Query         psy3656
Match_columns 185
No_of_seqs    163 out of 1335
Neff          9.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:17:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3656.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3656hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9   5E-26 1.1E-30  183.5  -3.3  104   80-184   272-377 (468)
  2 KOG1701|consensus               99.9 1.2E-24 2.5E-29  175.6   1.2   98   83-180   335-440 (468)
  3 KOG4577|consensus               99.9 3.9E-24 8.5E-29  164.7  -3.8  104   81-185    32-139 (383)
  4 KOG1044|consensus               99.8 1.3E-21 2.7E-26  163.1   1.9   99   80-179   131-230 (670)
  5 KOG2272|consensus               99.8 6.5E-21 1.4E-25  144.6  -3.5  101   83-183    13-115 (332)
  6 KOG2272|consensus               99.8 4.5E-20 9.8E-25  140.1  -1.8  105   77-181   190-294 (332)
  7 KOG1703|consensus               99.7 7.1E-19 1.5E-23  149.7   1.7  103   82-184   363-467 (479)
  8 KOG1703|consensus               99.7 2.9E-17 6.2E-22  139.9   3.1  103   82-184   303-406 (479)
  9 PF00412 LIM:  LIM domain;  Int  99.5 3.5E-14 7.5E-19   86.9   2.7   56   85-140     1-58  (58)
 10 KOG1044|consensus               99.4 3.9E-13 8.4E-18  112.9   5.4   91   82-182    16-107 (670)
 11 KOG1700|consensus               99.4 1.2E-13 2.6E-18  104.8   0.6  102   82-183     7-151 (200)
 12 PF00412 LIM:  LIM domain;  Int  99.0 2.8E-10 6.1E-15   69.4   3.6   41  144-184     1-43  (58)
 13 smart00132 LIM Zinc-binding do  99.0 5.5E-10 1.2E-14   62.3   2.8   36  143-178     1-38  (39)
 14 smart00132 LIM Zinc-binding do  98.5 5.4E-08 1.2E-12   54.0   2.6   36   84-119     1-38  (39)
 15 KOG4577|consensus               98.1 4.6E-07 9.9E-12   70.9  -0.1   64   82-145    92-159 (383)
 16 KOG1700|consensus               98.1 7.3E-07 1.6E-11   67.8   0.5   61   80-140   106-167 (200)
 17 KOG0490|consensus               98.0 1.1E-06 2.4E-11   68.2  -0.8   96   88-184     2-104 (235)
 18 KOG1702|consensus               97.9 1.2E-06 2.6E-11   65.6  -1.0   58   83-140     5-63  (264)
 19 PF14446 Prok-RING_1:  Prokaryo  94.9    0.02 4.3E-07   34.0   1.9   38  140-177     4-51  (54)
 20 PF14835 zf-RING_6:  zf-RING of  90.5    0.33 7.1E-06   29.9   2.7   49  109-157     8-56  (65)
 21 PF08394 Arc_trans_TRASH:  Arch  86.9    0.45 9.7E-06   26.0   1.4   28  144-171     1-30  (37)
 22 PF09943 DUF2175:  Uncharacteri  85.6    0.25 5.3E-06   33.3  -0.0   28  143-170     4-33  (101)
 23 PF10367 Vps39_2:  Vacuolar sor  85.5    0.77 1.7E-05   30.8   2.4   28  142-169    79-108 (109)
 24 KOG0320|consensus               84.2    0.35 7.5E-06   35.9   0.3   48  106-153   129-179 (187)
 25 PF10235 Cript:  Microtubule-as  82.9    0.84 1.8E-05   30.1   1.6   36  110-153    46-81  (90)
 26 PF10367 Vps39_2:  Vacuolar sor  82.1     1.3 2.9E-05   29.6   2.5   32   79-110    75-108 (109)
 27 KOG1813|consensus               80.8    0.83 1.8E-05   36.6   1.2   47  107-154   240-288 (313)
 28 COG5152 Uncharacterized conser  78.7    0.39 8.4E-06   36.3  -1.2   51  106-157   194-246 (259)
 29 smart00504 Ubox Modified RING   77.9     1.8   4E-05   25.9   1.9   44  109-153     2-47  (63)
 30 PF06827 zf-FPG_IleRS:  Zinc fi  76.3    0.77 1.7E-05   23.5  -0.1   27  141-167     1-27  (30)
 31 PF05864 Chordopox_RPO7:  Chord  75.4    0.33 7.1E-06   29.0  -1.9   17  169-185     6-22  (63)
 32 PF11571 Med27:  Mediator compl  75.1     1.4   3E-05   29.0   0.9   32  136-167    49-89  (90)
 33 PRK14873 primosome assembly pr  74.7     2.3 5.1E-05   38.3   2.4   48   83-150   384-431 (665)
 34 PF11781 RRN7:  RNA polymerase   74.7     1.4   3E-05   23.8   0.6   23  110-136    10-32  (36)
 35 PF12773 DZR:  Double zinc ribb  73.7     3.8 8.2E-05   23.5   2.4    6  144-149    32-37  (50)
 36 PHA03082 DNA-dependent RNA pol  73.2    0.39 8.4E-06   28.7  -1.9   17  169-185     6-22  (63)
 37 smart00504 Ubox Modified RING   72.3     2.7 5.8E-05   25.1   1.6   39  143-181     3-49  (63)
 38 PF00645 zf-PARP:  Poly(ADP-rib  72.2     1.2 2.6E-05   28.6  -0.0   32  138-169     4-47  (82)
 39 PF07191 zinc-ribbons_6:  zinc-  70.3     1.9 4.1E-05   27.0   0.5   51  128-184    16-67  (70)
 40 PF10083 DUF2321:  Uncharacteri  69.9       2 4.3E-05   31.2   0.7   50  126-177    25-78  (158)
 41 PF13920 zf-C3HC4_3:  Zinc fing  69.9     2.9 6.2E-05   24.0   1.3   42  110-152     4-48  (50)
 42 TIGR00595 priA primosomal prot  69.7     3.6 7.9E-05   35.9   2.4   38  110-150   224-262 (505)
 43 PF13240 zinc_ribbon_2:  zinc-r  66.8     3.9 8.5E-05   19.7   1.2    8  144-151     2-9   (23)
 44 PF14634 zf-RING_5:  zinc-RING   66.4     4.3 9.2E-05   22.7   1.5   39  111-149     2-44  (44)
 45 PF06677 Auto_anti-p27:  Sjogre  64.9     4.7  0.0001   22.5   1.4   10  125-134    30-39  (41)
 46 KOG4443|consensus               63.4     4.5 9.8E-05   36.0   1.7   21  159-179   107-127 (694)
 47 PF14471 DUF4428:  Domain of un  63.2     3.6 7.8E-05   24.1   0.8   29  110-139     1-30  (51)
 48 COG4847 Uncharacterized protei  62.8     2.3   5E-05   28.2  -0.1   34  142-175     7-42  (103)
 49 cd00162 RING RING-finger (Real  62.3     4.2 9.1E-05   21.8   0.9   24  127-150    18-44  (45)
 50 COG1645 Uncharacterized Zn-fin  61.7     4.9 0.00011   28.4   1.3   21  111-136    31-51  (131)
 51 PLN03208 E3 ubiquitin-protein   60.3     8.7 0.00019   29.1   2.5   12  142-153    69-80  (193)
 52 KOG2462|consensus               60.3     5.5 0.00012   31.8   1.5   37  143-179   217-255 (279)
 53 PF10886 DUF2685:  Protein of u  59.4     6.5 0.00014   23.3   1.4   24  142-165     2-26  (54)
 54 PF05502 Dynactin_p62:  Dynacti  59.3     6.3 0.00014   34.2   1.9   12  166-177    51-62  (483)
 55 PRK14559 putative protein seri  58.6      11 0.00023   34.1   3.3   49   83-152     2-52  (645)
 56 COG2191 Formylmethanofuran deh  57.5     4.9 0.00011   30.6   0.8   31  109-139   173-203 (206)
 57 PF06906 DUF1272:  Protein of u  57.2      14 0.00031   22.0   2.6   43  111-153     8-53  (57)
 58 KOG0823|consensus               55.7     9.4  0.0002   29.7   2.1   50  104-154    43-97  (230)
 59 PF07754 DUF1610:  Domain of un  52.8     9.1  0.0002   18.7   1.1   10  144-153     1-10  (24)
 60 PRK00420 hypothetical protein;  52.2     9.5 0.00021   26.3   1.5   10   83-92     24-33  (112)
 61 PF13248 zf-ribbon_3:  zinc-rib  51.6      11 0.00024   18.5   1.3    9   84-92      4-12  (26)
 62 COG0266 Nei Formamidopyrimidin  51.5     9.5 0.00021   30.6   1.6   27  141-167   245-271 (273)
 63 PF05502 Dynactin_p62:  Dynacti  50.6     9.7 0.00021   33.1   1.6   37   83-119    27-63  (483)
 64 COG1198 PriA Primosomal protei  50.0      14  0.0003   33.8   2.6   39  109-150   445-484 (730)
 65 KOG2462|consensus               48.2      12 0.00026   29.9   1.7   14  166-179   214-227 (279)
 66 PF13923 zf-C3HC4_2:  Zinc fing  48.0     3.2 6.9E-05   22.4  -1.1   27  112-138     2-28  (39)
 67 PF00096 zf-C2H2:  Zinc finger,  46.9     7.7 0.00017   18.0   0.3   12  168-179     1-12  (23)
 68 PRK12495 hypothetical protein;  46.9      13 0.00028   28.7   1.6   10  109-118    43-52  (226)
 69 KOG4739|consensus               46.8      15 0.00033   28.7   2.0   34  120-153    15-49  (233)
 70 PF08209 Sgf11:  Sgf11 (transcr  45.6     3.9 8.4E-05   21.7  -1.0   15  168-182     5-19  (33)
 71 cd02340 ZZ_NBR1_like Zinc fing  45.3     8.7 0.00019   21.5   0.4   10  144-153     3-12  (43)
 72 PF12171 zf-C2H2_jaz:  Zinc-fin  44.9      10 0.00022   18.6   0.6   13  168-180     2-14  (27)
 73 KOG2114|consensus               44.1     9.3  0.0002   35.2   0.6   35  143-177   842-882 (933)
 74 KOG3579|consensus               43.9      11 0.00024   30.3   0.9   47   83-134   269-316 (352)
 75 PF08790 zf-LYAR:  LYAR-type C2  43.9     4.5 9.8E-05   20.6  -0.8   15  168-182     1-15  (28)
 76 COG0068 HypF Hydrogenase matur  43.0      16 0.00034   33.2   1.8   83   81-177   100-183 (750)
 77 PF14569 zf-UDP:  Zinc-binding   42.6      13 0.00029   23.8   0.9   50   81-150     8-60  (80)
 78 PF02069 Metallothio_Pro:  Prok  42.5      14  0.0003   21.8   0.9   25  110-134     9-33  (52)
 79 PRK05580 primosome assembly pr  42.5      20 0.00044   32.5   2.4   38  110-150   392-430 (679)
 80 smart00184 RING Ring finger. E  42.3      10 0.00022   19.3   0.4   26  144-169     1-26  (39)
 81 PRK04016 DNA-directed RNA poly  42.2     5.4 0.00012   24.4  -0.8   11  169-179     6-16  (62)
