus               22.8      34 0.00073   28.4   0.4   45   32-77     47-91  (299)
132 PF06524 NOA36:  NOA36 protein;  22.6 1.6E+02  0.0035   24.0   4.2   13  142-154   208-220 (314)
133 PRK01103 formamidopyrimidine/5  22.6      55  0.0012   26.6   1.7   28  142-169   244-271 (274)
134 smart00184 RING Ring finger. E  22.5      38 0.00082   17.3   0.5   24  147-170     2-25  (39)
135 PF05502 Dynactin_p62:  Dynacti  21.8      56  0.0012   29.0   1.7   14  167-180    50-63  (483)
136 PRK14810 formamidopyrimidine-D  21.6      59  0.0013   26.5   1.6   28  142-169   243-270 (272)
137 PF01194 RNA_pol_N:  RNA polyme  21.3      61  0.0013   20.0   1.3   12  143-154     4-15  (60)
138 cd02344 ZZ_HERC2 Zinc finger,   21.1      80  0.0017   18.2   1.7   11  145-155     2-13  (45)
139 PHA02929 N1R/p28-like protein;  21.0      59  0.0013   26.0   1.5   38  143-180   174-227 (238)
140 PF12156 ATPase-cat_bd:  Putati  21.0      51  0.0011   21.8   1.0   31  145-178     2-35  (88)
141 PF13912 zf-C2H2_6:  C2H2-type   20.9      43 0.00093   16.3   0.5   12   34-45      2-13  (27)
142 PRK10445 endonuclease VIII; Pr  20.8      62  0.0013   26.2   1.6   28  142-169   234-261 (263)
143 PRK14714 DNA polymerase II lar  20.5      71  0.0015   31.9   2.1   23  131-153   667-689 (1337)
144 PRK10220 hypothetical protein;  20.4      63  0.0014   22.5   1.3   29   13-46      5-33  (111)
145 PRK14811 formamidopyrimidine-D  20.4      65  0.0014   26.2   1.7   25  143-167   235-259 (269)
146 PF08792 A2L_zn_ribbon:  A2L zi  20.4      93   0.002   16.6   1.7   23   35-60      5-27  (33)
147 PF14149 YhfH:  YhfH-like prote  20.2      13 0.00027   20.6  -1.7   18  139-156     9-26  (37)
148 TIGR00577 fpg formamidopyrimid  20.1      67  0.0015   26.1   1.7   28  142-169   244-271 (272)

No 1  
>KOG2272|consensus
Probab=100.00  E-value=3e-40  Score=253.63  Aligned_cols=194  Identities=34%  Similarity=0.731  Sum_probs=175.8

Q ss_pred             hHHhhCcCc------ccchhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCccccccccccccc
Q psy3653           9 FDDHFSLRC------FQKCVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVS   82 (202)
Q Consensus         9 ~~~~~~~~C------~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~   82 (202)
                      ++...|.||      .++++...+..||.+||.|+.|-.|+.++.|++.+|+.||+.|+..+|+|-|..|++.|.+++|.
T Consensus        10 ~~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiGrVik   89 (332)
T KOG2272|consen   10 LANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIGRVIK   89 (332)
T ss_pred             HHHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchhhHHHH
Confidence            456789999      45788889999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCC----------------------------------------
Q psy3653          83 ALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQG----------------------------------------  122 (202)
Q Consensus        83 ~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~----------------------------------------  122 (202)
                      +++.+||+.||+|..|++.|.+..|+...|+.+|+++-+.                                        
T Consensus        90 amnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~yHFkCt~C  169 (332)
T KOG2272|consen   90 AMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPYHFKCTTC  169 (332)
T ss_pred             hhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCccceecccc
Confidence            9999999999999999999999999888888777544321                                        


Q ss_pred             -----CceeecCCCccccccccccCCCCCCCCCCCcccceeeecCcccccccccccccccccCCCceEeeCCcccChhhH
Q psy3653         123 -----GSFFDHEGLPYCETHYHAKRGSLCAGCHKPITGRCITAMFRKFHPEHFVCAFCLRQLNKGTFKEQNDKPYCHGCF  197 (202)
Q Consensus       123 -----~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~  197 (202)
                           +..-+..|.+||.+|+.+..-+.|..|.+||.+++|.++|+.||.++|+|+.|.+++-+-+.+++.|.+||..+|
T Consensus       170 ~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~  249 (332)
T KOG2272|consen  170 GKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHY  249 (332)
T ss_pred             cccccchhhhhccceeccccccccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccchhhhhhcCchhHHHHH
Confidence                 011123567899999998889999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcC
Q psy3653         198 EKLFG  202 (202)
Q Consensus       198 ~~~fg  202 (202)
                      .+|||
T Consensus       250 ~qLfG  254 (332)
T KOG2272|consen  250 HQLFG  254 (332)
T ss_pred             HHHhh
Confidence            99998


No 2  
>KOG1701|consensus
Probab=100.00  E-value=9.7e-37  Score=249.62  Aligned_cols=170  Identities=31%  Similarity=0.671  Sum_probs=154.3

Q ss_pred             hCcCcccc------hhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccccccCc
Q psy3653          13 FSLRCFQK------CVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVSALNT   86 (202)
Q Consensus        13 ~~~~C~~~------~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~   86 (202)
                      .|.+|.+.      .+.||++.||..||+|.+|++.|.++.||..|+++||+.||.+.. .+|..|+++|.++++.|+|+
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLrA~Gk  354 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILRALGK  354 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHHhccc
Confidence            78899543      478999999999999999999999999999999999999997754 69999999999999999999


Q ss_pred             eecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCcc---cc----eee
Q psy3653          87 QWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPIT---GR----CIT  159 (202)
Q Consensus        87 ~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~---~~----~~~  159 (202)
                      .||+.||+|..|++.|++..|.+                 +.++++||..+|+++|+++|+.|++||.   |+    .|+
T Consensus       355 ayHp~CF~Cv~C~r~ldgipFtv-----------------d~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etvRvv  417 (468)
T KOG1701|consen  355 AYHPGCFTCVVCARCLDGIPFTV-----------------DSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETVRVV  417 (468)
T ss_pred             ccCCCceEEEEeccccCCccccc-----------------cCCCceeeehhhhhhcCcchhhccCCccCCCCCcceEEEE
Confidence            99999999999999999988764                 6788999999999999999999999993   21    378


Q ss_pred             ecCcccccccccccccccccC----CCceEeeCCcccChhhHhhh
Q psy3653         160 AMFRKFHPEHFVCAFCLRQLN----KGTFKEQNDKPYCHGCFEKL  200 (202)
Q Consensus       160 ~~~~~~H~~Cf~C~~C~~~l~----~~~~~~~~~~~yC~~c~~~~  200 (202)
                      ++++.||.+|++|..|+..|+    +...+..||.++|+.|..+.
T Consensus       418 amdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~Ch~~R  462 (468)
T KOG1701|consen  418 AMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTCHLKR  462 (468)
T ss_pred             EccccccccceehhhcCccccccCCCCcceeccCceeechhhhhh
Confidence            999999999999999999998    23389999999999998765


No 3  
>KOG2272|consensus
Probab=99.97  E-value=1.4e-33  Score=216.92  Aligned_cols=164  Identities=34%  Similarity=0.829  Sum_probs=141.8

Q ss_pred             ccchhcccccccccccccccccccccCCCceeeeCCe-------------------------------------------
Q psy3653          18 FQKCVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGK-------------------------------------------   54 (202)
Q Consensus        18 ~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~-------------------------------------------   54 (202)
                      .|++|.||+.+||+.||+|..|++.|++..|+...|+                                           
T Consensus        84 iGrVikamnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~yH  163 (332)
T KOG2272|consen   84 IGRVIKAMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPYH  163 (332)
T ss_pred             hhHHHHhhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCccc
Confidence            5788999999999999999999988877666544444                                           


Q ss_pred             --------------------eeccccccccCCCCCcccccccccccccccCceecccCCCCCCCCCCCCCCceeecCCcc
Q psy3653          55 --------------------PYCRDDYFDLFAPKCGGCNRAIMENYVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKP  114 (202)
Q Consensus        55 --------------------~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~  114 (202)
                                          +||.+|+.+.-.|.|..|.++|.+++|.++|+.||.+.|+|+.|-+|+-+-         
T Consensus       164 FkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGH---------  234 (332)
T KOG2272|consen  164 FKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGH---------  234 (332)
T ss_pred             eecccccccccchhhhhccceeccccccccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccch---------
Confidence                                455555554555778889999998899999999999999999998887654         


Q ss_pred             cCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCcccceeeecCcccccccccccccccccCCCc-eEeeCCcccC
Q psy3653         115 DCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPITGRCITAMFRKFHPEHFVCAFCLRQLNKGT-FKEQNDKPYC  193 (202)
Q Consensus       115 ~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~-~~~~~~~~yC  193 (202)
                               ..+++.|.+||+++|.++++..|..|+.+|.|.++.|+++.|.++||+|+.|++.|...+ |++.|.+|.|
T Consensus       235 ---------rHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G~vv~al~KawCv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~C  305 (332)
T KOG2272|consen  235 ---------RHYEKKGLAYCETHYHQLFGNLCFICNRVIGGDVVSALNKAWCVECFSCSTCDKKLTQKNKFYEFDMKPVC  305 (332)
T ss_pred             ---------hhhhhcCchhHHHHHHHHhhhhheecCCccCccHHHHhhhhhccccccccccccccccccceeeeccchHH
Confidence                     345799999999999999999999999999999999999999999999999999998554 9999999999


Q ss_pred             hhhHhh
Q psy3653         194 HGCFEK  199 (202)
Q Consensus       194 ~~c~~~  199 (202)
                      +.||++
T Consensus       306 KkCy~r  311 (332)
T KOG2272|consen  306 KKCYDR  311 (332)
T ss_pred             HHHHhh
Confidence            999974


No 4  
>KOG1044|consensus
Probab=99.94  E-value=1e-27  Score=202.78  Aligned_cols=175  Identities=25%  Similarity=0.543  Sum_probs=144.8

Q ss_pred             hhhHHhhCcCcccchhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccccccCc
Q psy3653           7 LFFDDHFSLRCFQKCVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVSALNT   86 (202)
Q Consensus         7 ~~~~~~~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~   86 (202)
                      +|+-.-.+++|.|+++.+.++.||..||+|..|+..|....|+.+++.        +++++  ..|...|.+++|+++++
T Consensus        16 ~i~c~~c~~kc~gevlrv~d~~fhi~cf~c~~cg~~la~~gff~k~~~--------~~ygt--~~c~~~~~gevvsa~gk   85 (670)
T KOG1044|consen   16 GIKCDKCRKKCSGEVLRVNDNHFHINCFQCKKCGRNLAEGGFFTKPEN--------RLYGT--DDCRAFVEGEVVSTLGK   85 (670)
T ss_pred             ceehhhhCCccccceeEeeccccceeeeeccccCCCcccccceecccc--------eeecc--cchhhhccceeEecccc
Confidence            344555677889999999999999999999999999999999988886        44555  77888999999999999


Q ss_pred             eecccCCCCCCCCCCCCCCce-eecCCcccCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCc-ccceeeecCcc
Q psy3653          87 QWHSTCFVCRDCKKPVTGKSF-YAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPI-TGRCITAMFRK  164 (202)
Q Consensus        87 ~~H~~Cf~C~~C~~~l~~~~~-~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I-~~~~~~~~~~~  164 (202)
                      .||++||.|+.|+.|+...+. ...+...+|..+.+......          ........|++|++.| .|+.+.|+++.
T Consensus        86 tyh~~cf~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p----------~~~~~ps~cagc~~~lk~gq~llald~q  155 (670)
T KOG1044|consen   86 TYHPKCFSCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSP----------AESYGPSTCAGCGEELKNGQALLALDKQ  155 (670)
T ss_pred             eeccccceecccCCCCCCCCeeeecchhhhhhhhcCcccCCc----------ccccCCccccchhhhhhccceeeeeccc
Confidence            999999999999999955444 44444566666554433321          1113456799999999 79999999999


Q ss_pred             cccccccccccccccCCCceEeeCCcccChhhHhhhcC
Q psy3653         165 FHPEHFVCAFCLRQLNKGTFKEQNDKPYCHGCFEKLFG  202 (202)
Q Consensus       165 ~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~fg  202 (202)
                      ||..||+|..|...|. ++++.+||.|||..+|.+.||
T Consensus       156 whv~cfkc~~c~~vL~-gey~skdg~pyce~dy~~~fg  192 (670)
T KOG1044|consen  156 WHVSCFKCKSCSAVLN-GEYMSKDGVPYCEKDYQAKFG  192 (670)
T ss_pred             eeeeeeehhhhccccc-ceeeccCCCcchhhhhhhhcC
Confidence            9999999999999997 579999999999999999998


No 5  
>KOG1703|consensus
Probab=99.93  E-value=1.7e-27  Score=206.58  Aligned_cols=160  Identities=43%  Similarity=0.864  Sum_probs=150.6

Q ss_pred             chhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccccccCceecccCCCCCCCC
Q psy3653          20 KCVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVSALNTQWHSTCFVCRDCK   99 (202)
Q Consensus        20 ~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~~~H~~Cf~C~~C~   99 (202)
                      +.+.++++.||+.+|.|..|+..+....+...||.+||.+|+.+.+.+.|.+|.++|.++.|.|.+..||++||.|..|+
T Consensus       317 ~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~~~~wH~~cf~C~~C~  396 (479)
T KOG1703|consen  317 KVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCALGRLWHPECFVCADCG  396 (479)
T ss_pred             eeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhccCeechhceeeeccc
Confidence            78889999999999999999999988888999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCcc--cceeeecCccccccccccccccc
Q psy3653         100 KPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPIT--GRCITAMFRKFHPEHFVCAFCLR  177 (202)
Q Consensus       100 ~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~--~~~~~~~~~~~H~~Cf~C~~C~~  177 (202)
                      ++|.+..                  ++..++.+||+.+|..++..+|..|.+||.  +..+.+.+..||..||+|+.|.+
T Consensus       397 ~~~~~~~------------------~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~~~~~~h~~~F~c~~c~~  458 (479)
T KOG1703|consen  397 KPLKNSS------------------FFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQIEADGSPFHGDCFRCANCMK  458 (479)
T ss_pred             CCCCCCc------------------ccccCCccchhhhHhhhccccchhccchhHhhhhHhhccCccccccceehhhhhc
Confidence            8887754                  456888999999999999999999999985  78899999999999999999999


Q ss_pred             ccCCCceEeeCCcccChhhH
Q psy3653         178 QLNKGTFKEQNDKPYCHGCF  197 (202)
Q Consensus       178 ~l~~~~~~~~~~~~yC~~c~  197 (202)
                      .|.++.|+...++|+|.+|+
T Consensus       459 ~l~~~~~~~~~~~p~c~~~~  478 (479)
T KOG1703|consen  459 KLTKKTFFETLDKPLCQKHF  478 (479)
T ss_pred             cccCCceeecCCccccccCC
Confidence            99999999999999999875


No 6  
>KOG1044|consensus
Probab=99.89  E-value=1.5e-24  Score=183.73  Aligned_cols=161  Identities=29%  Similarity=0.642  Sum_probs=138.5

Q ss_pred             ccchhcccccccccccccccccccccCCCcee-eeCCeeecccccccc--------CCCCCcccccccc-cccccccCce
Q psy3653          18 FQKCVTALEKTWHTEHFFCAQCGKQFGEDGFH-EKDGKPYCRDDYFDL--------FAPKCGGCNRAIM-ENYVSALNTQ   87 (202)
Q Consensus        18 ~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~-~~~g~~yC~~c~~~~--------~~~~C~~C~~~I~-~~~v~~~~~~   87 (202)
                      .++++.++|++||+.||.|++|+.+.....-. .......|+.|-.-.        ....|++|++.|. ++.+.|+++.
T Consensus        76 ~gevvsa~gktyh~~cf~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llald~q  155 (670)
T KOG1044|consen   76 EGEVVSTLGKTYHPKCFSCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLALDKQ  155 (670)
T ss_pred             cceeEecccceeccccceecccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeeeccc
Confidence            46789999999999999999999998765444 444457788876432        2237999999996 7889999999