 82 PRK04023 DNA polymerase II lar  42.1      33 0.00072   32.6   3.7   52   80-153   624-675 (1121)
 83 KOG3002|consensus               41.9      19  0.0004   29.3   1.9   43  109-152    49-91  (299)
 84 PRK01103 formamidopyrimidine/5  41.4      17 0.00037   29.0   1.7   29  139-167   243-271 (274)
 85 PHA02929 N1R/p28-like protein;  40.3      14 0.00031   28.9   1.0   36  142-177   175-226 (238)
 86 cd02249 ZZ Zinc finger, ZZ typ  40.2      18 0.00039   20.3   1.2   11  143-153     2-12  (46)
 87 PLN03208 E3 ubiquitin-protein   39.1      20 0.00043   27.2   1.6   30  108-138    18-47  (193)
 88 PF01258 zf-dskA_traR:  Prokary  38.7     2.3 4.9E-05   22.8  -2.6   13   84-96      5-17  (36)
 89 PF12874 zf-met:  Zinc-finger o  37.4      13 0.00029   17.5   0.3   13  168-180     1-13  (25)
 90 PRK14810 formamidopyrimidine-D  36.8      22 0.00048   28.4   1.6   28  140-167   243-270 (272)
 91 PF13894 zf-C2H2_4:  C2H2-type   36.1      16 0.00035   16.5   0.5   11  168-178     1-11  (24)
 92 KOG0978|consensus               35.8      11 0.00024   34.1  -0.3   27  125-151   659-688 (698)
 93 PRK10445 endonuclease VIII; Pr  35.8      24 0.00051   28.1   1.6   29  139-167   233-261 (263)
 94 PF06750 DiS_P_DiS:  Bacterial   35.5      54  0.0012   21.6   3.1   11   82-92     33-43  (92)
 95 PRK00807 50S ribosomal protein  35.3      30 0.00065   20.3   1.6   29  142-170     2-34  (52)
 96 KOG3970|consensus               35.2      19  0.0004   28.0   0.9   53   99-154    44-107 (299)
 97 PF03107 C1_2:  C1 domain;  Int  34.9      28 0.00062   17.6   1.3    9  144-152     3-11  (30)
 98 PRK14811 formamidopyrimidine-D  34.7      26 0.00056   28.0   1.7   27  141-167   235-261 (269)
 99 KOG0978|consensus               34.4     7.8 0.00017   35.1  -1.4   44  142-185   644-696 (698)
100 TIGR00577 fpg formamidopyrimid  33.9      26 0.00057   27.9   1.6   27  141-167   245-271 (272)
101 PF07649 C1_3:  C1-like domain;  33.5      26 0.00055   17.7   1.0    9  144-152     3-11  (30)
102 PF00130 C1_1:  Phorbol esters/  33.5      53  0.0011   18.7   2.5   28  142-169    12-44  (53)
103 cd02341 ZZ_ZZZ3 Zinc finger, Z  33.5      26 0.00056   20.2   1.1    9  144-152     3-12  (48)
104 PRK14890 putative Zn-ribbon RN  33.1      31 0.00066   20.9   1.4   11  142-152     8-18  (59)
105 PF13912 zf-C2H2_6:  C2H2-type   32.7      17 0.00038   17.5   0.3   12  168-179     2-13  (27)
106 TIGR00599 rad18 DNA repair pro  31.4      19 0.00041   30.5   0.5   44  108-152    26-71  (397)
107 TIGR00599 rad18 DNA repair pro  31.0      27 0.00058   29.6   1.3   37   82-118    26-70  (397)
108 COG3813 Uncharacterized protei  30.8      43 0.00093   21.1   1.8   42  111-152     8-52  (84)
109 COG4357 Zinc finger domain con  30.5     7.5 0.00016   25.9  -1.6   43   85-127    38-81  (105)
110 KOG2932|consensus               30.5      24 0.00053   28.8   0.9   43  110-152    92-134 (389)
111 TIGR00570 cdk7 CDK-activating   30.4      41 0.00089   27.5   2.2   28  126-153    25-55  (309)
112 PRK13945 formamidopyrimidine-D  30.3      33 0.00071   27.5   1.6   27  141-167   254-280 (282)
113 PF01927 Mut7-C:  Mut7-C RNAse   30.3      93   0.002   22.2   3.9   36   82-117    91-133 (147)
114 PF13695 zf-3CxxC:  Zinc-bindin  30.1      59  0.0013   21.5   2.6   13  138-150    35-47  (98)
115 KOG2186|consensus               30.0      12 0.00025   29.6  -1.0   41   83-123     4-44  (276)
116 PF06524 NOA36:  NOA36 protein;  29.7      38 0.00082   27.0   1.8   11  142-152   210-220 (314)
117 smart00531 TFIIE Transcription  29.3      40 0.00086   24.2   1.8   35   82-119    99-134 (147)
118 cd02336 ZZ_RSC8 Zinc finger, Z  29.1      38 0.00082   19.2   1.3   29  110-138     2-32  (45)
119 KOG3039|consensus               29.0      36 0.00079   26.9   1.6   75   82-156   183-274 (303)
120 PF12677 DUF3797:  Domain of un  28.5      48   0.001   19.2   1.6   26  142-167    14-42  (49)
121 COG4306 Uncharacterized protei  28.2      35 0.00075   24.0   1.2   11  143-153    41-51  (160)
122 PF04570 DUF581:  Protein of un  27.8      33 0.00071   20.7   0.9    9  170-178    19-27  (58)
123 TIGR00143 hypF [NiFe] hydrogen  27.8      43 0.00093   30.7   2.1   83   81-177    67-150 (711)
124 PF02591 DUF164:  Putative zinc  27.4      22 0.00048   20.9   0.1   14   80-93     20-33  (56)
125 PRK14891 50S ribosomal protein  27.2      45 0.00097   23.5   1.6   30  142-171     5-38  (131)
126 smart00746 TRASH metallochaper  27.1      64  0.0014   15.6   2.0   21  144-164     1-25  (39)
127 smart00547 ZnF_RBZ Zinc finger  27.1      45 0.00098   15.9   1.3   19  132-150     5-25  (26)
128 PF08746 zf-RING-like:  RING-li  26.9      12 0.00026   21.0  -1.1    8   85-92      1-8   (43)
129 PHA02768 hypothetical protein;  26.9      10 0.00022   22.6  -1.4   11  109-119     6-16  (55)
130 smart00291 ZnF_ZZ Zinc-binding  26.6      42 0.00091   18.6   1.2   12  142-153     5-16  (44)
131 TIGR02420 dksA RNA polymerase-  26.5      12 0.00026   25.5  -1.3   28  142-174    81-108 (110)
132 PF13901 DUF4206:  Domain of un  26.3      43 0.00094   25.4   1.6   42  131-174   144-196 (202)
133 PF01194 RNA_pol_N:  RNA polyme  26.2      31 0.00067   20.9   0.6    9  170-178     7-15  (60)
134 COG1656 Uncharacterized conser  26.0      30 0.00064   25.6   0.6   36  142-177    98-140 (165)
135 TIGR00373 conserved hypothetic  25.9      56  0.0012   23.8   2.1   30   82-119   109-139 (158)
136 PF00628 PHD:  PHD-finger;  Int  25.5      73  0.0016   17.8   2.2   10  160-169    21-30  (51)
137 PF04997 RNA_pol_Rpb1_1:  RNA p  25.0 1.1E+02  0.0024   24.2   3.9   52  126-177    39-104 (337)
138 PF01873 eIF-5_eIF-2B:  Domain   24.8      49  0.0011   23.2   1.5   28  142-171    94-121 (125)
139 PF04810 zf-Sec23_Sec24:  Sec23  24.6      63  0.0014   17.5   1.7   29   83-116     3-32  (40)
140 PRK14714 DNA polymerase II lar  24.5      83  0.0018   30.8   3.3   48   84-153   669-721 (1337)
141 KOG3576|consensus               24.5     4.2 9.1E-05   31.1  -4.1   10   83-92    118-127 (267)
142 PF13465 zf-H2C2_2:  Zinc-finge  24.3      31 0.00067   16.7   0.3   10  168-177    15-24  (26)
143 smart00355 ZnF_C2H2 zinc finge  24.2      39 0.00085   15.2   0.7   12  168-179     1-12  (26)
144 COG2174 RPL34A Ribosomal prote  24.0      41  0.0009   22.2   0.9   19  135-153    26-46  (93)
145 COG1571 Predicted DNA-binding   23.2      57  0.0012   27.9   1.9   33  141-182   350-382 (421)
146 COG2888 Predicted Zn-ribbon RN  23.2      61  0.0013   19.6   1.5   11  142-152    10-20  (61)
147 PF13639 zf-RING_2:  Ring finge  22.6      23  0.0005   19.4  -0.4   27  143-169     2-31  (44)
148 PF13832 zf-HC5HC2H_2:  PHD-zin  22.2      55  0.0012   21.9   1.4   29  139-168    53-85  (110)
149 PLN02638 cellulose synthase A   22.0      73  0.0016   30.6   2.4   30   82-118    17-46  (1079)
150 PRK03564 formate dehydrogenase  21.8 1.8E+02  0.0038   23.9   4.4   10   82-91    187-196 (309)
151 PLN02436 cellulose synthase A   21.6      79  0.0017   30.4   2.6   31   81-118    35-65  (1094)
152 cd00472 Ribosomal_L24e_L24 Rib  21.6      67  0.0014   19.0   1.4   25  142-166     4-32  (54)
153 PF12156 ATPase-cat_bd:  Putati  21.6      45 0.00098   21.7   0.8   10  143-152     2-11  (88)
154 smart00249 PHD PHD zinc finger  21.5      69  0.0015   17.0   1.5    7  161-167    22-28  (47)
155 COG0846 SIR2 NAD-dependent pro  21.5 1.3E+02  0.0029   23.8   3.5   19  141-159   146-165 (250)
156 PF10080 DUF2318:  Predicted me  21.5      52  0.0011   22.2   1.1   33  102-138    29-61  (102)
157 PF14279 HNH_5:  HNH endonuclea  21.3      32  0.0007   21.5   0.1   22  157-179    21-42  (71)
158 PRK11595 DNA utilization prote  21.2      68  0.0015   24.7   1.9   10   83-92      6-15  (227)
159 PF11077 DUF2616:  Protein of u  21.1      66  0.0014   24.0   1.7   18  123-140   154-171 (173)
160 PF13834 DUF4193:  Domain of un  21.0      26 0.00055   23.6  -0.5   11  125-135    88-98  (99)
161 PF12647 RNHCP:  RNHCP domain;   20.9 1.8E+02  0.0038   19.3   3.4   34  142-176    42-76  (92)
162 PLN02400 cellulose synthase     20.2      83  0.0018   30.3   2.4   31   81-118    35-65  (1085)
163 PRK04136 rpl40e 50S ribosomal   20.2      58  0.0013   18.8   0.9   22  128-149    13-36  (48)
164 PRK06266 transcription initiat  20.2   1E+02  0.0022   23.0   2.5   30   82-119   117-147 (178)