Q ss_pred             ecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCcccceeeecCccccc
Q psy3653          88 WHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPITGRCITAMFRKFHP  167 (202)
Q Consensus        88 ~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~H~  167 (202)
                      ||..||+|..|...|.+                   .++.++|.|||+++|.+.|+.+|..|.+-|.|.++.|.|++||+
T Consensus       156 whv~cfkc~~c~~vL~g-------------------ey~skdg~pyce~dy~~~fgvkc~~c~~fisgkvLqag~kh~HP  216 (670)
T KOG1044|consen  156 WHVSCFKCKSCSAVLNG-------------------EYMSKDGVPYCEKDYQAKFGVKCEECEKFISGKVLQAGDKHFHP  216 (670)
T ss_pred             eeeeeeehhhhcccccc-------------------eeeccCCCcchhhhhhhhcCeehHHhhhhhhhhhhhccCcccCc
Confidence            99999999999999977                   46789999999999999999999999999999999999999999


Q ss_pred             ccccccccccccCCCc-eEeeCCcccChhhH
Q psy3653         168 EHFVCAFCLRQLNKGT-FKEQNDKPYCHGCF  197 (202)
Q Consensus       168 ~Cf~C~~C~~~l~~~~-~~~~~~~~yC~~c~  197 (202)
                      .|-+|+.|+..+..|+ .+.....+|=+.|-
T Consensus       217 tCARCsRCgqmF~eGEEMYlQGs~iWHP~C~  247 (670)
T KOG1044|consen  217 TCARCSRCGQMFGEGEEMYLQGSEIWHPDCK  247 (670)
T ss_pred             chhhhhhhccccccchheeeccccccCCccc
Confidence            9999999999999776 77777777766663


No 7  
>KOG1701|consensus
Probab=99.88  E-value=7.9e-25  Score=179.84  Aligned_cols=117  Identities=33%  Similarity=0.786  Sum_probs=105.6

Q ss_pred             CCCcccccccccc--cccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccccCCC
Q psy3653          67 PKCGGCNRAIMEN--YVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGS  144 (202)
Q Consensus        67 ~~C~~C~~~I~~~--~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~  144 (202)
                      .+|++|++.|++.  .+.||++.||..||+|..|.+.|.++.||.                  .|+++||+.+|.. ..+
T Consensus       275 ~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~------------------v~~k~~CE~cyq~-tle  335 (468)
T KOG1701|consen  275 GICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQ------------------VDGKPYCEGCYQD-TLE  335 (468)
T ss_pred             hhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccc------------------cCCcccchHHHHH-HHH
Confidence            3999999999854  679999999999999999999999987765                  5666788888865 478


Q ss_pred             CCCCCCCCcccceeeecCcccccccccccccccccCCCceEe-eCCcccChhhHhhhcC
Q psy3653         145 LCAGCHKPITGRCITAMFRKFHPEHFVCAFCLRQLNKGTFKE-QNDKPYCHGCFEKLFG  202 (202)
Q Consensus       145 ~C~~C~~~I~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~-~~~~~yC~~c~~~~fg  202 (202)
                      +|..|+++|.+++|.|.|+.||+.||+|..|++.|++..|.+ .++++||..+|.++|+
T Consensus       336 kC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfA  394 (468)
T KOG1701|consen  336 KCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFA  394 (468)
T ss_pred             HHhhhhhHHHHHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcC
Confidence            999999999999999999999999999999999999999985 5899999999999986


No 8  
>KOG1703|consensus
Probab=99.85  E-value=2.8e-22  Score=174.00  Aligned_cols=165  Identities=27%  Similarity=0.490  Sum_probs=152.7

Q ss_pred             chhccccccccccccccc-ccccccCCCceeeeCCeeeccccccccCCCCCccccccccc-ccccccCceecccCCCCCC
Q psy3653          20 KCVTALEKTWHTEHFFCA-QCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIME-NYVSALNTQWHSTCFVCRD   97 (202)
Q Consensus        20 ~~~~~~~~~~H~~Cf~C~-~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~-~~v~~~~~~~H~~Cf~C~~   97 (202)
                      ....+....||..-+++. .+...|....++.+.+.+.+..+|...+.+.|..|.+.|.+ +++.++++.||+.+|.|+.
T Consensus       256 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~  335 (479)
T KOG1703|consen  256 PLVSAPRPASEGLHMKVEKELPLLLVESEALKKLREEEKPAEYHNVTRPLCLSCNQKIRSVKVIVALGKEWHPEHFSCEV  335 (479)
T ss_pred             cceecccccccccccccccccchhhcccccccccccccccccccccccccccccccCcccceeEeeccccccccceeecc
Confidence            456778999999999999 88888888889999999999999999999999999999998 9999999999999999999


Q ss_pred             CCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCcccceeeecCccccccccccccccc
Q psy3653          98 CKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPITGRCITAMFRKFHPEHFVCAFCLR  177 (202)
Q Consensus        98 C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~H~~Cf~C~~C~~  177 (202)
                      |...+....+                  ...+|.+||..++.+.+++.|.+|+++|.++.|.+.++.||++||.|..|++
T Consensus       336 ~~~~~~~~~~------------------~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~~~~wH~~cf~C~~C~~  397 (479)
T KOG1703|consen  336 CAIVILDGGP------------------RELDGKILCHECFHAPFRPNCKRCLLPILEEGVCALGRLWHPECFVCADCGK  397 (479)
T ss_pred             ccccccCCCc------------------cccCCCccHHHHHHHhhCccccccCCchHHhHhhhccCeechhceeeecccC
Confidence            9988865433                  4578899999999999999999999999999999999999999999999999


Q ss_pred             ccCCCceEeeCCcccChhhHhhhcC
Q psy3653         178 QLNKGTFKEQNDKPYCHGCFEKLFG  202 (202)
Q Consensus       178 ~l~~~~~~~~~~~~yC~~c~~~~fg  202 (202)
                      +|.++.|+..++.|||..||.++|+
T Consensus       398 ~~~~~~~~~~~~~pyce~~~~~~~~  422 (479)
T KOG1703|consen  398 PLKNSSFFESDGEPYCEDHYKKLFT  422 (479)
T ss_pred             CCCCCcccccCCccchhhhHhhhcc
Confidence            9999999999999999999999874


No 9  
>KOG4577|consensus
Probab=99.78  E-value=6.1e-21  Score=149.79  Aligned_cols=121  Identities=29%  Similarity=0.776  Sum_probs=104.4

Q ss_pred             cccccCCCCCccccccccccc-ccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccc
Q psy3653          60 DYFDLFAPKCGGCNRAIMENY-VSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHY  138 (202)
Q Consensus        60 c~~~~~~~~C~~C~~~I~~~~-v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~  138 (202)
                      ++.....|+|++|.+.|.+++ +.++++.||..|++|+.|..+|...                   .|.++|..||++++
T Consensus        27 df~~~eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~dr-------------------CFsR~~s~yCkedF   87 (383)
T KOG4577|consen   27 DFSNVEIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLADR-------------------CFSREGSVYCKEDF   87 (383)
T ss_pred             cccccccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHHH-------------------HhhcCCceeehHHH
Confidence            344445689999999999985 4899999999999999999999763                   45789999999999


Q ss_pred             cccCCCCCCCCCCCcccc-ee-eecCcccccccccccccccccCCCc-eE-eeCCcccChhhHhh
Q psy3653         139 HAKRGSLCAGCHKPITGR-CI-TAMFRKFHPEHFVCAFCLRQLNKGT-FK-EQNDKPYCHGCFEK  199 (202)
Q Consensus       139 ~~~~~~~C~~C~~~I~~~-~~-~~~~~~~H~~Cf~C~~C~~~l~~~~-~~-~~~~~~yC~~c~~~  199 (202)
                      .++|+.+|..|+..|... +| .|.+..||..||.|..|+++|.+|+ |+ ..|.++.|+..|+.
T Consensus        88 fKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~  152 (383)
T KOG4577|consen   88 FKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYET  152 (383)
T ss_pred             HHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHH
Confidence            999999999999999544 33 5778899999999999999999776 66 56899999999975


No 10 
>KOG4577|consensus
Probab=99.76  E-value=4.1e-20  Score=145.15  Aligned_cols=97  Identities=32%  Similarity=0.836  Sum_probs=84.3

Q ss_pred             hhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccc-cc-cccCceecccCCCCCCC
Q psy3653          21 CVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMEN-YV-SALNTQWHSTCFVCRDC   98 (202)
Q Consensus        21 ~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~-~v-~~~~~~~H~~Cf~C~~C   98 (202)
                      +++++++.||..|++|++|..+|.+ .++.++|.+||+++|+++|+.+|..|...|.+. +| .|.+..||..||.|..|
T Consensus        48 ilKvl~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC  126 (383)
T KOG4577|consen   48 ILKVLDRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFIC  126 (383)
T ss_pred             HHHHHhhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhh
Confidence            5789999999999999999999976 477999999999999999999999999999854 44 68899999999999999


Q ss_pred             CCCC-CCCceeecC-CcccCCC
Q psy3653          99 KKPV-TGKSFYAME-GKPDCRQ  118 (202)
Q Consensus        99 ~~~l-~~~~~~~~~-~~~~C~~  118 (202)
                      ++.| ++++||.++ .+..|..
T Consensus       127 ~R~L~TGdEFYLmeD~rLvCK~  148 (383)
T KOG4577|consen  127 KRQLATGDEFYLMEDARLVCKD  148 (383)
T ss_pred             hcccccCCeeEEeccceeehhh
Confidence            9999 788888753 2444433


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.61  E-value=6.5e-16  Score=96.40  Aligned_cols=56  Identities=50%  Similarity=1.025  Sum_probs=51.1

Q ss_pred             CCCCCCCccccee--eecCcccccccccccccccccCCCceEeeCCcccChhhHhhhc
Q psy3653         146 CAGCHKPITGRCI--TAMFRKFHPEHFVCAFCLRQLNKGTFKEQNDKPYCHGCFEKLF  201 (202)
Q Consensus       146 C~~C~~~I~~~~~--~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~f  201 (202)
                      |++|+++|.+..+  .+.|+.||++||+|..|+++|.++.++..+++|||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            7899999964433  5999999999999999999999999999999999999999987


No 12 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.37  E-value=2.2e-13  Score=84.87  Aligned_cols=44  Identities=50%  Similarity=1.083  Sum_probs=40.8

Q ss_pred             hcccccccccccccccccccccCCCceeeeCCeeeccccccccC
Q psy3653          22 VTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLF   65 (202)
Q Consensus        22 ~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~   65 (202)
                      +.++|+.||+.||+|+.|+++|.+..++..||++||++||.++|
T Consensus        15 ~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen   15 IKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             EEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             EEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            36999999999999999999999888999999999999998764


No 13 
>KOG1700|consensus
Probab=99.25  E-value=2e-12  Score=100.11  Aligned_cols=136  Identities=26%  Similarity=0.542  Sum_probs=100.9

Q ss_pred             CCCCCcccccccc-cccccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCC-----Cceee----------c
Q psy3653          65 FAPKCGGCNRAIM-ENYVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQG-----GSFFD----------H  128 (202)
Q Consensus        65 ~~~~C~~C~~~I~-~~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~-----~~~~~----------~  128 (202)
                      ...+|..|++.+. .+.+...+..||+.||+|..|.+.|...+....++.++|..+...     +..+.          .
T Consensus         6 ~~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (200)
T KOG1700|consen    6 TTDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGK   85 (200)
T ss_pred             ccchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCc
Confidence            4568999999997 445558899999999999999999998888889999999873210     00000          0


Q ss_pred             CCCcc---cccc-----ccccCCCCCCCCCCCc-ccceeeecCcccccccccccccccccCCCceEeeCCcccChhhHhh
Q psy3653         129 EGLPY---CETH-----YHAKRGSLCAGCHKPI-TGRCITAMFRKFHPEHFVCAFCLRQLNKGTFKEQNDKPYCHGCFEK  199 (202)
Q Consensus       129 ~g~~~---C~~~-----~~~~~~~~C~~C~~~I-~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~  199 (202)
                      ++...   ...-     ........|.+|++.+ ..+.+...+..||+.||+|+.|+..|+.+.+...++.+||...+.+
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~  165 (200)
T KOG1700|consen   86 DGKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQ  165 (200)
T ss_pred             ccccccccccccchhHHhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhhe
Confidence            11110   1000     0111245799999999 5667888899999999999999999999999999999999766654


Q ss_pred             h
Q psy3653         200 L  200 (202)
Q Consensus       200 ~  200 (202)
                      +
T Consensus       166 ~  166 (200)
T KOG1700|consen  166 L  166 (200)
T ss_pred             e
Confidence            3


No 14 
>KOG1700|consensus
Probab=99.13  E-value=1.4e-11  Score=95.41  Aligned_cols=107  Identities=29%  Similarity=0.684  Sum_probs=85.6

Q ss_pred             hCcCcccch-----hcccccccccccccccccccccCCCceeeeCCeeeccccccccCCC--------------------
Q psy3653          13 FSLRCFQKC-----VTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAP--------------------   67 (202)
Q Consensus        13 ~~~~C~~~~-----~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~--------------------   67 (202)
                      -|++|.+.+     +...|..||+.||+|..|.+.|+...+.++++.+||+.+|...+++                    
T Consensus         9 kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (200)
T KOG1700|consen    9 KCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGKDGK   88 (200)
T ss_pred             hhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCcccc
Confidence            577885433     3456899999999999999999999999999999999976444332                    


Q ss_pred             ---------------------CCccccccccc-ccccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCC
Q psy3653          68 ---------------------KCGGCNRAIME-NYVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQP  119 (202)
Q Consensus        68 ---------------------~C~~C~~~I~~-~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~  119 (202)
                                           .|.+|++.+.+ +.+...+..||..||+|+.|+..|+..++....+.++|..+
T Consensus        89 ~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~  162 (200)
T KOG1700|consen   89 SLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHH  162 (200)
T ss_pred             cccccccccchhHHhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchh
Confidence                                 29999999984 56678899999999999999999988777665555555443


No 15 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.80  E-value=3.3e-09  Score=60.17  Aligned_cols=36  Identities=44%  Similarity=0.918  Sum_probs=32.6

Q ss_pred             CCCCCCCCccc--ceeeecCcccccccccccccccccC
Q psy3653         145 LCAGCHKPITG--RCITAMFRKFHPEHFVCAFCLRQLN  180 (202)
Q Consensus       145 ~C~~C~~~I~~--~~~~~~~~~~H~~Cf~C~~C~~~l~  180 (202)
                      +|.+|+++|.+  ..+.+.++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            58999999965  6788899999999999999999986


No 16 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.55  E-value=4e-08  Score=55.56  Aligned_cols=36  Identities=42%  Similarity=1.037  Sum_probs=32.0

Q ss_pred             CCccccccccc--ccccccCceecccCCCCCCCCCCCC
Q psy3653          68 KCGGCNRAIME--NYVSALNTQWHSTCFVCRDCKKPVT  103 (202)
Q Consensus        68 ~C~~C~~~I~~--~~v~~~~~~~H~~Cf~C~~C~~~l~  103 (202)
                      +|.+|+++|.+  ..+.+++..||+.||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            58899999986  5778899999999999999999885


No 17 
>KOG0490|consensus
Probab=97.48  E-value=2.6e-05  Score=61.67  Aligned_cols=90  Identities=31%  Similarity=0.764  Sum_probs=72.3

Q ss_pred             hhcccccccccccccccccccccC--CCceeeeCCeeeccccccc--cCCCCCcccccccc--cccccccCceecccCCC
Q psy3653          21 CVTALEKTWHTEHFFCAQCGKQFG--EDGFHEKDGKPYCRDDYFD--LFAPKCGGCNRAIM--ENYVSALNTQWHSTCFV   94 (202)
Q Consensus        21 ~~~~~~~~~H~~Cf~C~~C~~~l~--~~~~~~~~g~~yC~~c~~~--~~~~~C~~C~~~I~--~~~v~~~~~~~H~~Cf~   94 (202)
                      .+.+.+..||..|++|..|..+|.  ...|.. +|..||..+|..  .+..+|.+|...+.  +.+..+.... |-.||.
T Consensus        11 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~~ler~f~~~-h~Pd~~   88 (235)
T KOG0490|consen   11 LLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRCARCKFTISQLDELERAFEKV-HLPCFA   88 (235)
T ss_pred             HhhcccHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccccCCCCCcCHHHHHHHhhcCC-CcCccc
Confidence            345568999999999999999997  444445 999999999998  78889999999986  4455566666 999999


Q ss_pred             CCCCCCCC-CCCceeecCC
Q psy3653          95 CRDCKKPV-TGKSFYAMEG  112 (202)
Q Consensus        95 C~~C~~~l-~~~~~~~~~~  112 (202)
                      |..|.+.+ ...++.+..|
T Consensus        89 ~r~~la~~~~~~e~rVqvw  107 (235)
T KOG0490|consen   89 CRECLALLLTGDEFRVQVW  107 (235)
T ss_pred             hHHHHhhcCCCCeeeeehh
Confidence            99998876 5666666555


No 18 
>KOG0490|consensus
Probab=97.30  E-value=8.1e-05  Score=58.83  Aligned_cols=109  Identities=28%  Similarity=0.579  Sum_probs=82.3

Q ss_pred             cccccccc-cccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccc--cCCCCCCC
Q psy3653          72 CNRAIMEN-YVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHA--KRGSLCAG  148 (202)
Q Consensus        72 C~~~I~~~-~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~--~~~~~C~~  148 (202)
                      |+..|.+. .+.+.+..||..|..|..|..+|...                 ...+.++|..||..++..  .+..+|.+
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~g~~~~~~d~~~~~~~~~rr~r   64 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVG-----------------DTCFSKDGSIYCKRDYQREFKFSKRCAR   64 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccC-----------------CCcccCCCcccccccchhhhhccccccC
Confidence            56677665 34566899999999999999888611                 123345888999999987  67889999


Q ss_pred             CCCCc--ccceeeecCcccccccccccccccccCCCc-eEeeCC-cccChhhHh
Q psy3653         149 CHKPI--TGRCITAMFRKFHPEHFVCAFCLRQLNKGT-FKEQND-KPYCHGCFE  198 (202)
Q Consensus       149 C~~~I--~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~-~~~~~~-~~yC~~c~~  198 (202)
                      |...|  .+++..+..+. |..||.|..|.+.+..++ +.+.+. +..|...+.
T Consensus        65 t~~~~~ql~~ler~f~~~-h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~  117 (235)
T KOG0490|consen   65 CKFTISQLDELERAFEKV-HLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRK  117 (235)
T ss_pred             CCCCcCHHHHHHHhhcCC-CcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhh
Confidence            99998  35555667777 999999999999876555 666555 777776654


No 19 
>KOG1702|consensus
Probab=97.07  E-value=5.4e-05  Score=57.78  Aligned_cols=57  Identities=25%  Similarity=0.523  Sum_probs=48.0

Q ss_pred             CCCCCCCCCc-ccceeeecCcccccccccccccccccCCCceEeeCCcccChhhHhhh
Q psy3653         144 SLCAGCHKPI-TGRCITAMFRKFHPEHFVCAFCLRQLNKGTFKEQNDKPYCHGCFEKL  200 (202)
Q Consensus       144 ~~C~~C~~~I-~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~  200 (202)
                      ..|..|++.+ .-+-|.-+++.||..||+|..|+.+|+-..+-..+.+|||...|.+.
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq   62 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQ   62 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccc
Confidence            3466788877 34557888999999999999999999988888889999999998654


No 20 
>KOG1702|consensus
Probab=96.62  E-value=0.00051  Score=52.54  Aligned_cols=60  Identities=22%  Similarity=0.546  Sum_probs=49.6

Q ss_pred             CCCccccccccc-ccccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCcee
Q psy3653          67 PKCGGCNRAIME-NYVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFF  126 (202)
Q Consensus        67 ~~C~~C~~~I~~-~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~  126 (202)
                      +.+..|++.+.+ +-+.-+++.||..||+|..|+.+|.-..+...+.+|+|...++++.+.
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~at   65 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQVAT   65 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccceee
Confidence            456778888874 567788999999999999999999888888888899998888776554


No 21 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=91.59  E-value=0.071  Score=29.58  Aligned_cols=32  Identities=31%  Similarity=0.658  Sum_probs=23.0

Q ss_pred             CCCCCCCcccce--eeecCcccccccccccccccccC
Q psy3653         146 CAGCHKPITGRC--ITAMFRKFHPEHFVCAFCLRQLN  180 (202)
Q Consensus       146 C~~C~~~I~~~~--~~~~~~~~H~~Cf~C~~C~~~l~  180 (202)
                      |.-|+++|.++.  +...++.|+   |.|..|.+.|.
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~---fCC~tC~~~fk   34 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY---FCCPTCLSQFK   34 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE---EECHHHHHHHH
Confidence            677999996654  456788888   66677766553


No 22 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=91.03  E-value=0.2  Score=31.36  Aligned_cols=48  Identities=15%  Similarity=0.254  Sum_probs=24.8

Q ss_pred             ccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYV   81 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v   81 (202)
                      ++|+.|..-|...-....=+..||..|..+.++..|..|+.|...+.+
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~qD~   55 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQDI   55 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-SS-
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHHHH
Confidence            678888887766544455567899999999888999999998864433


No 23 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=89.21  E-value=0.33  Score=29.31  Aligned_cols=38  Identities=18%  Similarity=0.433  Sum_probs=26.2

Q ss_pred             CCCCCCCCCCCcc--cceee--ecCcccccccc----cccc--ccccc
Q psy3653         142 RGSLCAGCHKPIT--GRCIT--AMFRKFHPEHF----VCAF--CLRQL  179 (202)
Q Consensus       142 ~~~~C~~C~~~I~--~~~~~--~~~~~~H~~Cf----~C~~--C~~~l  179 (202)
                      .+.+|..|+++|.  +.+|+  .-+..||++|.    .|..  |+..+
T Consensus         4 ~~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~~g~C~~~~c~~~~   51 (54)
T PF14446_consen    4 EGCKCPVCGKKFKDGDDIVVCPECGAPYHRDCWEKAGGCINYSCGTGF   51 (54)
T ss_pred             cCccChhhCCcccCCCCEEECCCCCCcccHHHHhhCCceEeccCCCCc
Confidence            3578999999993  34332  34788999997    4665  55543


No 24 
>KOG2462|consensus
Probab=82.76  E-value=0.81  Score=36.98  Aligned_cols=129  Identities=17%  Similarity=0.351  Sum_probs=74.2

Q ss_pred             cccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccccccCceecccCCCCCCCCCCCCCCceeec
Q psy3653          31 TEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVSALNTQWHSTCFVCRDCKKPVTGKSFYAM  110 (202)
Q Consensus        31 ~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~  110 (202)
                      ...++|.+|++.++...=..+..+.-|.-+-  .-+..|..|++.-.......|-..-|.-=+.|..|++.|...  |..
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s--~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRP--WLL  203 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDS--KKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRP--WLL  203 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccc--cccccCCCCCceeeehHHHhhHhhccCCCcccccccccccch--HHh
Confidence            4568999999998765444566666665544  334589999987653322233344466567899999887531  111


Q ss_pred             CCcccCCCCCCCCceeecCCCccccccccccCCCCCCCCCCCcccce-eeec-CcccccccccccccccccCCCce
Q psy3653         111 EGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCHKPITGRC-ITAM-FRKFHPEHFVCAFCLRQLNKGTF  184 (202)
Q Consensus       111 ~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~~~~-~~~~-~~~~H~~Cf~C~~C~~~l~~~~~  184 (202)
                      .|+.           -.+.|         + ..-.|+.|++...++. +.|- ...=+.+=|.|..|++.+....+
T Consensus       204 QGHi-----------RTHTG---------E-KPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~Sy  258 (279)
T KOG2462|consen  204 QGHI-----------RTHTG---------E-KPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSY  258 (279)
T ss_pred             hccc-----------ccccC---------C-CCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHH
Confidence            1110           00000         0 1235889998886642 2221 11123335788999888775443


No 25 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=82.29  E-value=0.46  Score=26.04  Aligned_cols=32  Identities=16%  Similarity=0.625  Sum_probs=22.6

Q ss_pred             hCcCcccchhcccccccccccccccccccccC
Q psy3653          13 FSLRCFQKCVTALEKTWHTEHFFCAQCGKQFG   44 (202)
Q Consensus        13 ~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~   44 (202)
                      .|+.|..++....++.||..=..|..||=+++
T Consensus         1 lC~~C~~Ey~~p~~RR~~~~~isC~~CGPr~~   32 (35)
T PF07503_consen    1 LCDDCLKEYFDPSNRRFHYQFISCTNCGPRYS   32 (35)
T ss_dssp             --HHHHHHHCSTTSTTTT-TT--BTTCC-SCC
T ss_pred             CCHHHHHHHcCCCCCcccCcCccCCCCCCCEE
Confidence            37778888888899999999999999987663


No 26 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=81.13  E-value=1.2  Score=25.36  Aligned_cols=28  Identities=36%  Similarity=0.822  Sum_probs=19.4

Q ss_pred             cccccccccccccccCCCceeeeCCeeecccc
Q psy3653          29 WHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDD   60 (202)
Q Consensus        29 ~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c   60 (202)
                      |-.-=-.|..|+.||-    ..++|+.||..|
T Consensus        13 ~~ML~~~Cp~C~~PL~----~~k~g~~~Cv~C   40 (41)
T PF06677_consen   13 WTMLDEHCPDCGTPLM----RDKDGKIYCVSC   40 (41)
T ss_pred             HhHhcCccCCCCCeeE----EecCCCEECCCC
Confidence            4444446778888873    368999998765


No 27 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=81.12  E-value=1.2  Score=24.58  Aligned_cols=25  Identities=32%  Similarity=0.535  Sum_probs=18.9

Q ss_pred             ccccccccccCCCceeeeCCeeecccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYF   62 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~   62 (202)
                      +.|..|+..    .|...||..||..|-.
T Consensus         9 ~~C~~C~~~----~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSR----WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCe----EeEccCCEEEhhhCce
Confidence            347888765    4778999999987754


No 28 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=78.38  E-value=0.39  Score=26.31  Aligned_cols=28  Identities=18%  Similarity=0.453  Sum_probs=12.1

Q ss_pred             ccccccccCCCceEeeCCcccChhhHhh
Q psy3653         172 CAFCLRQLNKGTFKEQNDKPYCHGCFEK  199 (202)
Q Consensus       172 C~~C~~~l~~~~~~~~~~~~yC~~c~~~  199 (202)
                      |..|+.++...+....++..+|.+|+.+
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhCc
Confidence            4444444443333334455555555543


No 29 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=78.28  E-value=2.1  Score=30.00  Aligned_cols=26  Identities=23%  Similarity=0.402  Sum_probs=18.3

Q ss_pred             hCcCcccchhcccccccccccccccccccccCCC
Q psy3653          13 FSLRCFQKCVTALEKTWHTEHFFCAQCGKQFGED   46 (202)
Q Consensus        13 ~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   46 (202)
                      .||||..++-..-        ..|..||..|-..
T Consensus         3 ~CPrC~skvC~LP--------~~CpiCgLtLVss   28 (112)
T TIGR00622         3 FCPQCRAKVCELP--------VECPICGLTLILS   28 (112)
T ss_pred             cCCCCCCCccCCC--------CcCCcCCCEEecc
Confidence            5889988775544        5678888877543


No 30 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=77.77  E-value=1.6  Score=29.74  Aligned_cols=29  Identities=17%  Similarity=0.313  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCcccce-e-eecCccccccccc
Q psy3653         143 GSLCAGCHKPITGRC-I-TAMFRKFHPEHFV  171 (202)
Q Consensus       143 ~~~C~~C~~~I~~~~-~-~~~~~~~H~~Cf~  171 (202)
                      ...|+.|+++|.... + -..|..+|..|.+
T Consensus        78 ~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   78 STKCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CCCccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            467999999995433 3 3346778888863


No 31 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=77.15  E-value=1.7  Score=21.36  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=4.6

Q ss_pred             CCCCCCCcc
Q psy3653         146 CAGCHKPIT  154 (202)
Q Consensus       146 C~~C~~~I~  154 (202)
                      |+.|+..|.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            455555553


No 32 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=77.15  E-value=3.8  Score=25.67  Aligned_cols=31  Identities=26%  Similarity=0.415  Sum_probs=15.4

Q ss_pred             CCccccccccccCCCCCCCCCCCcccceeee
Q psy3653         130 GLPYCETHYHAKRGSLCAGCHKPITGRCITA  160 (202)
Q Consensus       130 g~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~  160 (202)
                      ...+|..|.....+..|+.|..|...+.+..
T Consensus        27 eH~fCs~Ci~~~~~~~CPvC~~Paw~qD~~~   57 (65)
T PF14835_consen   27 EHIFCSSCIRDCIGSECPVCHTPAWIQDIQI   57 (65)
T ss_dssp             S--B-TTTGGGGTTTB-SSS--B-S-SS---
T ss_pred             ccHHHHHHhHHhcCCCCCCcCChHHHHHHHh
Confidence            3567777777777888999999986554443


No 33 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=75.71  E-value=1.3  Score=34.17  Aligned_cols=31  Identities=29%  Similarity=0.505  Sum_probs=27.2

Q ss_pred             ccccccccccCCCceeeeCCeeecccccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYFDL   64 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~   64 (202)
                      -+|+.||....+..-...+|++.|..|+.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            6899999999887777899999999999754


No 34 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=75.10  E-value=1.9  Score=30.99  Aligned_cols=22  Identities=36%  Similarity=0.910  Sum_probs=17.4

Q ss_pred             cccccccccCCCceeeeCCeeeccccc
Q psy3653          35 FCAQCGKQFGEDGFHEKDGKPYCRDDY   61 (202)
Q Consensus        35 ~C~~C~~~l~~~~~~~~~g~~yC~~c~   61 (202)
                      .|..||.||    | .+||.+||..|-
T Consensus        30 hCp~Cg~PL----F-~KdG~v~CPvC~   51 (131)
T COG1645          30 HCPKCGTPL----F-RKDGEVFCPVCG   51 (131)
T ss_pred             hCcccCCcc----e-eeCCeEECCCCC
Confidence            368899988    4 499999987764


No 35 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=74.17  E-value=2.5  Score=25.16  Aligned_cols=28  Identities=32%  Similarity=0.759  Sum_probs=17.0

Q ss_pred             ccccccccCCCc-eEeeCCcccChhhHhhh
Q psy3653         172 CAFCLRQLNKGT-FKEQNDKPYCHGCFEKL  200 (202)
Q Consensus       172 C~~C~~~l~~~~-~~~~~~~~yC~~c~~~~  200 (202)
                      |..|+..++--. +-..|| ..|..|+.++
T Consensus         2 C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    2 CAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCccccccccccceeccCc-cchHHHHHHh
Confidence            566666665322 456666 5777777664


No 36 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=74.08  E-value=2.1  Score=25.59  Aligned_cols=27  Identities=33%  Similarity=0.626  Sum_probs=16.1

Q ss_pred             ccccccccCCCceeeeCCeeeccc-ccc
Q psy3653          36 CAQCGKQFGEDGFHEKDGKPYCRD-DYF   62 (202)
Q Consensus        36 C~~C~~~l~~~~~~~~~g~~yC~~-c~~   62 (202)
                      |..|.-.++...-+.+||+.||.+ |..
T Consensus        10 C~~C~C~V~~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen   10 CPSCSCVVSEEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             STT----B-TTTSEESSS-EESSHHHHH
T ss_pred             CCCCEeEECchHhHHhCCEeeecHHHhc
Confidence            567888888777899999999964 543