No 1  
>KOG1701|consensus
Probab=99.90  E-value=5e-26  Score=183.46  Aligned_cols=104  Identities=29%  Similarity=0.749  Sum_probs=96.7

Q ss_pred             CCCCccccccccccc--ceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEE
Q psy3656          80 TQKGCCSSCDKPIVG--QVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVT  157 (185)
Q Consensus        80 ~~~~~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~  157 (185)
                      .+..+|.+|+|.|.+  ..+.+|++.||..||+|..|+++|.+..||..++++||+.||.... +||.+|++.|++++|+
T Consensus       272 ~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLr  350 (468)
T KOG1701|consen  272 DYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILR  350 (468)
T ss_pred             hhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHH
Confidence            345699999999964  4789999999999999999999999999999999999999998776 9999999999999999


Q ss_pred             eCCCeecccCcccccCCCccCCCCeee
Q psy3656         158 ALEKTWHTEHFFCAQCGKQFGEAMVKF  184 (185)
Q Consensus       158 ~~~~~~H~~Cf~C~~C~~~l~~~~~~~  184 (185)
                      |+|+.||+.||+|..|++.|++.-|.+
T Consensus       351 A~GkayHp~CF~Cv~C~r~ldgipFtv  377 (468)
T KOG1701|consen  351 ALGKAYHPGCFTCVVCARCLDGIPFTV  377 (468)
T ss_pred             hcccccCCCceEEEEeccccCCccccc
Confidence            999999999999999999999988753


No 2  
>KOG1701|consensus
Probab=99.89  E-value=1.2e-24  Score=175.63  Aligned_cols=98  Identities=36%  Similarity=0.891  Sum_probs=90.9

Q ss_pred             CcccccccccccceeeecCcccccCCccCCCCCCCCCCCCee-eeCCcCCCccchhhccCCCCCccCCcccCc-------
Q psy3656          83 GCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFF-ERDSRPYCEPDYHNLFSPRCSYCNGPILDK-------  154 (185)
Q Consensus        83 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~-~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~-------  154 (185)
                      .+|..|++.|.++++.++|+.||..||+|..|.+.|.+..|. ..++++||-+||+++|+++|+.|+++|+++       
T Consensus       335 ekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etv  414 (468)
T KOG1701|consen  335 EKCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETV  414 (468)
T ss_pred             HHHhhhhhHHHHHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceE
Confidence            478999999999999999999999999999999999888886 788999999999999999999999999842       


Q ss_pred             eEEeCCCeecccCcccccCCCccCCC
Q psy3656         155 CVTALEKTWHTEHFFCAQCGKQFGEA  180 (185)
Q Consensus       155 ~~~~~~~~~H~~Cf~C~~C~~~l~~~  180 (185)
                      .|+++|+.||.+||+|..|+.+|+.+
T Consensus       415 Rvvamdr~fHv~CY~CEDCg~~LS~e  440 (468)
T KOG1701|consen  415 RVVAMDRDFHVNCYKCEDCGLLLSSE  440 (468)
T ss_pred             EEEEccccccccceehhhcCcccccc
Confidence            46899999999999999999999743


No 3  
>KOG4577|consensus
Probab=99.86  E-value=3.9e-24  Score=164.74  Aligned_cols=104  Identities=26%  Similarity=0.680  Sum_probs=94.9

Q ss_pred             CCCcccccccccccc-eeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCc-eE-E
Q psy3656          81 QKGCCSSCDKPIVGQ-VITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDK-CV-T  157 (185)
Q Consensus        81 ~~~~C~~C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~-~~-~  157 (185)
                      ..++|++|.+.|.+. ++.++++.||..|++|+.|..+| ....+.++|.+||+++|.++||.+|..|..+|.+. +| .
T Consensus        32 eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL-~drCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRk  110 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQL-ADRCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRK  110 (383)
T ss_pred             ccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHH-HHHHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHH
Confidence            357899999999876 56799999999999999999999 45689999999999999999999999999999975 44 4


Q ss_pred             eCCCeecccCcccccCCCcc-CCCCeeeC
Q psy3656         158 ALEKTWHTEHFFCAQCGKQF-GEAMVKFI  185 (185)
Q Consensus       158 ~~~~~~H~~Cf~C~~C~~~l-~~~~~~~~  185 (185)
                      |.+.+||.+||.|..|.++| .+|+|++|
T Consensus       111 Aqd~VYHl~CF~C~iC~R~L~TGdEFYLm  139 (383)
T KOG4577|consen  111 AQDFVYHLHCFACFICKRQLATGDEFYLM  139 (383)
T ss_pred             hhcceeehhhhhhHhhhcccccCCeeEEe
Confidence            99999999999999999999 89999986


No 4  
>KOG1044|consensus
Probab=99.83  E-value=1.3e-21  Score=163.05  Aligned_cols=99  Identities=34%  Similarity=0.785  Sum_probs=93.5

Q ss_pred             CCCCccccccccc-ccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEEe
Q psy3656          80 TQKGCCSSCDKPI-VGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVTA  158 (185)
Q Consensus        80 ~~~~~C~~C~~~i-~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~~  158 (185)
                      .+...|++|++.| .++.+.++++.||..||+|..|..-| .++|...+|.+||+.||...||.+|..|.+.|.|++|.|
T Consensus       131 ~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL-~gey~skdg~pyce~dy~~~fgvkc~~c~~fisgkvLqa  209 (670)
T KOG1044|consen  131 YGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVL-NGEYMSKDGVPYCEKDYQAKFGVKCEECEKFISGKVLQA  209 (670)
T ss_pred             cCCccccchhhhhhccceeeeeccceeeeeeehhhhcccc-cceeeccCCCcchhhhhhhhcCeehHHhhhhhhhhhhhc
Confidence            4567899999999 68999999999999999999999988 778999999999999999999999999999999999999


Q ss_pred             CCCeecccCcccccCCCccCC
Q psy3656         159 LEKTWHTEHFFCAQCGKQFGE  179 (185)
Q Consensus       159 ~~~~~H~~Cf~C~~C~~~l~~  179 (185)
                      .|+.|||.|-+|++|+.+|++
T Consensus       210 g~kh~HPtCARCsRCgqmF~e  230 (670)
T KOG1044|consen  210 GDKHFHPTCARCSRCGQMFGE  230 (670)
T ss_pred             cCcccCcchhhhhhhcccccc
Confidence            999999999999999999943


No 5  
>KOG2272|consensus
Probab=99.77  E-value=6.5e-21  Score=144.64  Aligned_cols=101  Identities=29%  Similarity=0.785  Sum_probs=93.7