No 37 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=71.54  E-value=1.8  Score=22.53  Aligned_cols=15  Identities=27%  Similarity=0.465  Sum_probs=8.2

Q ss_pred             CCCCCCCCCccccee
Q psy3653         144 SLCAGCHKPITGRCI  158 (202)
Q Consensus       144 ~~C~~C~~~I~~~~~  158 (202)
                      .+|.+|+.+|....+
T Consensus         2 ~~C~rC~~~~~~~~~   16 (30)
T PF06827_consen    2 EKCPRCWNYIEDIGI   16 (30)
T ss_dssp             SB-TTT--BBEEEEE
T ss_pred             CcCccCCCcceEeEe
Confidence            578899988865444


No 38 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=71.48  E-value=1.5  Score=28.84  Aligned_cols=29  Identities=38%  Similarity=0.843  Sum_probs=21.4

Q ss_pred             cccccccccCCCcee--eeCC---eeeccccccc
Q psy3653          35 FCAQCGKQFGEDGFH--EKDG---KPYCRDDYFD   63 (202)
Q Consensus        35 ~C~~C~~~l~~~~~~--~~~g---~~yC~~c~~~   63 (202)
                      .|+.||-||+....+  +.||   .-||.-||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            489999999876533  3455   3699999865


No 39 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=71.10  E-value=1.4  Score=34.02  Aligned_cols=30  Identities=30%  Similarity=0.502  Sum_probs=24.6

Q ss_pred             ccccccccccCCCceEeeCCcccChhhHhh
Q psy3653         170 FVCAFCLRQLNKGTFKEQNDKPYCHGCFEK  199 (202)
Q Consensus       170 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~  199 (202)
                      -+|..|+..+...+-...+|++.|..|+.+
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~  202 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEK  202 (206)
T ss_pred             eeccccCcccccchhhhcCCceeccccccc
Confidence            578888887776677788999999999974


No 40 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=68.59  E-value=4.2  Score=24.66  Aligned_cols=45  Identities=18%  Similarity=0.428  Sum_probs=32.4

Q ss_pred             cccccccccCCCc---eeeeCCeeeccccccccCCCCCcccccccccc
Q psy3653          35 FCAQCGKQFGEDG---FHEKDGKPYCRDDYFDLFAPKCGGCNRAIMEN   79 (202)
Q Consensus        35 ~C~~C~~~l~~~~---~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~   79 (202)
                      .|..|++.|..++   ++=.-.=.||.+|....+...|..|+..+..+
T Consensus         7 nCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGelv~R   54 (57)
T PF06906_consen    7 NCECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGELVRR   54 (57)
T ss_pred             CccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCccccC
Confidence            3577888886543   44344457899999988888999998877543


No 41 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=68.21  E-value=3.3  Score=27.84  Aligned_cols=42  Identities=19%  Similarity=0.543  Sum_probs=25.3

Q ss_pred             cccccccccccccccCCCceeeeCCeeeccccccccCCCCCccccccccc
Q psy3653          29 WHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIME   78 (202)
Q Consensus        29 ~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~   78 (202)
                      |-+.=-+|..|+..+..      .|..||..|..+.  -.|+-|++.|.+
T Consensus        40 y~~~~~~C~~CK~~v~q------~g~~YCq~CAYkk--GiCamCGKki~d   81 (90)
T PF10235_consen   40 YAPYSSKCKICKTKVHQ------PGAKYCQTCAYKK--GICAMCGKKILD   81 (90)
T ss_pred             ccccCcccccccccccc------CCCccChhhhccc--CcccccCCeecc
Confidence            33333356777665532      3566888886554  378888877753


No 42 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=67.58  E-value=4.7  Score=27.35  Aligned_cols=27  Identities=26%  Similarity=0.405  Sum_probs=16.7

Q ss_pred             cccccccccCCCceee-eCCeeeccccc
Q psy3653          35 FCAQCGKQFGEDGFHE-KDGKPYCRDDY   61 (202)
Q Consensus        35 ~C~~C~~~l~~~~~~~-~~g~~yC~~c~   61 (202)
                      +|+.|+++|....|.. -+|..++..|.
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEecccc
Confidence            4777777777665553 44566655554


No 43 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=65.57  E-value=1.8  Score=29.70  Aligned_cols=27  Identities=37%  Similarity=0.496  Sum_probs=19.4

Q ss_pred             CCCCCCCCc-ccceeeec-Cccccccccc
Q psy3653         145 LCAGCHKPI-TGRCITAM-FRKFHPEHFV  171 (202)
Q Consensus       145 ~C~~C~~~I-~~~~~~~~-~~~~H~~Cf~  171 (202)
                      +|..|+++| .|+..++. +..-|-.||+
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~   32 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFR   32 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHH
Confidence            588899999 56665554 4556888885


No 44 
>PF12773 DZR:  Double zinc ribbon
Probab=64.52  E-value=3.7  Score=23.93  Aligned_cols=12  Identities=25%  Similarity=0.935  Sum_probs=8.3

Q ss_pred             CCCCCCCCCCcc
Q psy3653         143 GSLCAGCHKPIT  154 (202)
Q Consensus       143 ~~~C~~C~~~I~  154 (202)
                      +..|..|+.++.
T Consensus        12 ~~fC~~CG~~l~   23 (50)
T PF12773_consen   12 AKFCPHCGTPLP   23 (50)
T ss_pred             ccCChhhcCChh
Confidence            456777777776


No 45 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=58.98  E-value=5.6  Score=22.55  Aligned_cols=39  Identities=23%  Similarity=0.483  Sum_probs=24.2

Q ss_pred             ccccccccCC--CceeeeCCeeeccccccccC--CCCCccccc
Q psy3653          36 CAQCGKQFGE--DGFHEKDGKPYCRDDYFDLF--APKCGGCNR   74 (202)
Q Consensus        36 C~~C~~~l~~--~~~~~~~g~~yC~~c~~~~~--~~~C~~C~~   74 (202)
                      |..|.+.+++  ..+...=|..+|.+|..+..  ...|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            5566666622  23445667788888887776  556766653


No 46 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=58.84  E-value=5.4  Score=24.49  Aligned_cols=36  Identities=22%  Similarity=0.465  Sum_probs=18.2

Q ss_pred             cccccccccCCCceeeeCCeeeccccccccCCCCCccccc
Q psy3653          35 FCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNR   74 (202)
Q Consensus        35 ~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~   74 (202)
                      +|.+||..|.+..   +.-...|.+|-... ..+|..|.+
T Consensus         9 ~CtSCg~~i~~~~---~~~~F~CPnCG~~~-I~RC~~CRk   44 (59)
T PRK14890          9 KCTSCGIEIAPRE---KAVKFLCPNCGEVI-IYRCEKCRK   44 (59)
T ss_pred             cccCCCCcccCCC---ccCEeeCCCCCCee-EeechhHHh
Confidence            5778888776542   12344555553321 124555543


No 47 
>PRK00420 hypothetical protein; Validated
Probab=58.39  E-value=6.2  Score=27.69  Aligned_cols=25  Identities=32%  Similarity=0.572  Sum_probs=17.8

Q ss_pred             ccccccccccCCCceeeeCCeeecccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYF   62 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~   62 (202)
                      -.|..||.+|    |-.++|+.||..|-.
T Consensus        24 ~~CP~Cg~pL----f~lk~g~~~Cp~Cg~   48 (112)
T PRK00420         24 KHCPVCGLPL----FELKDGEVVCPVHGK   48 (112)
T ss_pred             CCCCCCCCcc----eecCCCceECCCCCC
Confidence            5678898877    334888888777643


No 48 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=58.27  E-value=4  Score=27.83  Aligned_cols=29  Identities=38%  Similarity=0.700  Sum_probs=19.9

Q ss_pred             ccccccccccccCCC-ceeeeCCeeecccc
Q psy3653          32 EHFFCAQCGKQFGED-GFHEKDGKPYCRDD   60 (202)
Q Consensus        32 ~Cf~C~~C~~~l~~~-~~~~~~g~~yC~~c   60 (202)
                      .=|+|+.|-..-... .-..++|+++|.+|
T Consensus        69 DEFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   69 DEFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             CceeeeeeeeEechhhhccccCCCEecccc
Confidence            458999996544322 23367899999987


No 49 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=58.12  E-value=6.6  Score=19.68  Aligned_cols=7  Identities=43%  Similarity=1.516  Sum_probs=3.0

Q ss_pred             ccccccc
Q psy3653          36 CAQCGKQ   42 (202)
Q Consensus        36 C~~C~~~   42 (202)
                      |..||+.
T Consensus         5 Cp~Cg~~   11 (26)
T PF13248_consen    5 CPNCGAE   11 (26)
T ss_pred             CcccCCc
Confidence            3444443


No 50 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=54.95  E-value=2.1  Score=28.92  Aligned_cols=53  Identities=19%  Similarity=0.521  Sum_probs=36.7

Q ss_pred             Ccccccccccc-cccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCC
Q psy3653          69 CGGCNRAIMEN-YVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQ  121 (202)
Q Consensus        69 C~~C~~~I~~~-~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~  121 (202)
                      |..|...+.+- .....-..+++.+..|..|...|+..++...+.-|+|+.+|.
T Consensus        38 Cy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C~spFN   91 (105)
T COG4357          38 CYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCGSCPYCQSPFN   91 (105)
T ss_pred             HHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcCCCCCcCCCCC
Confidence            55555555432 223333567888889999999998888877777788877763


No 51 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=54.00  E-value=7.6  Score=23.00  Aligned_cols=26  Identities=27%  Similarity=0.669  Sum_probs=13.0

Q ss_pred             HhhCcCcccchhccccccccccccccccccc
Q psy3653          11 DHFSLRCFQKCVTALEKTWHTEHFFCAQCGK   41 (202)
Q Consensus        11 ~~~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~   41 (202)
                      ..+||+|... +.+..    ..=|.|..|+-
T Consensus        20 ~~fCP~Cg~~-~m~~~----~~r~~C~~Cgy   45 (50)
T PRK00432         20 NKFCPRCGSG-FMAEH----LDRWHCGKCGY   45 (50)
T ss_pred             cCcCcCCCcc-hhecc----CCcEECCCcCC
Confidence            3467777544 33332    23455666643


No 52 
>KOG2462|consensus
Probab=53.76  E-value=4  Score=33.11  Aligned_cols=36  Identities=22%  Similarity=0.515  Sum_probs=15.5

Q ss_pred             CCcccccccccc-cccc-cCceecccCCCCCCCCCCCC
Q psy3653          68 KCGGCNRAIMEN-YVSA-LNTQWHSTCFVCRDCKKPVT  103 (202)
Q Consensus        68 ~C~~C~~~I~~~-~v~~-~~~~~H~~Cf~C~~C~~~l~  103 (202)
                      .|..|++.+.|+ -+.| +-..=+..=|.|.+|++.|.
T Consensus       217 ~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFs  254 (279)
T KOG2462|consen  217 SCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFA  254 (279)
T ss_pred             cCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHH
Confidence            455555555543 1221 11122223455555555544


No 53 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=53.67  E-value=11  Score=21.70  Aligned_cols=11  Identities=64%  Similarity=1.413  Sum_probs=7.2

Q ss_pred             CCCCCCCCccc
Q psy3653         145 LCAGCHKPITG  155 (202)
Q Consensus       145 ~C~~C~~~I~~  155 (202)
                      .|..|+++|.+
T Consensus         2 ~C~~C~~~i~g   12 (46)
T cd02249           2 SCDGCLKPIVG   12 (46)
T ss_pred             CCcCCCCCCcC
Confidence            46777776655


No 54 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=52.84  E-value=5.3  Score=29.57  Aligned_cols=49  Identities=16%  Similarity=0.437  Sum_probs=32.7

Q ss_pred             CccccccccccCCCCCCCCCCCcccce----eeecCcccccccccccccccccCC
Q psy3653         131 LPYCETHYHAKRGSLCAGCHKPITGRC----ITAMFRKFHPEHFVCAFCLRQLNK  181 (202)
Q Consensus       131 ~~~C~~~~~~~~~~~C~~C~~~I~~~~----~~~~~~~~H~~Cf~C~~C~~~l~~  181 (202)
                      .-||.+|-.+ .-..|+.|+.||.|..    +...|..|+.-=+ |..|+++...
T Consensus        28 ~~fC~kCG~~-tI~~Cp~C~~~IrG~y~v~gv~~~g~~~~~PsY-C~~CGkpyPW   80 (158)
T PF10083_consen   28 EKFCSKCGAK-TITSCPNCSTPIRGDYHVEGVFGLGGHYEAPSY-CHNCGKPYPW   80 (158)
T ss_pred             HHHHHHhhHH-HHHHCcCCCCCCCCceecCCeeeeCCCCCCChh-HHhCCCCCch
Confidence            3477777654 3567999999997653    3445666664332 8888888763


No 55 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=52.57  E-value=4.7  Score=26.26  Aligned_cols=13  Identities=38%  Similarity=0.871  Sum_probs=9.6

Q ss_pred             CCCCCCCCCCCcc
Q psy3653         142 RGSLCAGCHKPIT  154 (202)
Q Consensus       142 ~~~~C~~C~~~I~  154 (202)
                      ...+|.+|++.|.
T Consensus         6 ~Ra~Ck~C~~~I~   18 (82)
T PF00645_consen    6 GRAKCKGCKKKIA   18 (82)
T ss_dssp             STEBETTTSCBE-
T ss_pred             CCccCcccCCcCC
Confidence            3457999999993


No 56 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=52.17  E-value=13  Score=21.18  Aligned_cols=12  Identities=50%  Similarity=1.043  Sum_probs=7.7

Q ss_pred             CCCCCCCCCccc
Q psy3653         144 SLCAGCHKPITG  155 (202)
Q Consensus       144 ~~C~~C~~~I~~  155 (202)
                      ..|..|+.+|.+
T Consensus         5 ~~C~~C~~~i~g   16 (44)
T smart00291        5 YSCDTCGKPIVG   16 (44)
T ss_pred             cCCCCCCCCCcC
Confidence            457777776654


No 57 
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=52.05  E-value=5.6  Score=23.29  Aligned_cols=29  Identities=38%  Similarity=0.847  Sum_probs=15.6

Q ss_pred             eecCCCccccccccc--------cCCCCCCCCCCCcc
Q psy3653         126 FDHEGLPYCETHYHA--------KRGSLCAGCHKPIT  154 (202)
Q Consensus       126 ~~~~g~~~C~~~~~~--------~~~~~C~~C~~~I~  154 (202)
                      +...|.+.|.++|.-        ..+++|+.|++|+.
T Consensus        10 f~~k~Li~C~dHYLCl~CLt~ml~~s~~C~iC~~~LP   46 (50)
T PF03854_consen   10 FANKGLIKCSDHYLCLNCLTLMLSRSDRCPICGKPLP   46 (50)
T ss_dssp             S--SSEEE-SS-EEEHHHHHHT-SSSSEETTTTEE--
T ss_pred             hcCCCeeeecchhHHHHHHHHHhccccCCCcccCcCc
Confidence            455666677777732        24678888888874


No 58 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=51.23  E-value=5.2  Score=26.80  Aligned_cols=16  Identities=31%  Similarity=0.914  Sum_probs=13.7

Q ss_pred             ccccCCCCCccccccc
Q psy3653          61 YFDLFAPKCGGCNRAI   76 (202)
Q Consensus        61 ~~~~~~~~C~~C~~~I   76 (202)
                      |..+|...|.+|++.+
T Consensus        49 Y~~lfs~pC~~C~klL   64 (90)
T PF11571_consen   49 YRNLFSTPCKKCGKLL   64 (90)
T ss_pred             HhhhccchhhHHHhHh
Confidence            5677888999999988


No 59 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=50.97  E-value=5.3  Score=21.80  Aligned_cols=39  Identities=23%  Similarity=0.459  Sum_probs=17.7