Q ss_pred             Ccccccccccc--cceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEEeCC
Q psy3656          83 GCCSSCDKPIV--GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVTALE  160 (185)
Q Consensus        83 ~~C~~C~~~i~--~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~~~~  160 (185)
                      -.|..|.....  ..++...|..||..||.|..|-.++.++.|+..+|+.||+.+|..+|+|.|..|++.|.|++|.+++
T Consensus        13 ~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiGrVikamn   92 (332)
T KOG2272|consen   13 MVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIGRVIKAMN   92 (332)
T ss_pred             HHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchhhHHHHhhc
Confidence            35888988773  4578899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeecccCcccccCCCccCCCCee
Q psy3656         161 KTWHTEHFFCAQCGKQFGEAMVK  183 (185)
Q Consensus       161 ~~~H~~Cf~C~~C~~~l~~~~~~  183 (185)
                      ..|||.||+|..|++.|.+.+|+
T Consensus        93 nSwHp~CF~Cd~Cn~~Lad~gf~  115 (332)
T KOG2272|consen   93 NSWHPACFRCDLCNKHLADQGFY  115 (332)
T ss_pred             cccCcccchhHHHHHHHhhhhhH
Confidence            99999999999999999877763


No 6  
>KOG2272|consensus
Probab=99.75  E-value=4.5e-20  Score=140.09  Aligned_cols=105  Identities=36%  Similarity=0.800  Sum_probs=98.0

Q ss_pred             CCCCCCCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceE
Q psy3656          77 VTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCV  156 (185)
Q Consensus        77 ~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~  156 (185)
                      ....+.++|..|.++|..+++.++|+-||.+.|+|+.|.+++.+-+.|.+.|..||+.||.++||..|..|++.|-|.++
T Consensus       190 hD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G~vv  269 (332)
T KOG2272|consen  190 HDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGGDVV  269 (332)
T ss_pred             ccccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCccHH
Confidence            33456789999999999889999999999999999999999988899999999999999999999999999999999999


Q ss_pred             EeCCCeecccCcccccCCCccCCCC
Q psy3656         157 TALEKTWHTEHFFCAQCGKQFGEAM  181 (185)
Q Consensus       157 ~~~~~~~H~~Cf~C~~C~~~l~~~~  181 (185)
                      .|.++.|.++||.|+.|++.|.-..
T Consensus       270 ~al~KawCv~cf~Cs~Cdkkl~~K~  294 (332)
T KOG2272|consen  270 SALNKAWCVECFSCSTCDKKLTQKN  294 (332)
T ss_pred             HHhhhhhcccccccccccccccccc
Confidence            9999999999999999999996544


No 7  
>KOG1703|consensus
Probab=99.73  E-value=7.1e-19  Score=149.69  Aligned_cols=103  Identities=36%  Similarity=0.863  Sum_probs=98.4

Q ss_pred             CCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCccc--CceEEeC
Q psy3656          82 KGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL--DKCVTAL  159 (185)
Q Consensus        82 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~--~~~~~~~  159 (185)
                      .+.|.+|+++|.++.|.+++..||.+||.|..|.+.|....|+..+|.+||+.||+.+++.+|..|.++|.  +..+.++
T Consensus       363 ~p~C~~C~~~i~~~~v~a~~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~~  442 (479)
T KOG1703|consen  363 RPNCKRCLLPILEEGVCALGRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQIEAD  442 (479)
T ss_pred             CccccccCCchHHhHhhhccCeechhceeeecccCCCCCCcccccCCccchhhhHhhhccccchhccchhHhhhhHhhcc
Confidence            47899999999999999999999999999999999999999999999999999999999999999999987  7899999


Q ss_pred             CCeecccCcccccCCCccCCCCeee
Q psy3656         160 EKTWHTEHFFCAQCGKQFGEAMVKF  184 (185)
Q Consensus       160 ~~~~H~~Cf~C~~C~~~l~~~~~~~  184 (185)
                      +..||.+||+|+.|.+.|.++.|++
T Consensus       443 ~~~~h~~~F~c~~c~~~l~~~~~~~  467 (479)
T KOG1703|consen  443 GSPFHGDCFRCANCMKKLTKKTFFE  467 (479)
T ss_pred             CccccccceehhhhhccccCCceee
Confidence            9999999999999999999999876


No 8  
>KOG1703|consensus
Probab=99.66  E-value=2.9e-17  Score=139.89  Aligned_cols=103  Identities=40%  Similarity=0.785  Sum_probs=97.8

Q ss_pred             CCccccccccccc-ceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEEeCC
Q psy3656          82 KGCCSSCDKPIVG-QVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVTALE  160 (185)
Q Consensus        82 ~~~C~~C~~~i~~-~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~~~~  160 (185)
                      .+.|..|...|.+ +.+.++++.||+.+|.|..|...+..+.+...+|.+||..||...+.+.|..|+.+|.+++|.|.+
T Consensus       303 ~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~~  382 (479)
T KOG1703|consen  303 RPLCLSCNQKIRSVKVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCALG  382 (479)
T ss_pred             cccccccccCcccceeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhcc
Confidence            4789999999988 899999999999999999999999888888999999999999999999999999999999999999


Q ss_pred             CeecccCcccccCCCccCCCCeee
Q psy3656         161 KTWHTEHFFCAQCGKQFGEAMVKF  184 (185)
Q Consensus       161 ~~~H~~Cf~C~~C~~~l~~~~~~~  184 (185)
                      +.||++||.|..|++.|.+..|++
T Consensus       383 ~~wH~~cf~C~~C~~~~~~~~~~~  406 (479)
T KOG1703|consen  383 RLWHPECFVCADCGKPLKNSSFFE  406 (479)
T ss_pred             CeechhceeeecccCCCCCCcccc
Confidence            999999999999999998888764


No 9  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.46  E-value=3.5e-14  Score=86.94  Aligned_cols=56  Identities=45%  Similarity=1.172  Sum_probs=50.4

Q ss_pred             cccccccccc-cee-eecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhcc
Q psy3656          85 CSSCDKPIVG-QVI-TALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  140 (185)
Q Consensus        85 C~~C~~~i~~-~~~-~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~  140 (185)
                      |..|+++|.+ +.+ .++|+.||.+||+|..|+..|....++..+|++||+.||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            7899999964 443 6999999999999999999999888999999999999999876


No 10 
>KOG1044|consensus
Probab=99.39  E-value=3.9e-13  Score=112.86  Aligned_cols=91  Identities=26%  Similarity=0.599  Sum_probs=79.3

Q ss_pred             CCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEEeCCC
Q psy3656          82 KGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVTALEK  161 (185)
Q Consensus        82 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~~~~~  161 (185)
                      ...|..|.+.-.++++.+.++.||..||.|..|++.|..+.|+..++.        ++++.  ..|.+.|.+++|.++++
T Consensus        16 ~i~c~~c~~kc~gevlrv~d~~fhi~cf~c~~cg~~la~~gff~k~~~--------~~ygt--~~c~~~~~gevvsa~gk   85 (670)
T KOG1044|consen   16 GIKCDKCRKKCSGEVLRVNDNHFHINCFQCKKCGRNLAEGGFFTKPEN--------RLYGT--DDCRAFVEGEVVSTLGK   85 (670)
T ss_pred             ceehhhhCCccccceeEeeccccceeeeeccccCCCcccccceecccc--------eeecc--cchhhhccceeEecccc
Confidence            457999999999999999999999999999999999998888866554        34444  67899999999999999


Q ss_pred             eecccCcccccCCCcc-CCCCe
Q psy3656         162 TWHTEHFFCAQCGKQF-GEAMV  182 (185)
Q Consensus       162 ~~H~~Cf~C~~C~~~l-~~~~~  182 (185)
                      .||++||.|+.|..++ .+++.
T Consensus        86 tyh~~cf~cs~ck~pf~~g~~v  107 (670)
T KOG1044|consen   86 TYHPKCFSCSTCKSPFKSGDKV  107 (670)
T ss_pred             eeccccceecccCCCCCCCCee
Confidence            9999999999999998 55443


No 11 
>KOG1700|consensus
Probab=99.36  E-value=1.2e-13  Score=104.85  Aligned_cols=102  Identities=25%  Similarity=0.603  Sum_probs=87.9

Q ss_pred             CCcccccccccc-cceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCC------------------
Q psy3656          82 KGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSP------------------  142 (185)
Q Consensus        82 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~------------------  142 (185)
                      ...|..|++.|+ .+.+..+|..||..||+|..|...|....+..+++.+||+.+|...+++                  
T Consensus         7 ~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGKD   86 (200)
T ss_pred             cchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCcc
Confidence            357999999995 6777799999999999999999999988999999999999977666654                  


Q ss_pred             -----------------------CCCccCCcccC-ceEEeCCCeecccCcccccCCCccCCCCee
Q psy3656         143 -----------------------RCSYCNGPILD-KCVTALEKTWHTEHFFCAQCGKQFGEAMVK  183 (185)
Q Consensus       143 -----------------------~C~~C~~~i~~-~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~  183 (185)
                                             .|..|.+.+.+ +.+...+..||..||+|+.|++.|....|.
T Consensus        87 ~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~  151 (200)
T KOG1700|consen   87 GKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYA  151 (200)
T ss_pred             cccccccccccchhHHhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchh
Confidence                                   39999998874 566788999999999999999999766553


No 12 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.02  E-value=2.8e-10  Score=69.41  Aligned_cols=41  Identities=34%  Similarity=0.790  Sum_probs=35.4

Q ss_pred             CCccCCcccCceE--EeCCCeecccCcccccCCCccCCCCeee
Q psy3656         144 CSYCNGPILDKCV--TALEKTWHTEHFFCAQCGKQFGEAMVKF  184 (185)
Q Consensus       144 C~~C~~~i~~~~~--~~~~~~~H~~Cf~C~~C~~~l~~~~~~~  184 (185)
                      |..|+++|.+..+  .+.++.||++||+|..|++.|.+..|+.
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~   43 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYE   43 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEE
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEe
Confidence            7899999996433  5999999999999999999998887653


No 13 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.95  E-value=5.5e-10  Score=62.31  Aligned_cols=36  Identities=44%  Similarity=1.018  Sum_probs=33.0

Q ss_pred             CCCccCCcccC--ceEEeCCCeecccCcccccCCCccC
Q psy3656         143 RCSYCNGPILD--KCVTALEKTWHTEHFFCAQCGKQFG  178 (185)
Q Consensus       143 ~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~l~  178 (185)
                      +|..|+++|.+  ..+.+.++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            58999999997  6778999999999999999999985


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.55  E-value=5.4e-08  Score=54.04  Aligned_cols=36  Identities=56%  Similarity=1.238  Sum_probs=32.1

Q ss_pred             ccccccccccc--ceeeecCcccccCCccCCCCCCCCC
Q psy3656          84 CCSSCDKPIVG--QVITALGKTWHPEHFICTHCNQELG  119 (185)
Q Consensus        84 ~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~L~  119 (185)
                      +|..|++.|.+  ..+.+.++.||..||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            48999999965  6788999999999999999999884


No 15 
>KOG4577|consensus
Probab=98.13  E-value=4.6e-07  Score=70.91  Aligned_cols=64  Identities=31%  Similarity=0.644  Sum_probs=52.2

Q ss_pred             CCcccccccccc-ccee-eecCcccccCCccCCCCCCCCCCC-Cee-eeCCcCCCccchhhccCCCCC
Q psy3656          82 KGCCSSCDKPIV-GQVI-TALGKTWHPEHFICTHCNQELGTR-NFF-ERDSRPYCEPDYHNLFSPRCS  145 (185)
Q Consensus        82 ~~~C~~C~~~i~-~~~~-~~~~~~~H~~Cf~C~~C~~~L~~~-~~~-~~~g~~yC~~~~~~~~~~~C~  145 (185)
                      ..+|..|...|. .++| .+.+..||..||.|..|.++|..+ +|| ..++++.|+++|+..-..-|.
T Consensus        92 GTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~~  159 (383)
T KOG4577|consen   92 GTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHCN  159 (383)
T ss_pred             CCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhcccc
Confidence            358999999994 5554 588999999999999999999844 676 788999999999875545453


No 16 
>KOG1700|consensus
Probab=98.11  E-value=7.3e-07  Score=67.84  Aligned_cols=61  Identities=30%  Similarity=0.692  Sum_probs=54.4

Q ss_pred             CCCCcccccccccc-cceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhcc
Q psy3656          80 TQKGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  140 (185)
Q Consensus        80 ~~~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~  140 (185)
                      .....|..|++.++ .+.+...+..||..||+|..|+..|....+...++.+||..++..+|
T Consensus       106 g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~  167 (200)
T KOG1700|consen  106 GEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLF  167 (200)
T ss_pred             ccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhheee
Confidence            33578999999996 68899999999999999999999999999999999999998877655


No 17 
>KOG0490|consensus
Probab=97.97  E-value=1.1e-06  Score=68.16  Aligned_cols=96  Identities=30%  Similarity=0.701  Sum_probs=76.0

Q ss_pred             cccccccc-eeeecCcccccCCccCCCCCCCCC-CCCeeeeCCcCCCccchhh--ccCCCCCccCCccc--CceEEeCCC
Q psy3656          88 CDKPIVGQ-VITALGKTWHPEHFICTHCNQELG-TRNFFERDSRPYCEPDYHN--LFSPRCSYCNGPIL--DKCVTALEK  161 (185)
Q Consensus        88 C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~L~-~~~~~~~~g~~yC~~~~~~--~~~~~C~~C~~~i~--~~~~~~~~~  161 (185)
                      |+..|.+. .+...+..||..|.+|..|...|. ....+..+|..||..+|.+  .+..+|..|...|.  ++...+.++
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~~ler~f~~   81 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKFSKRCARCKFTISQLDELERAFEK   81 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchhhhhccccccCCCCCcCHHHHHHHhhcC
Confidence            55666543 345669999999999999999996 2344444999999999998  78899999999985  455667788


Q ss_pred             eecccCcccccCCCcc-CCCCeee
Q psy3656         162 TWHTEHFFCAQCGKQF-GEAMVKF  184 (185)
Q Consensus       162 ~~H~~Cf~C~~C~~~l-~~~~~~~  184 (185)
                      + |-.||.|..|...+ .++++.+
T Consensus        82 ~-h~Pd~~~r~~la~~~~~~e~rV  104 (235)
T KOG0490|consen   82 V-HLPCFACRECLALLLTGDEFRV  104 (235)
T ss_pred             C-CcCccchHHHHhhcCCCCeeee
Confidence            8 99999999999866 6666544


No 18 
>KOG1702|consensus
Probab=97.95  E-value=1.2e-06  Score=65.56  Aligned_cols=58  Identities=29%  Similarity=0.707  Sum_probs=51.9

Q ss_pred             Ccccccccccc-cceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhcc
Q psy3656          83 GCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  140 (185)
Q Consensus        83 ~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~  140 (185)
                      .-|..|++.++ .+.+..+++.||..||+|..|+.+|...++...+.++||..+|....
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~   63 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQV   63 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccce
Confidence            45889999995 68899999999999999999999999888889999999999997543


No 19 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=94.92  E-value=0.02  Score=33.98  Aligned_cols=38  Identities=24%  Similarity=0.581  Sum_probs=29.0

Q ss_pred             cCCCCCccCCccc--CceEE--eCCCeecccCc----cccc--CCCcc
Q psy3656         140 FSPRCSYCNGPIL--DKCVT--ALEKTWHTEHF----FCAQ--CGKQF  177 (185)
Q Consensus       140 ~~~~C~~C~~~i~--~~~~~--~~~~~~H~~Cf----~C~~--C~~~l  177 (185)
                      .+.+|..|++.|.  +.+|.  .-+..||.+|+    .|..  |+..+
T Consensus         4 ~~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~~g~C~~~~c~~~~   51 (54)
T PF14446_consen    4 EGCKCPVCGKKFKDGDDIVVCPECGAPYHRDCWEKAGGCINYSCGTGF   51 (54)
T ss_pred             cCccChhhCCcccCCCCEEECCCCCCcccHHHHhhCCceEeccCCCCc
Confidence            3588999999995  45554  45799999999    4877  76654


No 20 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=90.48  E-value=0.33  Score=29.89  Aligned_cols=49  Identities=14%  Similarity=0.369  Sum_probs=23.0

Q ss_pred             ccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccCceEE
Q psy3656         109 FICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDKCVT  157 (185)
Q Consensus       109 f~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~~~  157 (185)
                      ++|+.|..-|..--....=...||..|-...++..|.+|+.|...+.+.
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~qD~~   56 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQDIQ   56 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-SS--
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHHHHH
Confidence            4677777766432223555678899998888888899999987655444


No 21 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=86.91  E-value=0.45  Score=25.96  Aligned_cols=28  Identities=29%  Similarity=0.523  Sum_probs=21.0

Q ss_pred             CCccCCcccCc--eEEeCCCeecccCcccc
Q psy3656         144 CSYCNGPILDK--CVTALEKTWHTEHFFCA  171 (185)
Q Consensus       144 C~~C~~~i~~~--~~~~~~~~~H~~Cf~C~  171 (185)
                      |.-|++.|.++  .+...++.||--|=.|.
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC~tC~   30 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCCPTCL   30 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEECHHHH
Confidence            77899999865  45678999996665553


No 22 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=85.56  E-value=0.25  Score=33.26  Aligned_cols=28  Identities=29%  Similarity=0.443  Sum_probs=21.9

Q ss_pred             CCCccCCccc-CceEEe-CCCeecccCccc
Q psy3656         143 RCSYCNGPIL-DKCVTA-LEKTWHTEHFFC  170 (185)
Q Consensus       143 ~C~~C~~~i~-~~~~~~-~~~~~H~~Cf~C  170 (185)
                      +|..|+++|. |+..++ .+..-|-+||+=
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~   33 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFRE   33 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHH
Confidence            6999999997 666664 457889999863


No 23 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=85.51  E-value=0.77  Score=30.78  Aligned_cols=28  Identities=21%  Similarity=0.373  Sum_probs=17.0

Q ss_pred             CCCCccCCcccCc-eEEe-CCCeecccCcc
Q psy3656         142 PRCSYCNGPILDK-CVTA-LEKTWHTEHFF  169 (185)
Q Consensus       142 ~~C~~C~~~i~~~-~~~~-~~~~~H~~Cf~  169 (185)
                      ..|..|+++|... ++.+ .|..+|-.|++
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CCccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            5577777777643 3333 35667777753


No 24 
>KOG0320|consensus
Probab=84.25  E-value=0.35  Score=35.90  Aligned_cols=48  Identities=13%  Similarity=0.394  Sum_probs=37.2

Q ss_pred             cCCccCCCCCCCCCCCC-eeeeCCcCCCccchhhc--cCCCCCccCCcccC
Q psy3656         106 PEHFICTHCNQELGTRN-FFERDSRPYCEPDYHNL--FSPRCSYCNGPILD  153 (185)
Q Consensus       106 ~~Cf~C~~C~~~L~~~~-~~~~~g~~yC~~~~~~~--~~~~C~~C~~~i~~  153 (185)
                      ..+|+|..|-....... +...-|++||..|-...  .+.+|..|++.|..
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            45689999977775443 55788999999998754  45899999998864