Q ss_pred             ccccccccCCCceeeeCCeeeccccccccC---CCCCccccc
Q psy3653          36 CAQCGKQFGEDGFHEKDGKPYCRDDYFDLF---APKCGGCNR   74 (202)
Q Consensus        36 C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~---~~~C~~C~~   74 (202)
                      |..|...+........=|..||..|..+.+   ..+|..|+.
T Consensus         2 C~iC~~~~~~~~~~~~C~H~~c~~C~~~~~~~~~~~Cp~C~~   43 (45)
T cd00162           2 CPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRT   43 (45)
T ss_pred             CCcCchhhhCceEecCCCChhcHHHHHHHHHhCcCCCCCCCC
Confidence            455555552222222245556666654332   234555544


No 60 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=50.82  E-value=3.9  Score=22.36  Aligned_cols=10  Identities=30%  Similarity=1.039  Sum_probs=5.2

Q ss_pred             cccccccccc
Q psy3653          34 FFCAQCGKQF   43 (202)
Q Consensus        34 f~C~~C~~~l   43 (202)
                      ++|..|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            5555555544


No 61 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=50.74  E-value=12  Score=18.65  Aligned_cols=9  Identities=44%  Similarity=1.387  Sum_probs=4.3

Q ss_pred             CCCCCCCcc
Q psy3653         146 CAGCHKPIT  154 (202)
Q Consensus       146 C~~C~~~I~  154 (202)
                      |..|+.+|.
T Consensus         1 C~sC~~~i~    9 (24)
T PF07754_consen    1 CTSCGRPIA    9 (24)
T ss_pred             CccCCCccc
Confidence            344555553


No 62 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=50.73  E-value=20  Score=32.97  Aligned_cols=21  Identities=14%  Similarity=0.502  Sum_probs=9.2

Q ss_pred             cccccccccCCCCCCCCCCCc
Q psy3653         133 YCETHYHAKRGSLCAGCHKPI  153 (202)
Q Consensus       133 ~C~~~~~~~~~~~C~~C~~~I  153 (202)
                      ||..|-.......|+.|+..+
T Consensus        17 FC~~CG~~l~~~~Cp~CG~~~   37 (645)
T PRK14559         17 FCQKCGTSLTHKPCPQCGTEV   37 (645)
T ss_pred             cccccCCCCCCCcCCCCCCCC
Confidence            444444333333455555544


No 63 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=49.99  E-value=16  Score=33.69  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=4.6

Q ss_pred             CCCccccccc
Q psy3653          67 PKCGGCNRAI   76 (202)
Q Consensus        67 ~~C~~C~~~I   76 (202)
                      ..|..|+..+
T Consensus        28 ~~Cp~CG~~~   37 (645)
T PRK14559         28 KPCPQCGTEV   37 (645)
T ss_pred             CcCCCCCCCC
Confidence            3455554443


No 64 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=49.65  E-value=6.6  Score=22.22  Aligned_cols=11  Identities=27%  Similarity=0.918  Sum_probs=4.5

Q ss_pred             ccccccccccC
Q psy3653          34 FFCAQCGKQFG   44 (202)
Q Consensus        34 f~C~~C~~~l~   44 (202)
                      +.|..||..|+
T Consensus        20 ~vC~~CG~Vl~   30 (43)
T PF08271_consen   20 LVCPNCGLVLE   30 (43)
T ss_dssp             EEETTT-BBEE
T ss_pred             EECCCCCCEee
Confidence            44444444443


No 65 
>KOG0320|consensus
Probab=49.20  E-value=5  Score=30.45  Aligned_cols=50  Identities=22%  Similarity=0.443  Sum_probs=38.6

Q ss_pred             ccccccccccccccCCCc-eeeeCCeeecccccccc--CCCCCcccccccccc
Q psy3653          30 HTEHFFCAQCGKQFGEDG-FHEKDGKPYCRDDYFDL--FAPKCGGCNRAIMEN   79 (202)
Q Consensus        30 H~~Cf~C~~C~~~l~~~~-~~~~~g~~yC~~c~~~~--~~~~C~~C~~~I~~~   79 (202)
                      -..+++|..|-.+.+... +..+=|.+||+.|.+..  .+.+|..|++.|..+
T Consensus       128 ~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~k  180 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITHK  180 (187)
T ss_pred             cccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccchh
Confidence            346799999977776553 55788999999998775  356899999988643


No 66 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=49.18  E-value=17  Score=21.04  Aligned_cols=42  Identities=21%  Similarity=0.314  Sum_probs=27.2

Q ss_pred             cccccccccCCCceeeeCCee-ecccccccc--CCCCCcccccccc
Q psy3653          35 FCAQCGKQFGEDGFHEKDGKP-YCRDDYFDL--FAPKCGGCNRAIM   77 (202)
Q Consensus        35 ~C~~C~~~l~~~~~~~~~g~~-yC~~c~~~~--~~~~C~~C~~~I~   77 (202)
                      .|..|.....+ ..+..=|.. +|..|..+.  ...+|..|+++|.
T Consensus         4 ~C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPRD-VVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCCc-eEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            45666665443 334455666 899998776  4568999988874


No 67 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=47.77  E-value=4.4  Score=25.85  Aligned_cols=24  Identities=21%  Similarity=0.420  Sum_probs=8.0

Q ss_pred             Ceeecccccccc-CCCCCccccccc
Q psy3653          53 GKPYCRDDYFDL-FAPKCGGCNRAI   76 (202)
Q Consensus        53 g~~yC~~c~~~~-~~~~C~~C~~~I   76 (202)
                      +..+|..|-... ..+.|..|++++
T Consensus        16 ~~~~C~~C~~~~~~~a~CPdC~~~L   40 (70)
T PF07191_consen   16 GHYHCEACQKDYKKEAFCPDCGQPL   40 (70)
T ss_dssp             TEEEETTT--EEEEEEE-TTT-SB-
T ss_pred             CEEECccccccceecccCCCcccHH
Confidence            444444443221 113455555555


No 68 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=47.64  E-value=13  Score=22.39  Aligned_cols=29  Identities=10%  Similarity=0.032  Sum_probs=13.7

Q ss_pred             eeecCCCcccccccccc--CCCCCCCCCCCc
Q psy3653         125 FFDHEGLPYCETHYHAK--RGSLCAGCHKPI  153 (202)
Q Consensus       125 ~~~~~g~~~C~~~~~~~--~~~~C~~C~~~I  153 (202)
                      +....|..|+..+..+.  ....|+.|++++
T Consensus        15 v~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~   45 (63)
T smart00504       15 VILPSGQTYERRAIEKWLLSHGTDPVTGQPL   45 (63)
T ss_pred             EECCCCCEEeHHHHHHHHHHCCCCCCCcCCC
Confidence            44455555555543321  123455555555


No 69 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=47.37  E-value=9.8  Score=19.98  Aligned_cols=10  Identities=10%  Similarity=0.032  Sum_probs=1.8

Q ss_pred             CcCcccchhc
Q psy3653          14 SLRCFQKCVT   23 (202)
Q Consensus        14 ~~~C~~~~~~   23 (202)
                      ||.|..++..
T Consensus         5 Cp~C~se~~y   14 (30)
T PF08274_consen    5 CPLCGSEYTY   14 (30)
T ss_dssp             -TTT-----E
T ss_pred             CCCCCCccee
Confidence            4445443333


No 70 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=46.77  E-value=5.9  Score=26.75  Aligned_cols=30  Identities=23%  Similarity=0.233  Sum_probs=20.4

Q ss_pred             CCCCCCCCCc-ccceeeec-Cccccccccccc
Q psy3653         144 SLCAGCHKPI-TGRCITAM-FRKFHPEHFVCA  173 (202)
Q Consensus       144 ~~C~~C~~~I-~~~~~~~~-~~~~H~~Cf~C~  173 (202)
                      -+|..|+++| +|+..+.- ...-|-+||.=+
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s   38 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAES   38 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHHH
Confidence            4699999998 67765543 345687887433


No 71 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=44.53  E-value=13  Score=22.45  Aligned_cols=24  Identities=25%  Similarity=0.635  Sum_probs=15.8

Q ss_pred             CCCCCCCCCcc-cceeeecCccccc
Q psy3653         144 SLCAGCHKPIT-GRCITAMFRKFHP  167 (202)
Q Consensus       144 ~~C~~C~~~I~-~~~~~~~~~~~H~  167 (202)
                      .+|..|+.||. ...+...+..-|+
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~   26 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHP   26 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCc
Confidence            46888999994 4555555556665


No 72 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=42.00  E-value=12  Score=22.99  Aligned_cols=11  Identities=27%  Similarity=1.087  Sum_probs=6.5

Q ss_pred             cccccccccCC
Q psy3653          35 FCAQCGKQFGE   45 (202)
Q Consensus        35 ~C~~C~~~l~~   45 (202)
                      +|.+||..|..
T Consensus        11 ~CtSCg~~i~p   21 (61)
T COG2888          11 VCTSCGREIAP   21 (61)
T ss_pred             eeccCCCEecc
Confidence            45666666643


No 73 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=41.65  E-value=11  Score=28.63  Aligned_cols=27  Identities=33%  Similarity=0.699  Sum_probs=14.9

Q ss_pred             hCcCcccch--hcccccccccccccccccccccC
Q psy3653          13 FSLRCFQKC--VTALEKTWHTEHFFCAQCGKQFG   44 (202)
Q Consensus        13 ~~~~C~~~~--~~~~~~~~H~~Cf~C~~C~~~l~   44 (202)
                      .||+|..++  ..|++.     =|.|..||.+|.
T Consensus       119 ~Cp~C~~rytf~eA~~~-----~F~Cp~Cg~~L~  147 (178)
T PRK06266        119 FCPNCHIRFTFDEAMEY-----GFRCPQCGEMLE  147 (178)
T ss_pred             ECCCCCcEEeHHHHhhc-----CCcCCCCCCCCe
Confidence            467764433  334432     377777777664


No 74 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=41.27  E-value=11  Score=20.61  Aligned_cols=8  Identities=13%  Similarity=0.102  Sum_probs=4.2

Q ss_pred             hhCcCccc
Q psy3653          12 HFSLRCFQ   19 (202)
Q Consensus        12 ~~~~~C~~   19 (202)
                      +.||+|..
T Consensus         3 i~Cp~C~~   10 (36)
T PF13717_consen    3 ITCPNCQA   10 (36)
T ss_pred             EECCCCCC
Confidence            34666643


No 75 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=40.34  E-value=27  Score=19.61  Aligned_cols=29  Identities=28%  Similarity=0.581  Sum_probs=15.4

Q ss_pred             cccccccccCCCc-eE-eeCCcccChhhHhh
Q psy3653         171 VCAFCLRQLNKGT-FK-EQNDKPYCHGCFEK  199 (202)
Q Consensus       171 ~C~~C~~~l~~~~-~~-~~~~~~yC~~c~~~  199 (202)
                      +|+.|+++.+... .+ ..++...|..|...
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            5777777776444 33 23367778877654


No 76 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=40.22  E-value=5.8  Score=30.65  Aligned_cols=45  Identities=22%  Similarity=0.617  Sum_probs=34.1

Q ss_pred             ccccccccccCCCceeeeCCeeeccccccccC--CCCCcccccccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLF--APKCGGCNRAIMEN   79 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~--~~~C~~C~~~I~~~   79 (202)
                      |.|..|++...+. .+..=|..+|..|+.+.+  ++.|..|++...+.
T Consensus       197 F~C~iCKkdy~sp-vvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~  243 (259)
T COG5152         197 FLCGICKKDYESP-VVTECGHSFCSLCAIRKYQKGDECGVCGKATYGR  243 (259)
T ss_pred             eeehhchhhccch-hhhhcchhHHHHHHHHHhccCCcceecchhhccc
Confidence            7888888877553 445667888999987765  57899999877654


No 77 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=39.62  E-value=18  Score=22.15  Aligned_cols=27  Identities=30%  Similarity=0.899  Sum_probs=17.3

Q ss_pred             cccccccccCCCc--eEeeCCcccC-hhhH
Q psy3653         171 VCAFCLRQLNKGT--FKEQNDKPYC-HGCF  197 (202)
Q Consensus       171 ~C~~C~~~l~~~~--~~~~~~~~yC-~~c~  197 (202)
                      .|..|++.|..++  |+-...+.+| .+|-
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS~ECR   47 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCSEECR   47 (58)
T ss_pred             HHHccCCCCCCCCCeeeeccccccccHHHH
Confidence            4677778887443  5556667788 3554


No 78 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=39.46  E-value=24  Score=20.00  Aligned_cols=11  Identities=55%  Similarity=1.525  Sum_probs=8.0

Q ss_pred             CCCCCCCCccc
Q psy3653         145 LCAGCHKPITG  155 (202)
Q Consensus       145 ~C~~C~~~I~~  155 (202)
                      .|.+|+++|.|
T Consensus         2 ~Cd~C~~~i~G   12 (43)
T cd02340           2 ICDGCQGPIVG   12 (43)
T ss_pred             CCCCCCCcCcC
Confidence            47788887765


No 79 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=39.15  E-value=13  Score=21.40  Aligned_cols=14  Identities=36%  Similarity=1.198  Sum_probs=7.7

Q ss_pred             ccccccccccccccc
Q psy3653          28 TWHTEHFFCAQCGKQ   42 (202)
Q Consensus        28 ~~H~~Cf~C~~C~~~   42 (202)
                      .|-.+ |.|..|+..
T Consensus        14 RW~~g-~~CP~Cg~~   27 (46)
T PF12760_consen   14 RWPDG-FVCPHCGST   27 (46)
T ss_pred             cCCCC-CCCCCCCCe
Confidence            34444 666667653


No 80 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=38.91  E-value=11  Score=20.41  Aligned_cols=7  Identities=29%  Similarity=0.581  Sum_probs=4.2

Q ss_pred             hCcCccc
Q psy3653          13 FSLRCFQ   19 (202)
Q Consensus        13 ~~~~C~~   19 (202)
                      |||+|..
T Consensus         3 FCp~C~n    9 (35)
T PF02150_consen    3 FCPECGN    9 (35)
T ss_dssp             BETTTTS
T ss_pred             eCCCCCc
Confidence            5666653


No 81 
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=38.56  E-value=22  Score=22.31  Aligned_cols=21  Identities=33%  Similarity=0.868  Sum_probs=13.3

Q ss_pred             cccccccccCCCc---eEeeCCcc
Q psy3653         171 VCAFCLRQLNKGT---FKEQNDKP  191 (202)
Q Consensus       171 ~C~~C~~~l~~~~---~~~~~~~~  191 (202)
                      +|+.|+..|.+|.   |+..||.+
T Consensus         5 ~CsFcG~~I~PGtG~m~Vr~Dg~v   28 (66)
T COG2075           5 VCSFCGKKIEPGTGIMYVRNDGKV   28 (66)
T ss_pred             EecCcCCccCCCceEEEEecCCeE
Confidence            4677777776555   55556654


No 82 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=37.44  E-value=24  Score=32.73  Aligned_cols=84  Identities=21%  Similarity=0.498  Sum_probs=60.1

Q ss_pred             HHhhCcCcccchhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccccccCceec
Q psy3653          10 DDHFSLRCFQKCVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVSALNTQWH   89 (202)
Q Consensus        10 ~~~~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~~~H   89 (202)
                      +-..|+.|..+...-.++.||=-=-.|..||-+     |...+.-||=+.-....--+.|..|.+.    +-...|+.||
T Consensus       100 D~a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPR-----fTIi~alPYDR~nTsM~~F~lC~~C~~E----Y~dP~nRRfH  170 (750)
T COG0068         100 DAATCEDCLEEIFDPNSRRYLYPFINCTNCGPR-----FTIIEALPYDRENTSMADFPLCPFCDKE----YKDPLNRRFH  170 (750)
T ss_pred             chhhhHHHHHHhcCCCCcceeccccccCCCCcc-----eeeeccCCCCcccCccccCcCCHHHHHH----hcCccccccc
Confidence            445788898889999999999988899999654     4455555553333333333678888763    3345688999