No 25 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=82.93  E-value=0.84  Score=30.12  Aligned_cols=36  Identities=25%  Similarity=0.599  Sum_probs=25.1

Q ss_pred             cCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccC
Q psy3656         110 ICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD  153 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~  153 (185)
                      +|..|...+.      ..|..||..|-.++  .+|+-|++.|++
T Consensus        46 ~C~~CK~~v~------q~g~~YCq~CAYkk--GiCamCGKki~d   81 (90)
T PF10235_consen   46 KCKICKTKVH------QPGAKYCQTCAYKK--GICAMCGKKILD   81 (90)
T ss_pred             cccccccccc------cCCCccChhhhccc--CcccccCCeecc
Confidence            5666666552      22567999995543  689999999864


No 26 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=82.05  E-value=1.3  Score=29.59  Aligned_cols=32  Identities=28%  Similarity=0.453  Sum_probs=19.8

Q ss_pred             CCCCCcccccccccccc--eeeecCcccccCCcc
Q psy3656          79 TTQKGCCSSCDKPIVGQ--VITALGKTWHPEHFI  110 (185)
Q Consensus        79 ~~~~~~C~~C~~~i~~~--~~~~~~~~~H~~Cf~  110 (185)
                      ......|..|++.|...  .+--.|..+|..|++
T Consensus        75 i~~~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   75 ITESTKCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             ECCCCCccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            34456788888888432  233446677777753


No 27 
>KOG1813|consensus
Probab=80.77  E-value=0.83  Score=36.63  Aligned_cols=47  Identities=17%  Similarity=0.388  Sum_probs=37.0

Q ss_pred             CCccCCCCCCCCCCCCeeeeCCcCCCccchhhccC--CCCCccCCcccCc
Q psy3656         107 EHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFS--PRCSYCNGPILDK  154 (185)
Q Consensus       107 ~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~--~~C~~C~~~i~~~  154 (185)
                      --|.|..|.... -..+...-+..+|+.|....|.  ++|..|++.+.|.
T Consensus       240 ~Pf~c~icr~~f-~~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~  288 (313)
T KOG1813|consen  240 LPFKCFICRKYF-YRPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHGS  288 (313)
T ss_pred             CCcccccccccc-ccchhhcCCceeehhhhccccccCCcceecccccccc
Confidence            347888998877 3456677788899999887664  7899999998874


No 28 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=78.67  E-value=0.39  Score=36.28  Aligned_cols=51  Identities=12%  Similarity=0.380  Sum_probs=39.0

Q ss_pred             cCCccCCCCCCCCCCCCeeeeCCcCCCccchhhcc--CCCCCccCCcccCceEE
Q psy3656         106 PEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF--SPRCSYCNGPILDKCVT  157 (185)
Q Consensus       106 ~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~--~~~C~~C~~~i~~~~~~  157 (185)
                      ..-|.|..|..... ..+...-|..||..|+.+.+  ++.|..|++...|..-+
T Consensus       194 ~IPF~C~iCKkdy~-spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~f~V  246 (259)
T COG5152         194 KIPFLCGICKKDYE-SPVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGRFWV  246 (259)
T ss_pred             CCceeehhchhhcc-chhhhhcchhHHHHHHHHHhccCCcceecchhhccceeH
Confidence            34589999988773 34566778889999998776  48899999987776443


No 29 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=77.93  E-value=1.8  Score=25.88  Aligned_cols=44  Identities=9%  Similarity=0.192  Sum_probs=30.5

Q ss_pred             ccCCCCCCCCCCCCeeeeCCcCCCccchhhcc--CCCCCccCCcccC
Q psy3656         109 FICTHCNQELGTRNFFERDSRPYCEPDYHNLF--SPRCSYCNGPILD  153 (185)
Q Consensus       109 f~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~--~~~C~~C~~~i~~  153 (185)
                      |.|..|...+.. .+....|..||+.+..+.+  ...|..|++++..
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCCh
Confidence            467777777643 4666778889988766433  3578888887753


No 30 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=76.28  E-value=0.77  Score=23.54  Aligned_cols=27  Identities=15%  Similarity=0.214  Sum_probs=13.0

Q ss_pred             CCCCCccCCcccCceEEeCCCeecccC
Q psy3656         141 SPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       141 ~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      |.+|..|...|....+..+...|-+.|
T Consensus         1 G~~C~rC~~~~~~~~~~~r~~~~C~rC   27 (30)
T PF06827_consen    1 GEKCPRCWNYIEDIGINGRSTYLCPRC   27 (30)
T ss_dssp             TSB-TTT--BBEEEEETTEEEEE-TTT
T ss_pred             CCcCccCCCcceEeEecCCCCeECcCC
Confidence            467888888877554433334444444


No 31 
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=75.35  E-value=0.33  Score=28.96  Aligned_cols=17  Identities=24%  Similarity=0.884  Sum_probs=13.9

Q ss_pred             ccccCCCccCCCCeeeC
Q psy3656         169 FCAQCGKQFGEAMVKFI  185 (185)
Q Consensus       169 ~C~~C~~~l~~~~~~~~  185 (185)
                      .|++|++-|++++|.+|
T Consensus         6 vCSTCGrDlSeeRy~Ll   22 (63)
T PF05864_consen    6 VCSTCGRDLSEERYRLL   22 (63)
T ss_pred             eecccCCcchHHHHHHH
Confidence            58899999999888754


No 32 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=75.14  E-value=1.4  Score=29.04  Aligned_cols=32  Identities=25%  Similarity=0.472  Sum_probs=21.8

Q ss_pred             hhhccCCCCCccCCcc--c---CceEE---eCC-CeecccC
Q psy3656         136 YHNLFSPRCSYCNGPI--L---DKCVT---ALE-KTWHTEH  167 (185)
Q Consensus       136 ~~~~~~~~C~~C~~~i--~---~~~~~---~~~-~~~H~~C  167 (185)
                      |..+|...|.+|++.+  .   +...+   ... ..||+.|
T Consensus        49 Y~~lfs~pC~~C~klL~~~~~LPP~~r~~~~~~~~ayH~~C   89 (90)
T PF11571_consen   49 YRNLFSTPCKKCGKLLSSKAFLPPVRRPKDFRSWEAYHEGC   89 (90)
T ss_pred             HhhhccchhhHHHhHhhhcccCCCeeecccCCCCcccCccc
Confidence            6778888999999988  2   22333   222 5888887


No 33 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=74.70  E-value=2.3  Score=38.34  Aligned_cols=48  Identities=27%  Similarity=0.580  Sum_probs=34.8

Q ss_pred             CcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCc
Q psy3656          83 GCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGP  150 (185)
Q Consensus        83 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~  150 (185)
                      -.|..|+..+                 +|..|+.+|.   |....+.+.|.-|-......+|..|+..
T Consensus       384 l~C~~Cg~~~-----------------~C~~C~~~L~---~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        384 LACARCRTPA-----------------RCRHCTGPLG---LPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             eEhhhCcCee-----------------ECCCCCCcee---EecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            4677777655                 7888888772   3345667889988665556789999875


No 34 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=74.66  E-value=1.4  Score=23.82  Aligned_cols=23  Identities=26%  Similarity=0.589  Sum_probs=15.8

Q ss_pred             cCCCCCCCCCCCCeeeeCCcCCCccch
Q psy3656         110 ICTHCNQELGTRNFFERDSRPYCEPDY  136 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~yC~~~~  136 (185)
                      .|..|+..    .+...+|..||..|-
T Consensus        10 ~C~~C~~~----~~~~~dG~~yC~~cG   32 (36)
T PF11781_consen   10 PCPVCGSR----WFYSDDGFYYCDRCG   32 (36)
T ss_pred             cCCCCCCe----EeEccCCEEEhhhCc
Confidence            46667654    366888888887663


No 35 
>PF12773 DZR:  Double zinc ribbon
Probab=73.69  E-value=3.8  Score=23.45  Aligned_cols=6  Identities=33%  Similarity=1.270  Sum_probs=2.4

Q ss_pred             CCccCC
Q psy3656         144 CSYCNG  149 (185)
Q Consensus       144 C~~C~~  149 (185)
                      |..|+.
T Consensus        32 C~~Cg~   37 (50)
T PF12773_consen   32 CPNCGA   37 (50)
T ss_pred             CcCCcC
Confidence            444443


No 36 
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=73.18  E-value=0.39  Score=28.66  Aligned_cols=17  Identities=24%  Similarity=0.884  Sum_probs=13.9

Q ss_pred             ccccCCCccCCCCeeeC
Q psy3656         169 FCAQCGKQFGEAMVKFI  185 (185)
Q Consensus       169 ~C~~C~~~l~~~~~~~~  185 (185)
                      .|++|++-|++++|.+|
T Consensus         6 VCsTCGrDlSeeRy~Ll   22 (63)
T PHA03082          6 VCSTCGRDLSEERYRLL   22 (63)
T ss_pred             eecccCcchhHHHHHHH
Confidence            58899999999888753


No 37 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=72.33  E-value=2.7  Score=25.13  Aligned_cols=39  Identities=10%  Similarity=0.117  Sum_probs=30.1

Q ss_pred             CCCccCCcccCceEEeCCCeecccCcc--------cccCCCccCCCC
Q psy3656         143 RCSYCNGPILDKCVTALEKTWHTEHFF--------CAQCGKQFGEAM  181 (185)
Q Consensus       143 ~C~~C~~~i~~~~~~~~~~~~H~~Cf~--------C~~C~~~l~~~~  181 (185)
                      .|..|++.+.+.++...|++|-.+|+.        |..|+..|+.+.
T Consensus         3 ~Cpi~~~~~~~Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~~   49 (63)
T smart00504        3 LCPISLEVMKDPVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTHED   49 (63)
T ss_pred             CCcCCCCcCCCCEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCChhh
Confidence            588899988877777778888877654        888888886544


No 38 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=72.17  E-value=1.2  Score=28.57  Aligned_cols=32  Identities=28%  Similarity=0.451  Sum_probs=19.3

Q ss_pred             hccCCCCCccCCcccCc------eEEeCC------CeecccCcc
Q psy3656         138 NLFSPRCSYCNGPILDK------CVTALE------KTWHTEHFF  169 (185)
Q Consensus       138 ~~~~~~C~~C~~~i~~~------~~~~~~------~~~H~~Cf~  169 (185)
                      +.-..+|..|++.|.-.      .+....      .=||.+||.
T Consensus         4 ks~Ra~Ck~C~~~I~kg~lRiG~~~~~~~~~~~~~~W~H~~C~~   47 (82)
T PF00645_consen    4 KSGRAKCKGCKKKIAKGELRIGKIVPSPEGDGDIPKWYHWDCFF   47 (82)
T ss_dssp             SSSTEBETTTSCBE-TTSEEEEEEEEETTSSCEEEEEEEHHHHH
T ss_pred             CCCCccCcccCCcCCCCCEEEEEEecccccCCCCCceECccccc
Confidence            33346899999999732      222222      367888886


No 39 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=70.28  E-value=1.9  Score=27.04  Aligned_cols=51  Identities=22%  Similarity=0.511  Sum_probs=22.4

Q ss_pred             CcCCCccchhhc-cCCCCCccCCcccCceEEeCCCeecccCcccccCCCccCCCCeee
Q psy3656         128 SRPYCEPDYHNL-FSPRCSYCNGPILDKCVTALEKTWHTEHFFCAQCGKQFGEAMVKF  184 (185)
Q Consensus       128 g~~yC~~~~~~~-~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~  184 (185)
                      +..+|..|.... ....|..|++++.  .|.|-|.+    =|.|..|+..++-.+..|
T Consensus        16 ~~~~C~~C~~~~~~~a~CPdC~~~Le--~LkACGAv----dYFC~~c~gLiSKkrV~f   67 (70)
T PF07191_consen   16 GHYHCEACQKDYKKEAFCPDCGQPLE--VLKACGAV----DYFCNHCHGLISKKRVRF   67 (70)
T ss_dssp             TEEEETTT--EEEEEEE-TTT-SB-E--EEEETTEE----EEE-TTTT-EE-TTTSEE
T ss_pred             CEEECccccccceecccCCCcccHHH--HHHHhccc----ceeeccCCceeecceEEE
Confidence            444555443221 1256777777764  45554421    145777777776665544


No 40 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=69.93  E-value=2  Score=31.24  Aligned_cols=50  Identities=22%  Similarity=0.577  Sum_probs=33.4

Q ss_pred             eCCcCCCccchhhccCCCCCccCCcccCce----EEeCCCeecccCcccccCCCcc
Q psy3656         126 RDSRPYCEPDYHNLFSPRCSYCNGPILDKC----VTALEKTWHTEHFFCAQCGKQF  177 (185)
Q Consensus       126 ~~g~~yC~~~~~~~~~~~C~~C~~~i~~~~----~~~~~~~~H~~Cf~C~~C~~~l  177 (185)
                      .-..-||..|-.+.. ..|..|+-+|.|.+    +...+..|++-- -|..|++++
T Consensus        25 ~~~~~fC~kCG~~tI-~~Cp~C~~~IrG~y~v~gv~~~g~~~~~Ps-YC~~CGkpy   78 (158)
T PF10083_consen   25 ELREKFCSKCGAKTI-TSCPNCSTPIRGDYHVEGVFGLGGHYEAPS-YCHNCGKPY   78 (158)
T ss_pred             hHHHHHHHHhhHHHH-HHCcCCCCCCCCceecCCeeeeCCCCCCCh-hHHhCCCCC
Confidence            445678888876655 78999999999753    233456666322 277777765


No 41 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=69.91  E-value=2.9  Score=24.00  Aligned_cols=42  Identities=21%  Similarity=0.475  Sum_probs=27.7

Q ss_pred             cCCCCCCCCCCCCeeeeCCcC-CCccchhhcc--CCCCCccCCccc
Q psy3656         110 ICTHCNQELGTRNFFERDSRP-YCEPDYHNLF--SPRCSYCNGPIL  152 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~-yC~~~~~~~~--~~~C~~C~~~i~  152 (185)
                      .|..|..... ...+..=|.. +|..|+.+.+  ..+|..|.++|.
T Consensus         4 ~C~iC~~~~~-~~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPR-DVVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBS-SEEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCC-ceEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            4555655542 2344667777 8999987663  588999999885


No 42 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=69.68  E-value=3.6  Score=35.87  Aligned_cols=38  Identities=16%  Similarity=0.523  Sum_probs=27.0

Q ss_pred             cCCCCCCCCCCCCeeeeCCcCCCccchhh-ccCCCCCccCCc
Q psy3656         110 ICTHCNQELGTRNFFERDSRPYCEPDYHN-LFSPRCSYCNGP  150 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~yC~~~~~~-~~~~~C~~C~~~  150 (185)
                      +|..|+..|   .|....+.+.|..|-.. .+...|..|+..
T Consensus       224 ~C~~C~~~l---~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       224 CCPNCDVSL---TYHKKEGKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             CCCCCCCce---EEecCCCeEEcCCCcCcCCCCCCCCCCCCC
Confidence            677777766   34556778889888543 445789999874


No 43 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=66.81  E-value=3.9  Score=19.66  Aligned_cols=8  Identities=38%  Similarity=1.099  Sum_probs=3.1

Q ss_pred             CCccCCcc
Q psy3656         144 CSYCNGPI  151 (185)
Q Consensus       144 C~~C~~~i  151 (185)
                      |..|+..|
T Consensus         2 Cp~CG~~~    9 (23)
T PF13240_consen    2 CPNCGAEI    9 (23)
T ss_pred             CcccCCCC
Confidence            33344433


No 44 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=66.42  E-value=4.3  Score=22.65  Aligned_cols=39  Identities=23%  Similarity=0.533  Sum_probs=23.7

Q ss_pred             CCCCCCCCC--CCCeeeeCCcCCCccchhhcc--CCCCCccCC
Q psy3656         111 CTHCNQELG--TRNFFERDSRPYCEPDYHNLF--SPRCSYCNG  149 (185)
Q Consensus       111 C~~C~~~L~--~~~~~~~~g~~yC~~~~~~~~--~~~C~~C~~  149 (185)
                      |..|.....  ...+...=|..+|..|..+..  ...|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            445555552  122336667888888877766  466777753


No 45 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=64.91  E-value=4.7  Score=22.46  Aligned_cols=10  Identities=30%  Similarity=0.946  Sum_probs=4.8

Q ss_pred             eeCCcCCCcc
Q psy3656         125 ERDSRPYCEP  134 (185)
Q Consensus       125 ~~~g~~yC~~  134 (185)
                      .++|+.||-.
T Consensus        30 ~k~g~~~Cv~   39 (41)
T PF06677_consen   30 DKDGKIYCVS   39 (41)
T ss_pred             ecCCCEECCC
Confidence            3455555543


No 46 
>KOG4443|consensus
Probab=63.40  E-value=4.5  Score=36.04  Aligned_cols=21  Identities=14%  Similarity=0.169  Sum_probs=14.3

Q ss_pred             CCCeecccCcccccCCCccCC
Q psy3656         159 LEKTWHTEHFFCAQCGKQFGE  179 (185)
Q Consensus       159 ~~~~~H~~Cf~C~~C~~~l~~  179 (185)
                      .+..+.++||+|-.|+..|.+
T Consensus       107 sg~~~ckk~~~c~qc~~~lpg  127 (694)
T KOG4443|consen  107 SGPWLCKKCTRCRQCDSTLPG  127 (694)
T ss_pred             CcccccHHHHhhhhccccccc
Confidence            456667777777777776643


No 47 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=63.15  E-value=3.6  Score=24.06  Aligned_cols=29  Identities=24%  Similarity=0.538  Sum_probs=20.0

Q ss_pred             cCCCCCCCCCCC-CeeeeCCcCCCccchhhc
Q psy3656         110 ICTHCNQELGTR-NFFERDSRPYCEPDYHNL  139 (185)
Q Consensus       110 ~C~~C~~~L~~~-~~~~~~g~~yC~~~~~~~  139 (185)
                      .|..|+..++.- .+...+| ..|..|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            477888877643 3557777 5788888664


No 48 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=62.80  E-value=2.3  Score=28.17  Aligned_cols=34  Identities=24%  Similarity=0.327  Sum_probs=23.7

Q ss_pred             CCCCccCCccc-CceEEe-CCCeecccCcccccCCC
Q psy3656         142 PRCSYCNGPIL-DKCVTA-LEKTWHTEHFFCAQCGK  175 (185)
Q Consensus       142 ~~C~~C~~~i~-~~~~~~-~~~~~H~~Cf~C~~C~~  175 (185)
                      -+|++|++.|. |+..++ ....-|-+||.=+.=++
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~~~k   42 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAESKRKK   42 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHHHHhcC
Confidence            37999999886 666654 45678888887554333


No 49 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=62.26  E-value=4.2  Score=21.82  Aligned_cols=24  Identities=17%  Similarity=0.573  Sum_probs=11.5

Q ss_pred             CCcCCCccchhhcc---CCCCCccCCc
Q psy3656         127 DSRPYCEPDYHNLF---SPRCSYCNGP  150 (185)
Q Consensus       127 ~g~~yC~~~~~~~~---~~~C~~C~~~  150 (185)
                      =|..||..|..+.+   ..+|..|+..
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            45555655554322   2345555543