Q ss_pred             ccCCCCCCCCCCC
Q psy3653          90 STCFVCRDCKKPV  102 (202)
Q Consensus        90 ~~Cf~C~~C~~~l  102 (202)
                      ..=..|..|+-.+
T Consensus       171 AQp~aCp~CGP~~  183 (750)
T COG0068         171 AQPIACPKCGPHL  183 (750)
T ss_pred             cccccCcccCCCe
Confidence            9999999998765


No 83 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=37.36  E-value=21  Score=20.50  Aligned_cols=11  Identities=27%  Similarity=1.162  Sum_probs=7.6

Q ss_pred             ccccccccccC
Q psy3653          34 FFCAQCGKQFG   44 (202)
Q Consensus        34 f~C~~C~~~l~   44 (202)
                      ++|..||..++
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            56788877654


No 84 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=37.28  E-value=12  Score=20.58  Aligned_cols=9  Identities=22%  Similarity=0.785  Sum_probs=5.0

Q ss_pred             CCCCCCCCc
Q psy3653         145 LCAGCHKPI  153 (202)
Q Consensus       145 ~C~~C~~~I  153 (202)
                      +|..|++..
T Consensus         7 ~C~~Cg~~f   15 (41)
T smart00834        7 RCEDCGHTF   15 (41)
T ss_pred             EcCCCCCEE
Confidence            455665544


No 85 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=36.61  E-value=12  Score=21.14  Aligned_cols=11  Identities=18%  Similarity=0.697  Sum_probs=5.1

Q ss_pred             ccccccccccC
Q psy3653         170 FVCAFCLRQLN  180 (202)
Q Consensus       170 f~C~~C~~~l~  180 (202)
                      |+|..|+..+.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            34555554443


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=35.38  E-value=14  Score=27.43  Aligned_cols=27  Identities=22%  Similarity=0.498  Sum_probs=16.5

Q ss_pred             hCcCcccch--hcccccccccccccccccccccC
Q psy3653          13 FSLRCFQKC--VTALEKTWHTEHFFCAQCGKQFG   44 (202)
Q Consensus        13 ~~~~C~~~~--~~~~~~~~H~~Cf~C~~C~~~l~   44 (202)
                      +||+|..++  ..|++.     =|+|..||.+|.
T Consensus       111 ~Cp~c~~r~tf~eA~~~-----~F~Cp~Cg~~L~  139 (158)
T TIGR00373       111 ICPNMCVRFTFNEAMEL-----NFTCPRCGAMLD  139 (158)
T ss_pred             ECCCCCcEeeHHHHHHc-----CCcCCCCCCEee
Confidence            477775433  344442     378888887774


No 87 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=34.12  E-value=25  Score=20.20  Aligned_cols=12  Identities=50%  Similarity=1.176  Sum_probs=5.9

Q ss_pred             CCCCCCCC-Cccc
Q psy3653         144 SLCAGCHK-PITG  155 (202)
Q Consensus       144 ~~C~~C~~-~I~~  155 (202)
                      ..|.+|+. +|.+
T Consensus         5 ~~C~~C~~~~i~g   17 (46)
T PF00569_consen    5 YTCDGCGTDPIIG   17 (46)
T ss_dssp             CE-SSS-SSSEES
T ss_pred             eECcCCCCCcCcC
Confidence            45777766 5554


No 88 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=34.11  E-value=36  Score=19.64  Aligned_cols=29  Identities=14%  Similarity=0.537  Sum_probs=14.9

Q ss_pred             cccccccccCCCceEe--eCCcccChhhHhh
Q psy3653         171 VCAFCLRQLNKGTFKE--QNDKPYCHGCFEK  199 (202)
Q Consensus       171 ~C~~C~~~l~~~~~~~--~~~~~yC~~c~~~  199 (202)
                      .|..|+..+..-++.-  ..+.-+|.+||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            3555555554322221  1235678888854


No 89 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=33.89  E-value=39  Score=19.75  Aligned_cols=11  Identities=45%  Similarity=1.084  Sum_probs=7.3

Q ss_pred             CCCCCCC-Cccc
Q psy3653         145 LCAGCHK-PITG  155 (202)
Q Consensus       145 ~C~~C~~-~I~~  155 (202)
                      +|.+|+. ||.|
T Consensus         2 ~Cd~C~~~pI~G   13 (48)
T cd02341           2 KCDSCGIEPIPG   13 (48)
T ss_pred             CCCCCCCCcccc
Confidence            4777776 6664


No 90 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=33.74  E-value=14  Score=20.73  Aligned_cols=26  Identities=19%  Similarity=0.353  Sum_probs=15.4

Q ss_pred             CCCCCCCCcc-cceeee--cCcccccccc
Q psy3653         145 LCAGCHKPIT-GRCITA--MFRKFHPEHF  170 (202)
Q Consensus       145 ~C~~C~~~I~-~~~~~~--~~~~~H~~Cf  170 (202)
                      .|+.|.+.+. ++.+..  -+..||.+|+
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci   30 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCI   30 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHH
Confidence            4777777773 333222  3667777775


No 91 
>KOG1813|consensus
Probab=32.70  E-value=27  Score=28.78  Aligned_cols=44  Identities=25%  Similarity=0.457  Sum_probs=30.1

Q ss_pred             ccccccccccCCCceeeeCCeeeccccccccC--CCCCccccccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLF--APKCGGCNRAIME   78 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~--~~~C~~C~~~I~~   78 (202)
                      |.|..|+++..+. ....=|..+|+.|..+.+  ++.|..|++.+.+
T Consensus       242 f~c~icr~~f~~p-Vvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  242 FKCFICRKYFYRP-VVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             ccccccccccccc-hhhcCCceeehhhhccccccCCcceeccccccc
Confidence            6677777776543 445666778888877765  3578888887754


No 92 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=32.61  E-value=16  Score=21.36  Aligned_cols=10  Identities=20%  Similarity=0.644  Sum_probs=6.0

Q ss_pred             CCCCCCCCCc
Q psy3653         144 SLCAGCHKPI  153 (202)
Q Consensus       144 ~~C~~C~~~I  153 (202)
                      -+|..|+...
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            3577776644


No 93 
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=32.26  E-value=9.9  Score=23.12  Aligned_cols=16  Identities=25%  Similarity=1.036  Sum_probs=11.7

Q ss_pred             ccccccccccCCCcee
Q psy3653          34 FFCAQCGKQFGEDGFH   49 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~   49 (202)
                      +.|++||+.|++..|.
T Consensus         5 lvCSTCGrDlSeeRy~   20 (63)
T PF05864_consen    5 LVCSTCGRDLSEERYR   20 (63)
T ss_pred             eeecccCCcchHHHHH
Confidence            5688888888776553


No 94 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=31.75  E-value=22  Score=19.29  Aligned_cols=12  Identities=42%  Similarity=1.038  Sum_probs=5.2

Q ss_pred             cccccccccCCC
Q psy3653          35 FCAQCGKQFGED   46 (202)
Q Consensus        35 ~C~~C~~~l~~~   46 (202)
                      .|.+|++++..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            466777777654


No 95 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=31.58  E-value=20  Score=18.75  Aligned_cols=26  Identities=27%  Similarity=0.528  Sum_probs=10.6

Q ss_pred             hhCcCcccchhccccccccccccccccccc
Q psy3653          12 HFSLRCFQKCVTALEKTWHTEHFFCAQCGK   41 (202)
Q Consensus        12 ~~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~   41 (202)
                      -+|++|.++...+.+ -|-..|   ..|+.
T Consensus         4 rfC~~CG~~t~~~~~-g~~r~C---~~Cg~   29 (32)
T PF09297_consen    4 RFCGRCGAPTKPAPG-GWARRC---PSCGH   29 (32)
T ss_dssp             SB-TTT--BEEE-SS-SS-EEE---SSSS-
T ss_pred             cccCcCCccccCCCC-cCEeEC---CCCcC
Confidence            478888765555433 344444   55543


No 96 
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=31.53  E-value=10  Score=23.09  Aligned_cols=15  Identities=27%  Similarity=1.092  Sum_probs=11.3

Q ss_pred             ccccccccccCCCce
Q psy3653          34 FFCAQCGKQFGEDGF   48 (202)
Q Consensus        34 f~C~~C~~~l~~~~~   48 (202)
                      +.|++||+.|++..|
T Consensus         5 lVCsTCGrDlSeeRy   19 (63)
T PHA03082          5 LVCSTCGRDLSEERY   19 (63)
T ss_pred             eeecccCcchhHHHH
Confidence            568888888877654


No 97 
>KOG0978|consensus
Probab=31.39  E-value=6.4  Score=36.25  Aligned_cols=45  Identities=24%  Similarity=0.574  Sum_probs=31.6

Q ss_pred             ccccccccccCCCceeeeCCeeeccccccccCC---CCCcccccccccc
Q psy3653          34 FFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFA---PKCGGCNRAIMEN   79 (202)
Q Consensus        34 f~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~---~~C~~C~~~I~~~   79 (202)
                      ++|+.|+.+.-+ ..+.+=+..||..|...++.   .+|+.|+.++...
T Consensus       644 LkCs~Cn~R~Kd-~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFgan  691 (698)
T KOG0978|consen  644 LKCSVCNTRWKD-AVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGAN  691 (698)
T ss_pred             eeCCCccCchhh-HHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCcc
Confidence            688888866543 24456677888888877654   4788888877643


No 98 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=31.34  E-value=21  Score=16.64  Aligned_cols=12  Identities=42%  Similarity=1.132  Sum_probs=7.3

Q ss_pred             ccccccccccCC
Q psy3653          34 FFCAQCGKQFGE   45 (202)
Q Consensus        34 f~C~~C~~~l~~   45 (202)
                      |+|..|++.+..
T Consensus         1 y~C~~C~~~f~~   12 (23)
T PF00096_consen    1 YKCPICGKSFSS   12 (23)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCccCC
Confidence            456777666543


No 99 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=30.98  E-value=30  Score=28.30  Aligned_cols=28  Identities=21%  Similarity=0.377  Sum_probs=19.7

Q ss_pred             CCCCCCCCCCCcccceeeecCccccccc
Q psy3653         142 RGSLCAGCHKPITGRCITAMFRKFHPEH  169 (202)
Q Consensus       142 ~~~~C~~C~~~I~~~~~~~~~~~~H~~C  169 (202)
                      .+..|.+|+.+|.-..+.-.+..|.|.|
T Consensus       244 ~GepC~~CGt~I~k~~~~gR~t~~CP~C  271 (273)
T COG0266         244 AGEPCRRCGTPIEKIKLGGRSTFYCPVC  271 (273)
T ss_pred             CCCCCCccCCEeEEEEEcCCcCEeCCCC
Confidence            4667999999997655555555666655


No 100
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=30.75  E-value=44  Score=19.42  Aligned_cols=10  Identities=50%  Similarity=0.853  Sum_probs=6.1

Q ss_pred             CCCCCCCCcc
Q psy3653         145 LCAGCHKPIT  154 (202)
Q Consensus       145 ~C~~C~~~I~  154 (202)
                      .|.+|.+.|.
T Consensus         2 ~Cd~C~~~~~   11 (49)
T cd02335           2 HCDYCSKDIT   11 (49)
T ss_pred             CCCCcCCCCC
Confidence            4666766654


No 101
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=30.49  E-value=1.3e+02  Score=20.28  Aligned_cols=11  Identities=36%  Similarity=0.872  Sum_probs=7.8

Q ss_pred             CCCCCCCCCCC
Q psy3653          92 CFVCRDCKKPV  102 (202)
Q Consensus        92 Cf~C~~C~~~l  102 (202)
                      -|.|..|+...
T Consensus         4 ~F~C~~CG~~V   14 (92)
T PF12647_consen    4 SFTCVHCGLTV   14 (92)
T ss_pred             ccCccccCCCc
Confidence            47777777765


No 102
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=29.99  E-value=25  Score=20.80  Aligned_cols=28  Identities=29%  Similarity=0.653  Sum_probs=15.0

Q ss_pred             hHHhhCcCcccchhcccccccccccccccccc
Q psy3653           9 FDDHFSLRCFQKCVTALEKTWHTEHFFCAQCG   40 (202)
Q Consensus         9 ~~~~~~~~C~~~~~~~~~~~~H~~Cf~C~~C~   40 (202)
                      .-+-+||||..-++.|.    |.+=+-|..||
T Consensus        17 rk~~~CPrCG~gvfmA~----H~dR~~CGkCg   44 (51)
T COG1998          17 RKNRFCPRCGPGVFMAD----HKDRWACGKCG   44 (51)
T ss_pred             EccccCCCCCCcchhhh----cCceeEecccc
Confidence            34567888865455443    33334455554


No 103
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=29.73  E-value=47  Score=19.25  Aligned_cols=11  Identities=27%  Similarity=0.966  Sum_probs=6.2

Q ss_pred             ccccccccccC
Q psy3653         170 FVCAFCLRQLN  180 (202)
Q Consensus       170 f~C~~C~~~l~  180 (202)
                      |-|..|.+.|.
T Consensus        19 fIC~~CE~~iv   29 (46)
T PF10764_consen   19 FICSDCEKEIV   29 (46)
T ss_pred             EehHHHHHHhc
Confidence            55666655554


No 104
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=29.35  E-value=70  Score=31.89  Aligned_cols=9  Identities=22%  Similarity=0.759  Sum_probs=4.9

Q ss_pred             CCCCCCCCc
Q psy3653         145 LCAGCHKPI  153 (202)
Q Consensus       145 ~C~~C~~~I  153 (202)
                      .|+.|+.++
T Consensus       711 ~CP~CGtpl  719 (1337)
T PRK14714        711 ECPRCDVEL  719 (1337)
T ss_pred             cCCCCCCcc
Confidence            455555554


No 105
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=28.78  E-value=26  Score=20.93  Aligned_cols=8  Identities=50%  Similarity=1.277  Sum_probs=4.1

Q ss_pred             CCCCCCCc
Q psy3653         146 CAGCHKPI  153 (202)
Q Consensus       146 C~~C~~~I  153 (202)
                      |+-|+++|
T Consensus         3 CPyCge~~   10 (52)
T PF14255_consen    3 CPYCGEPI   10 (52)
T ss_pred             CCCCCCee
Confidence            45555554


No 106
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=28.58  E-value=44  Score=25.81  Aligned_cols=9  Identities=22%  Similarity=0.914  Sum_probs=4.0

Q ss_pred             ccccccccC
Q psy3653         172 CAFCLRQLN  180 (202)
Q Consensus       172 C~~C~~~l~  180 (202)
                      |..|...+.
T Consensus        71 CPvCR~~Is   79 (193)
T PLN03208         71 CPVCKSDVS   79 (193)
T ss_pred             CCCCCCcCC
Confidence            444444444


No 107
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=28.41  E-value=23  Score=20.95  Aligned_cols=11  Identities=36%  Similarity=0.718  Sum_probs=8.3

Q ss_pred             CCCCCCCCCCc
Q psy3653         143 GSLCAGCHKPI  153 (202)
Q Consensus       143 ~~~C~~C~~~I  153 (202)
                      +.+|+.|+-.|
T Consensus        24 ~irCp~Cg~rI   34 (49)
T COG1996          24 GIRCPYCGSRI   34 (49)
T ss_pred             ceeCCCCCcEE
Confidence            45788888777


No 108
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=26.94  E-value=52  Score=19.36  Aligned_cols=26  Identities=12%  Similarity=0.207  Sum_probs=18.8

Q ss_pred             CCCCCCCCCcc---cceeeecCccccccc
Q psy3653         144 SLCAGCHKPIT---GRCITAMFRKFHPEH  169 (202)
Q Consensus       144 ~~C~~C~~~I~---~~~~~~~~~~~H~~C  169 (202)
                      ..|+.|+....   +..+.+.+..|++.|
T Consensus        14 ~~Cp~CGN~~vGngEG~liV~edtfkRtC   42 (49)
T PF12677_consen   14 CKCPKCGNDKVGNGEGTLIVEEDTFKRTC   42 (49)
T ss_pred             ccCcccCCcEeecCcceEEEeccceeeee
Confidence            46999988762   344677788888876


No 109
>PF04945 YHS:  YHS domain;  InterPro: IPR007029 This short presumed domain is about 50 amino acid residues long. It often contains two cysteines that may be functionally important. This domain is found in copper transporting ATPases, some phenol hydroxylases and in a set of uncharacterised membrane proteins including Q9CNI0 from SWISSPROT. This domain is named after three of the most conserved amino acids it contains. The domain may be metal binding, possibly copper ions. This domain is duplicated in some copper transporting ATPases.; PDB: 3U52_B 2INN_A 2INP_B 1T0Q_A 2RDB_A 1T0R_A 2IND_A 1T0S_A 2INC_A 3DHI_A ....
Probab=26.83  E-value=12  Score=21.49  Aligned_cols=31  Identities=13%  Similarity=0.268  Sum_probs=19.1

Q ss_pred             CCCCCCc---ccceeeecCcccccccccccccccccC
Q psy3653         147 AGCHKPI---TGRCITAMFRKFHPEHFVCAFCLRQLN  180 (202)
Q Consensus       147 ~~C~~~I---~~~~~~~~~~~~H~~Cf~C~~C~~~l~  180 (202)
                      ++|+..|   ....+...|+.|+   |.+..|...+.
T Consensus         4 Pvcg~~v~~~~~~~~~y~G~~Y~---FCS~~C~~~F~   37 (47)
T PF04945_consen    4 PVCGMKVPGNAAYSVEYNGRTYY---FCSEGCKEKFE   37 (47)
T ss_dssp             -GGG-BE-----EEEEETTEEEE---ESSHHHHHHHH
T ss_pred             CCCCCEEccCccEEEEECCEEEE---EcCHHHHHHHH
Confidence            5677777   3445677888887   77777776654


No 110
>PHA00626 hypothetical protein
Probab=26.70  E-value=33  Score=20.83  Aligned_cols=38  Identities=18%  Similarity=0.408  Sum_probs=18.9

Q ss_pred             hCcCccc-chhcccccccccccccccccccccCCCceee
Q psy3653          13 FSLRCFQ-KCVTALEKTWHTEHFFCAQCGKQFGEDGFHE   50 (202)
Q Consensus        13 ~~~~C~~-~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~   50 (202)
                      .||+|.. .++.-.--.=+..=++|..||-..+.+.|-+
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~~~~~~   40 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFGE   40 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCeechhhhhh
Confidence            4788854 3433111112244467777776665444433


No 111
>PRK00807 50S ribosomal protein L24e; Validated
Probab=26.57  E-value=50  Score=19.63  Aligned_cols=20  Identities=25%  Similarity=0.820  Sum_probs=8.8

Q ss_pred             ccccccccCCCc---eEeeCCcc
Q psy3653         172 CAFCLRQLNKGT---FKEQNDKP  191 (202)
Q Consensus       172 C~~C~~~l~~~~---~~~~~~~~  191 (202)
                      |+.|+..+.++.   |+..||++
T Consensus         4 C~fcG~~I~pg~G~~~vr~Dgkv   26 (52)
T PRK00807          4 CSFCGKEIEPGTGKMYVKKDGTI   26 (52)
T ss_pred             cCCCCCeEcCCCCeEEEEeCCcE
Confidence            444555544222   34445544


No 112
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=26.37  E-value=43  Score=18.13  Aligned_cols=12  Identities=33%  Similarity=0.971  Sum_probs=5.6

Q ss_pred             CCcccChhhHhh
Q psy3653         188 NDKPYCHGCFEK  199 (202)
Q Consensus       188 ~~~~yC~~c~~~  199 (202)
                      =|..||.+|..+
T Consensus        17 CGH~fC~~C~~~   28 (39)
T PF13923_consen   17 CGHSFCKECIEK   28 (39)
T ss_dssp             TSEEEEHHHHHH
T ss_pred             CCCchhHHHHHH
Confidence            344455555443


No 113
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=26.27  E-value=34  Score=31.78  Aligned_cols=82  Identities=24%  Similarity=0.486  Sum_probs=51.2

Q ss_pred             CCcccccccccccccccCceecccCCCCCCCCCCCCCCceeecCCcccCCCCCCCCceeecCCCccccccccccCCCCCC
Q psy3653          68 KCGGCNRAIMENYVSALNTQWHSTCFVCRDCKKPVTGKSFYAMEGKPDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCA  147 (202)
Q Consensus        68 ~C~~C~~~I~~~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~~~g~~~C~~~~~~~~~~~C~  147 (202)
                      .|..|-+.|.+.    .++.|+-.=-.|+.|+-.++.                       -+..||=........-+.|+
T Consensus       103 ~C~~Cl~Ei~dp----~~rrY~YPF~~CT~CGPRfTI-----------------------i~alPYDR~nTsM~~F~lC~  155 (750)
T COG0068         103 TCEDCLEEIFDP----NSRRYLYPFINCTNCGPRFTI-----------------------IEALPYDRENTSMADFPLCP  155 (750)
T ss_pred             hhHHHHHHhcCC----CCcceeccccccCCCCcceee-----------------------eccCCCCcccCccccCcCCH
Confidence            577777766543    456677666679999876543                       23334433333333345677


Q ss_pred             CCCCCcccceeeecCcccccccccccccccccC
Q psy3653         148 GCHKPITGRCITAMFRKFHPEHFVCAFCLRQLN  180 (202)
Q Consensus       148 ~C~~~I~~~~~~~~~~~~H~~Cf~C~~C~~~l~  180 (202)
                      .|.+    ++-...++.||-.=..|..|+-.+.
T Consensus       156 ~C~~----EY~dP~nRRfHAQp~aCp~CGP~~~  184 (750)
T COG0068         156 FCDK----EYKDPLNRRFHAQPIACPKCGPHLF  184 (750)
T ss_pred             HHHH----HhcCccccccccccccCcccCCCeE
Confidence            7744    4446678888888888888887653


No 114
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=26.20  E-value=42  Score=31.40  Aligned_cols=84  Identities=19%  Similarity=0.489  Sum_probs=55.5

Q ss_pred             HHhhCcCcccchhcccccccccccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccccccccccCceec
Q psy3653          10 DDHFSLRCFQKCVTALEKTWHTEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIMENYVSALNTQWH   89 (202)
Q Consensus        10 ~~~~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~~~~v~~~~~~~H   89 (202)
                      +-..|+-|..+...-.++.|+=-=-.|..||=+     |.....-||=..-.....-+.|..|.+...+    ..++.||
T Consensus        67 D~a~C~~Cl~E~~dp~~Rry~YpF~nCt~CGPr-----~~i~~~lpydr~~t~m~~f~~C~~C~~ey~~----p~~rr~h  137 (711)
T TIGR00143        67 DVATCSDCLEEMLDKNDRRYLYPFISCTHCGPR-----FTIIEALPYDRENTSMADFPLCPDCAKEYKD----PLDRRFH  137 (711)
T ss_pred             chhhHHHHHHHhcCCCcccccCCcccccCCCCC-----eEEeecCCCCCCCcCCCCCcCCHHHHHHhcC----CccccCC
Confidence            556788898888888899999988899999754     3333333332211111122467777665432    3567788


Q ss_pred             ccCCCCCCCCCCC
Q psy3653          90 STCFVCRDCKKPV  102 (202)
Q Consensus        90 ~~Cf~C~~C~~~l  102 (202)
                      ..=..|..|+-+|
T Consensus       138 ~~~~~C~~Cgp~l  150 (711)
T TIGR00143       138 AQPIACPRCGPQL  150 (711)
T ss_pred             CCCccCCCCCcEE
Confidence            8878888888776


No 115
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=26.10  E-value=32  Score=18.54  Aligned_cols=9  Identities=44%  Similarity=1.202  Sum_probs=3.0

Q ss_pred             ccccccccC
Q psy3653          36 CAQCGKQFG   44 (202)
Q Consensus        36 C~~C~~~l~   44 (202)
                      |..||.+|+
T Consensus         3 C~~CG~~l~   11 (34)
T PF14803_consen    3 CPQCGGPLE   11 (34)
T ss_dssp             -TTT--B-E
T ss_pred             cccccChhh
Confidence            566666663


No 116
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=26.02  E-value=23  Score=25.92  Aligned_cols=11  Identities=36%  Similarity=1.219  Sum_probs=6.9

Q ss_pred             ccccccccccC
Q psy3653          34 FFCAQCGKQFG   44 (202)
Q Consensus        34 f~C~~C~~~l~   44 (202)
                      |.|..||..|.
T Consensus       124 f~Cp~Cg~~l~  134 (147)
T smart00531      124 FTCPRCGEELE  134 (147)
T ss_pred             EECCCCCCEEE
Confidence            66666666653


No 117
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=25.35  E-value=19  Score=19.31  Aligned_cols=16  Identities=25%  Similarity=0.551  Sum_probs=9.9

Q ss_pred             ccccccccccCCCceE
Q psy3653         170 FVCAFCLRQLNKGTFK  185 (202)
Q Consensus       170 f~C~~C~~~l~~~~~~  185 (202)
                      |.|..|++++..++|.
T Consensus         5 ~~C~nC~R~v~a~RfA   20 (33)
T PF08209_consen    5 VECPNCGRPVAASRFA   20 (33)
T ss_dssp             EE-TTTSSEEEGGGHH
T ss_pred             EECCCCcCCcchhhhH
Confidence            4577777777766654


No 118
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=25.01  E-value=42  Score=23.34  Aligned_cols=29  Identities=14%  Similarity=0.347  Sum_probs=19.0

Q ss_pred             hCcCcccchhcccccccccccccccccccccCCC
Q psy3653          13 FSLRCFQKCVTALEKTWHTEHFFCAQCGKQFGED   46 (202)
Q Consensus        13 ~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   46 (202)
                      .||+|..++.-.++..     |.|.+|+..++..
T Consensus         4 ~CP~C~seytY~dg~~-----~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHDGTQ-----LICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEecCCe-----eECcccccccccc
Confidence            4777777666655554     6777777766543


No 119
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=25.00  E-value=26  Score=20.93  Aligned_cols=13  Identities=23%  Similarity=0.733  Sum_probs=8.4

Q ss_pred             CCCcccccccccc
Q psy3653          67 PKCGGCNRAIMEN   79 (202)
Q Consensus        67 ~~C~~C~~~I~~~   79 (202)
                      ..|.+|+..|.+.
T Consensus        23 ~~C~gC~~~l~~~   35 (56)
T PF02591_consen   23 GTCSGCHMELPPQ   35 (56)
T ss_pred             CccCCCCEEcCHH
Confidence            4677777777643


No 120
>KOG1734|consensus
Probab=25.00  E-value=54  Score=26.78  Aligned_cols=43  Identities=28%  Similarity=0.436  Sum_probs=27.0

Q ss_pred             ceeecCCCccccccccccCCCCCCCCCCCccc----ce-e-----eecCccccccccc
Q psy3653         124 SFFDHEGLPYCETHYHAKRGSLCAGCHKPITG----RC-I-----TAMFRKFHPEHFV  171 (202)
Q Consensus       124 ~~~~~~g~~~C~~~~~~~~~~~C~~C~~~I~~----~~-~-----~~~~~~~H~~Cf~  171 (202)
                      .+++++|.|.     ..+....|+.|++.|..    +. |     -.-+..||..|-|
T Consensus       210 GfYs~~glPt-----khl~d~vCaVCg~~~~~s~~eegvienty~LsCnHvFHEfCIr  262 (328)
T KOG1734|consen  210 GFYSPSGLPT-----KHLSDSVCAVCGQQIDVSVDEEGVIENTYKLSCNHVFHEFCIR  262 (328)
T ss_pred             cccCCCCCCC-----CCCCcchhHhhcchheeecchhhhhhhheeeecccchHHHhhh
Confidence            4667777762     22334679999999831    11 1     2347789988764


No 121
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=24.97  E-value=50  Score=19.23  Aligned_cols=11  Identities=45%  Similarity=1.063  Sum_probs=7.3

Q ss_pred             CCCCCC-CCccc
Q psy3653         145 LCAGCH-KPITG  155 (202)
Q Consensus       145 ~C~~C~-~~I~~  155 (202)
                      .|.+|+ .+|.|
T Consensus         2 ~C~~C~~~~i~g   13 (49)
T cd02338           2 SCDGCGKSNFTG   13 (49)
T ss_pred             CCCCCcCCCcEE
Confidence            477777 56664


No 122
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=24.93  E-value=50  Score=19.13  Aligned_cols=13  Identities=38%  Similarity=0.626  Sum_probs=9.3

Q ss_pred             CCCCCCCCCCccc
Q psy3653         143 GSLCAGCHKPITG  155 (202)
Q Consensus       143 ~~~C~~C~~~I~~  155 (202)
                      ...|..|++.|.+
T Consensus        11 ~~~C~~C~~~i~g   23 (53)
T PF00130_consen   11 PTYCDVCGKFIWG   23 (53)
T ss_dssp             TEB-TTSSSBECS
T ss_pred             CCCCcccCcccCC
Confidence            4579999999944


No 123
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=24.81  E-value=38  Score=17.31  Aligned_cols=12  Identities=42%  Similarity=1.005  Sum_probs=3.5

Q ss_pred             ccccccccccCC
Q psy3653          34 FFCAQCGKQFGE   45 (202)
Q Consensus        34 f~C~~C~~~l~~   45 (202)
                      |+|..|++++++
T Consensus         1 ~~C~~C~~~~~~   12 (30)
T PF07649_consen    1 FRCDACGKPIDG   12 (30)
T ss_dssp             ---TTTS----S
T ss_pred             CcCCcCCCcCCC
Confidence            467777777655


No 124
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=24.78  E-value=48  Score=16.66  Aligned_cols=8  Identities=13%  Similarity=0.231  Sum_probs=3.7

Q ss_pred             CcCcccch
Q psy3653          14 SLRCFQKC   21 (202)
Q Consensus        14 ~~~C~~~~   21 (202)
                      ||.|..++
T Consensus         3 CP~C~~~V   10 (26)
T PF10571_consen    3 CPECGAEV   10 (26)
T ss_pred             CCCCcCCc
Confidence            45554433


No 125
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=24.64  E-value=34  Score=15.62  Aligned_cols=11  Identities=55%  Similarity=1.265  Sum_probs=5.1

Q ss_pred             ccccccccccC
Q psy3653          34 FFCAQCGKQFG   44 (202)
Q Consensus        34 f~C~~C~~~l~   44 (202)
                      |+|..|+..+.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            45666666554


No 126
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=23.98  E-value=18  Score=20.71  Aligned_cols=28  Identities=21%  Similarity=0.505  Sum_probs=17.4

Q ss_pred             CCCCCCCCCcc-cceeeecCcccccccccccccccccC
Q psy3653         144 SLCAGCHKPIT-GRCITAMFRKFHPEHFVCAFCLRQLN  180 (202)
Q Consensus       144 ~~C~~C~~~I~-~~~~~~~~~~~H~~Cf~C~~C~~~l~  180 (202)
                      -+|+.|+..+. +....         =++|..|+.++.
T Consensus         4 y~C~~CG~~~~~~~~~~---------~~~Cp~CG~~~~   32 (46)
T PRK00398          4 YKCARCGREVELDEYGT---------GVRCPYCGYRIL   32 (46)
T ss_pred             EECCCCCCEEEECCCCC---------ceECCCCCCeEE
Confidence            36888888773 22111         267888887654


No 127
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=23.78  E-value=34  Score=18.63  Aligned_cols=7  Identities=29%  Similarity=1.032  Sum_probs=3.0

Q ss_pred             Ccccccc
Q psy3653          69 CGGCNRA   75 (202)
Q Consensus        69 C~~C~~~   75 (202)
                      |..|+..
T Consensus         5 CP~C~~~   11 (37)
T PF13719_consen    5 CPNCQTR   11 (37)
T ss_pred             CCCCCce
Confidence            4444443


No 128
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=23.72  E-value=32  Score=19.24  Aligned_cols=20  Identities=25%  Similarity=0.351  Sum_probs=11.6

Q ss_pred             CCceEeeCCcccChhhHhhh
Q psy3653         181 KGTFKEQNDKPYCHGCFEKL  200 (202)
Q Consensus       181 ~~~~~~~~~~~yC~~c~~~~  200 (202)
                      ++.....+-.+.|..|..++
T Consensus        25 gg~~~~~Nl~~lC~~Ch~~k   44 (47)
T PF01844_consen   25 GGKNDLENLILLCPSCHRKK   44 (47)
T ss_dssp             T---STTTEEEEEHHHHHHH
T ss_pred             CCCCCHHHHHHHhHHHHHHh
Confidence            33445556688888887553


No 129
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=23.56  E-value=46  Score=25.22  Aligned_cols=36  Identities=22%  Similarity=0.408  Sum_probs=22.5

Q ss_pred             cccccccccccccCCCceeeeCCeeeccccccccCC
Q psy3653          31 TEHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFA   66 (202)
Q Consensus        31 ~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~   66 (202)
                      ..|++|+.=....+...+...|-+++|+.|...+|.
T Consensus       137 ~kC~QC~~~~~~~~~~~~~~F~~~lFC~~ClFPLF~  172 (173)
T PF11077_consen  137 DKCVQCSQKCENVGAKIFTYFNFNLFCKNCLFPLFD  172 (173)
T ss_pred             cccCcCCCCcccccceeEEecChhhcccccCccccc
Confidence            345555533233333337788889999999887763


No 130
>PF12898 Stc1:  Stc1 domain;  InterPro: IPR024630 The domain contains 8 conserved cysteines that may bind to zinc. In S. pombe, proteins containing the domain act as protein linkers, which link the chromatin modifying CLRC complex to RNAi by tethering it to the RITS complex. This domain has a slightly different arrangement of its CxxC pairs from the LIM domain, hence it is not part of that family []. The tandem zinc-finger structure could mediate protein-protein interactions.
Probab=23.44  E-value=13  Score=24.53  Aligned_cols=27  Identities=22%  Similarity=0.651  Sum_probs=14.5

Q ss_pred             cccccccccCCCceE---eeCCcc-cChhhH
Q psy3653         171 VCAFCLRQLNKGTFK---EQNDKP-YCHGCF  197 (202)
Q Consensus       171 ~C~~C~~~l~~~~~~---~~~~~~-yC~~c~  197 (202)
                      .|..|++.++-..|.   ..++.+ .|..|.
T Consensus        52 ~C~~C~~~k~ld~FSK~QR~~~~~a~C~~Cv   82 (84)
T PF12898_consen   52 TCSPCGKTKPLDEFSKNQRRKPDPARCKDCV   82 (84)
T ss_pred             EeccCCCCcCHHHHhHHhhcCCCcccchhhh
Confidence            566666666655554   233344 666653


No 131
>KOG3002|consensus
Probab=22.75  E-value=34  Score=28.39  Aligned_cols=45  Identities=20%  Similarity=0.388  Sum_probs=37.1

Q ss_pred             ccccccccccccCCCceeeeCCeeeccccccccCCCCCcccccccc
Q psy3653          32 EHFFCAQCGKQFGEDGFHEKDGKPYCRDDYFDLFAPKCGGCNRAIM   77 (202)
Q Consensus        32 ~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~C~~C~~~I~   77 (202)
                      +=|-|..|...|....|.=.+|.+.|..|-.++ ..+|..|..+|.
T Consensus        47 ~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~-~~~CP~Cr~~~g   91 (299)
T KOG3002|consen   47 DLLDCPVCFNPLSPPIFQCDNGHLACSSCRTKV-SNKCPTCRLPIG   91 (299)
T ss_pred             hhccCchhhccCcccceecCCCcEehhhhhhhh-cccCCccccccc
Confidence            346788999999888888889999999997654 358999999986


No 132
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=22.64  E-value=1.6e+02  Score=23.99  Aligned_cols=13  Identities=15%  Similarity=0.376  Sum_probs=9.9

Q ss_pred             CCCCCCCCCCCcc
Q psy3653         142 RGSLCAGCHKPIT  154 (202)
Q Consensus       142 ~~~~C~~C~~~I~  154 (202)
                      .+..|+.|+-+..
T Consensus       208 k~~PCPKCg~et~  220 (314)
T PF06524_consen  208 KPIPCPKCGYETQ  220 (314)
T ss_pred             CCCCCCCCCCccc
Confidence            4567999998883


No 133
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=22.55  E-value=55  Score=26.59  Aligned_cols=28  Identities=25%  Similarity=0.383  Sum_probs=15.1

Q ss_pred             CCCCCCCCCCCcccceeeecCccccccc
Q psy3653         142 RGSLCAGCHKPITGRCITAMFRKFHPEH  169 (202)
Q Consensus       142 ~~~~C~~C~~~I~~~~~~~~~~~~H~~C  169 (202)
                      .+..|.+|+.+|.-..+.-.+..|.|.|
T Consensus       244 ~g~pC~~Cg~~I~~~~~~gR~t~~CP~C  271 (274)
T PRK01103        244 EGEPCRRCGTPIEKIKQGGRSTFFCPRC  271 (274)
T ss_pred             CCCCCCCCCCeeEEEEECCCCcEECcCC
Confidence            3456888888885433332333344433


No 134
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=22.53  E-value=38  Score=17.28  Aligned_cols=24  Identities=8%  Similarity=0.135  Sum_probs=10.0

Q ss_pred             CCCCCCcccceeeecCcccccccc
Q psy3653         147 AGCHKPITGRCITAMFRKFHPEHF  170 (202)
Q Consensus       147 ~~C~~~I~~~~~~~~~~~~H~~Cf  170 (202)
                      +.|........+..-+..||..|+
T Consensus         2 ~iC~~~~~~~~~~~C~H~~c~~C~   25 (39)
T smart00184        2 PICLEELKDPVVLPCGHTFCRSCI   25 (39)
T ss_pred             CcCccCCCCcEEecCCChHHHHHH
Confidence            334444333233334445554443


No 135
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=21.83  E-value=56  Score=29.02  Aligned_cols=14  Identities=29%  Similarity=0.800  Sum_probs=8.6

Q ss_pred             cccccccccccccC
Q psy3653         167 PEHFVCAFCLRQLN  180 (202)
Q Consensus       167 ~~Cf~C~~C~~~l~  180 (202)
                      ++||.|-.|..+|.
T Consensus        50 r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen   50 RNCFDCPICFSPLS   63 (483)
T ss_pred             cccccCCCCCCcce
Confidence            46666666666655


No 136
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=21.62  E-value=59  Score=26.46  Aligned_cols=28  Identities=21%  Similarity=0.551  Sum_probs=16.0

Q ss_pred             CCCCCCCCCCCcccceeeecCccccccc
Q psy3653         142 RGSLCAGCHKPITGRCITAMFRKFHPEH  169 (202)
Q Consensus       142 ~~~~C~~C~~~I~~~~~~~~~~~~H~~C  169 (202)
                      .+..|.+|+.+|.-..+...+..|.|.|
T Consensus       243 ~g~pCprCG~~I~~~~~~gR~t~~CP~C  270 (272)
T PRK14810        243 TGEPCLNCKTPIRRVVVAGRSSHYCPHC  270 (272)
T ss_pred             CCCcCCCCCCeeEEEEECCCccEECcCC
Confidence            3567889988885433333333455444


No 137
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=21.34  E-value=61  Score=20.02  Aligned_cols=12  Identities=33%  Similarity=0.492  Sum_probs=9.1

Q ss_pred             CCCCCCCCCCcc
Q psy3653         143 GSLCAGCHKPIT  154 (202)
Q Consensus       143 ~~~C~~C~~~I~  154 (202)
                      ..+|..||++|.
T Consensus         4 PVRCFTCGkvi~   15 (60)
T PF01194_consen    4 PVRCFTCGKVIG   15 (60)
T ss_dssp             SSS-STTTSBTC
T ss_pred             ceecCCCCCChh
Confidence            568999999994


No 138
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=21.07  E-value=80  Score=18.19  Aligned_cols=11  Identities=55%  Similarity=1.407  Sum_probs=6.4

Q ss_pred             CCCCCCC-Cccc
Q psy3653         145 LCAGCHK-PITG  155 (202)
Q Consensus       145 ~C~~C~~-~I~~  155 (202)
                      .|.+|+. ||.|
T Consensus         2 ~Cd~C~~~pI~G   13 (45)
T cd02344           2 TCDGCQMFPING   13 (45)
T ss_pred             CCCCCCCCCCcc
Confidence            4666763 5654


No 139
>PHA02929 N1R/p28-like protein; Provisional
Probab=20.98  E-value=59  Score=26.02  Aligned_cols=38  Identities=18%  Similarity=0.403  Sum_probs=26.6

Q ss_pred             CCCCCCCCCCcccc--------eeeecCcccccccc--------cccccccccC
Q psy3653         143 GSLCAGCHKPITGR--------CITAMFRKFHPEHF--------VCAFCLRQLN  180 (202)
Q Consensus       143 ~~~C~~C~~~I~~~--------~~~~~~~~~H~~Cf--------~C~~C~~~l~  180 (202)
                      ...|+.|.+++.+.        .+..-+..||..|+        .|..|.+.+.
T Consensus       174 ~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~  227 (238)
T PHA02929        174 DKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFI  227 (238)
T ss_pred             CCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEee
Confidence            46799999987432        23345778888887        5777777665


No 140
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=20.98  E-value=51  Score=21.85  Aligned_cols=31  Identities=23%  Similarity=0.436  Sum_probs=19.0

Q ss_pred             CCCCCCCCcc-cce--eeecCcccccccccccccccc
Q psy3653         145 LCAGCHKPIT-GRC--ITAMFRKFHPEHFVCAFCLRQ  178 (202)
Q Consensus       145 ~C~~C~~~I~-~~~--~~~~~~~~H~~Cf~C~~C~~~  178 (202)
                      .|..|+.||. +..  +.+.|..-.   |.|..|...
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~---FCC~GC~~V   35 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERP---FCCPGCQAV   35 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccc---cccHHHHHH
Confidence            5889999994 322  344454433   667777654


No 141
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=20.86  E-value=43  Score=16.26  Aligned_cols=12  Identities=50%  Similarity=1.245  Sum_probs=7.5

Q ss_pred             ccccccccccCC
Q psy3653          34 FFCAQCGKQFGE   45 (202)
Q Consensus        34 f~C~~C~~~l~~   45 (202)
                      |+|..|++.+..
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            467777766654


No 142
>PRK10445 endonuclease VIII; Provisional
Probab=20.77  E-value=62  Score=26.17  Aligned_cols=28  Identities=18%  Similarity=0.319  Sum_probs=15.7

Q ss_pred             CCCCCCCCCCCcccceeeecCccccccc
Q psy3653         142 RGSLCAGCHKPITGRCITAMFRKFHPEH  169 (202)
Q Consensus       142 ~~~~C~~C~~~I~~~~~~~~~~~~H~~C  169 (202)
                      .+..|++|+.+|.-..+.-.+..|.|.|
T Consensus       234 ~g~~Cp~Cg~~I~~~~~~gR~t~~CP~C  261 (263)
T PRK10445        234 DGEACERCGGIIEKTTLSSRPFYWCPGC  261 (263)
T ss_pred             CCCCCCCCCCEeEEEEECCCCcEECCCC
Confidence            3567888888885433333333454443


No 143
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=20.53  E-value=71  Score=31.86  Aligned_cols=23  Identities=13%  Similarity=0.271  Sum_probs=15.0

Q ss_pred             CccccccccccCCCCCCCCCCCc
Q psy3653         131 LPYCETHYHAKRGSLCAGCHKPI  153 (202)
Q Consensus       131 ~~~C~~~~~~~~~~~C~~C~~~I  153 (202)
                      ...|+.|-...+..+|+.|+.+.
T Consensus       667 ~rkCPkCG~~t~~~fCP~CGs~t  689 (1337)
T PRK14714        667 RRRCPSCGTETYENRCPDCGTHT  689 (1337)
T ss_pred             EEECCCCCCccccccCcccCCcC
Confidence            35677776665566777777664


No 144
>PRK10220 hypothetical protein; Provisional
Probab=20.44  E-value=63  Score=22.50  Aligned_cols=29  Identities=10%  Similarity=0.499  Sum_probs=18.1

Q ss_pred             hCcCcccchhcccccccccccccccccccccCCC
Q psy3653          13 FSLRCFQKCVTALEKTWHTEHFFCAQCGKQFGED   46 (202)
Q Consensus        13 ~~~~C~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   46 (202)
                      .||.|..++.-.++..     |.|.+|+..++..
T Consensus         5 ~CP~C~seytY~d~~~-----~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYEDNGM-----YICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcCCCe-----EECCcccCcCCcc
Confidence            4777766666655554     6777777666543


No 145
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=20.40  E-value=65  Score=26.16  Aligned_cols=25  Identities=28%  Similarity=0.571  Sum_probs=14.5

Q ss_pred             CCCCCCCCCCcccceeeecCccccc
Q psy3653         143 GSLCAGCHKPITGRCITAMFRKFHP  167 (202)
Q Consensus       143 ~~~C~~C~~~I~~~~~~~~~~~~H~  167 (202)
                      +..|.+|+.+|.-..+.-.+..|.+
T Consensus       235 g~pC~~Cg~~I~~~~~~gR~ty~Cp  259 (269)
T PRK14811        235 GQPCPRCGTPIEKIVVGGRGTHFCP  259 (269)
T ss_pred             cCCCCcCCCeeEEEEECCCCcEECC
Confidence            5679999999854333322333444


No 146
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=20.37  E-value=93  Score=16.56  Aligned_cols=23  Identities=22%  Similarity=0.363  Sum_probs=13.4

Q ss_pred             cccccccccCCCceeeeCCeeecccc
Q psy3653          35 FCAQCGKQFGEDGFHEKDGKPYCRDD   60 (202)
Q Consensus        35 ~C~~C~~~l~~~~~~~~~g~~yC~~c   60 (202)
                      +|..|+.++   .+...++..+|..|
T Consensus         5 ~C~~C~~~~---i~~~~~~~~~C~~C   27 (33)
T PF08792_consen    5 KCSKCGGNG---IVNKEDDYEVCIFC   27 (33)
T ss_pred             EcCCCCCCe---EEEecCCeEEcccC
Confidence            466676654   23356666666665


No 147
>PF14149 YhfH:  YhfH-like protein
Probab=20.18  E-value=13  Score=20.61  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=13.2

Q ss_pred             cccCCCCCCCCCCCcccc
Q psy3653         139 HAKRGSLCAGCHKPITGR  156 (202)
Q Consensus       139 ~~~~~~~C~~C~~~I~~~  156 (202)
                      ..+....|+.||+.|.++
T Consensus         9 rnLp~K~C~~CG~~i~EQ   26 (37)
T PF14149_consen    9 RNLPPKKCTECGKEIEEQ   26 (37)
T ss_pred             HhCCCcccHHHHHHHHHH
Confidence            345567899999998643


No 148
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.12  E-value=67  Score=26.09  Aligned_cols=28  Identities=25%  Similarity=0.503  Sum_probs=16.5

Q ss_pred             CCCCCCCCCCCcccceeeecCccccccc
Q psy3653         142 RGSLCAGCHKPITGRCITAMFRKFHPEH  169 (202)
Q Consensus       142 ~~~~C~~C~~~I~~~~~~~~~~~~H~~C  169 (202)
                      .+..|.+|+.+|.-..+.-.+..|.|.|
T Consensus       244 ~g~pC~~Cg~~I~~~~~~gR~t~~CP~C  271 (272)
T TIGR00577       244 KGEPCRRCGTPIEKIKVGGRGTHFCPQC  271 (272)
T ss_pred             CCCCCCCCCCeeEEEEECCCCCEECCCC
Confidence            3557999999985433333333455544


Done!