No 50 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=61.66  E-value=4.9  Score=28.43  Aligned_cols=21  Identities=29%  Similarity=0.770  Sum_probs=12.4

Q ss_pred             CCCCCCCCCCCCeeeeCCcCCCccch
Q psy3656         111 CTHCNQELGTRNFFERDSRPYCEPDY  136 (185)
Q Consensus       111 C~~C~~~L~~~~~~~~~g~~yC~~~~  136 (185)
                      |..|+.+|    | ..+|.+||.-|-
T Consensus        31 Cp~Cg~PL----F-~KdG~v~CPvC~   51 (131)
T COG1645          31 CPKCGTPL----F-RKDGEVFCPVCG   51 (131)
T ss_pred             CcccCCcc----e-eeCCeEECCCCC
Confidence            55566655    2 367777776553


No 51 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=60.32  E-value=8.7  Score=29.11  Aligned_cols=12  Identities=25%  Similarity=1.021  Sum_probs=9.9

Q ss_pred             CCCCccCCcccC
Q psy3656         142 PRCSYCNGPILD  153 (185)
Q Consensus       142 ~~C~~C~~~i~~  153 (185)
                      .+|..|...|..
T Consensus        69 ~~CPvCR~~Is~   80 (193)
T PLN03208         69 PKCPVCKSDVSE   80 (193)
T ss_pred             CcCCCCCCcCCh
Confidence            679999998864


No 52 
>KOG2462|consensus
Probab=60.30  E-value=5.5  Score=31.76  Aligned_cols=37  Identities=24%  Similarity=0.631  Sum_probs=22.4

Q ss_pred             CCCccCCcccCc-eEEe-CCCeecccCcccccCCCccCC
Q psy3656         143 RCSYCNGPILDK-CVTA-LEKTWHTEHFFCAQCGKQFGE  179 (185)
Q Consensus       143 ~C~~C~~~i~~~-~~~~-~~~~~H~~Cf~C~~C~~~l~~  179 (185)
                      .|..|++...++ -|+| +...=+.+=|.|..|+|.|..
T Consensus       217 ~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl  255 (279)
T KOG2462|consen  217 SCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFAL  255 (279)
T ss_pred             cCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHH
Confidence            488888877764 2222 222333456788888887653


No 53 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=59.41  E-value=6.5  Score=23.27  Aligned_cols=24  Identities=29%  Similarity=0.443  Sum_probs=17.4

Q ss_pred             CCCCccCCcccC-ceEEeCCCeecc
Q psy3656         142 PRCSYCNGPILD-KCVTALEKTWHT  165 (185)
Q Consensus       142 ~~C~~C~~~i~~-~~~~~~~~~~H~  165 (185)
                      .+|.+|+++|.+ ..+...++.-|+
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~   26 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHP   26 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCc
Confidence            479999999986 455555666665


No 54 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=59.28  E-value=6.3  Score=34.24  Aligned_cols=12  Identities=25%  Similarity=0.562  Sum_probs=6.5

Q ss_pred             cCcccccCCCcc
Q psy3656         166 EHFFCAQCGKQF  177 (185)
Q Consensus       166 ~Cf~C~~C~~~l  177 (185)
                      +||.|-.|...|
T Consensus        51 ~Cf~CP~C~~~L   62 (483)
T PF05502_consen   51 NCFDCPICFSPL   62 (483)
T ss_pred             ccccCCCCCCcc
Confidence            555555555554


No 55 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=58.57  E-value=11  Score=34.05  Aligned_cols=49  Identities=16%  Similarity=0.349  Sum_probs=26.1

Q ss_pred             CcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhcc--CCCCCccCCccc
Q psy3656          83 GCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF--SPRCSYCNGPIL  152 (185)
Q Consensus        83 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~--~~~C~~C~~~i~  152 (185)
                      .+|..|+..+....            --|..|+.+|..         ..|..|-...-  ...|..|+..+.
T Consensus         2 ~~Cp~Cg~~n~~~a------------kFC~~CG~~l~~---------~~Cp~CG~~~~~~~~fC~~CG~~~~   52 (645)
T PRK14559          2 LICPQCQFENPNNN------------RFCQKCGTSLTH---------KPCPQCGTEVPVDEAHCPNCGAETG   52 (645)
T ss_pred             CcCCCCCCcCCCCC------------ccccccCCCCCC---------CcCCCCCCCCCcccccccccCCccc
Confidence            35888887763211            135566666631         24666644322  145777777643


No 56 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=57.47  E-value=4.9  Score=30.61  Aligned_cols=31  Identities=16%  Similarity=0.425  Sum_probs=23.5

Q ss_pred             ccCCCCCCCCCCCCeeeeCCcCCCccchhhc
Q psy3656         109 FICTHCNQELGTRNFFERDSRPYCEPDYHNL  139 (185)
Q Consensus       109 f~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~  139 (185)
                      -+|..|+-..........+|++.|..||.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            4777777766555566888999999998754


No 57 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=57.17  E-value=14  Score=22.01  Aligned_cols=43  Identities=16%  Similarity=0.564  Sum_probs=26.4

Q ss_pred             CCCCCCCCCCC---CeeeeCCcCCCccchhhccCCCCCccCCcccC
Q psy3656         111 CTHCNQELGTR---NFFERDSRPYCEPDYHNLFSPRCSYCNGPILD  153 (185)
Q Consensus       111 C~~C~~~L~~~---~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~  153 (185)
                      |..|.+.|...   .+.-.-.=.||.+|....+..+|.-|+..+..
T Consensus         8 CE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGelv~   53 (57)
T PF06906_consen    8 CECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGELVR   53 (57)
T ss_pred             ccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCcccc
Confidence            45555555422   22222334578888888878889999887653


No 58 
>KOG0823|consensus
Probab=55.72  E-value=9.4  Score=29.65  Aligned_cols=50  Identities=16%  Similarity=0.310  Sum_probs=35.7

Q ss_pred             cccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhcc-----CCCCCccCCcccCc
Q psy3656         104 WHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF-----SPRCSYCNGPILDK  154 (185)
Q Consensus       104 ~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~-----~~~C~~C~~~i~~~  154 (185)
                      -....|-|.+|=... ...+...=|+|||..|..+-.     ...|.+|+..|...
T Consensus        43 ~~~~~FdCNICLd~a-kdPVvTlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs~~   97 (230)
T KOG0823|consen   43 RDGGFFDCNICLDLA-KDPVVTLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVSID   97 (230)
T ss_pred             CCCCceeeeeecccc-CCCEEeecccceehHHHHHHHhhcCCCeeCCccccccccc
Confidence            445567888885433 556788899999999976433     25689999888754


No 59 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=52.83  E-value=9.1  Score=18.71  Aligned_cols=10  Identities=40%  Similarity=1.055  Sum_probs=5.6

Q ss_pred             CCccCCcccC
Q psy3656         144 CSYCNGPILD  153 (185)
Q Consensus       144 C~~C~~~i~~  153 (185)
                      |.+|+..|.+
T Consensus         1 C~sC~~~i~~   10 (24)
T PF07754_consen    1 CTSCGRPIAP   10 (24)
T ss_pred             CccCCCcccC
Confidence            4556666554


No 60 
>PRK00420 hypothetical protein; Validated
Probab=52.19  E-value=9.5  Score=26.28  Aligned_cols=10  Identities=30%  Similarity=0.946  Sum_probs=5.5

Q ss_pred             Cccccccccc
Q psy3656          83 GCCSSCDKPI   92 (185)
Q Consensus        83 ~~C~~C~~~i   92 (185)
                      ..|..|+-++
T Consensus        24 ~~CP~Cg~pL   33 (112)
T PRK00420         24 KHCPVCGLPL   33 (112)
T ss_pred             CCCCCCCCcc
Confidence            4466665544


No 61 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=51.56  E-value=11  Score=18.48  Aligned_cols=9  Identities=33%  Similarity=0.988  Sum_probs=5.3

Q ss_pred             ccccccccc
Q psy3656          84 CCSSCDKPI   92 (185)
Q Consensus        84 ~C~~C~~~i   92 (185)
                      .|..|+..|
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            466666654


No 62 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=51.46  E-value=9.5  Score=30.55  Aligned_cols=27  Identities=15%  Similarity=0.255  Sum_probs=22.8

Q ss_pred             CCCCCccCCcccCceEEeCCCeecccC
Q psy3656         141 SPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       141 ~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      ++-|..|+.+|.-..+.=++..|.|.|
T Consensus       245 GepC~~CGt~I~k~~~~gR~t~~CP~C  271 (273)
T COG0266         245 GEPCRRCGTPIEKIKLGGRSTFYCPVC  271 (273)
T ss_pred             CCCCCccCCEeEEEEEcCCcCEeCCCC
Confidence            578999999999777777888888777


No 63 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=50.61  E-value=9.7  Score=33.11  Aligned_cols=37  Identities=16%  Similarity=0.284  Sum_probs=27.8

Q ss_pred             CcccccccccccceeeecCcccccCCccCCCCCCCCC
Q psy3656          83 GCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELG  119 (185)
Q Consensus        83 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~  119 (185)
                      -.|..|-..+...-+...++...++||.|..|...|.
T Consensus        27 ~yCp~CL~~~p~~e~~~~~nrC~r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen   27 YYCPNCLFEVPSSEARSEKNRCSRNCFDCPICFSPLS   63 (483)
T ss_pred             eECccccccCChhhheeccceeccccccCCCCCCcce
Confidence            4577777666433356677888889999999999985


No 64 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=49.99  E-value=14  Score=33.85  Aligned_cols=39  Identities=15%  Similarity=0.392  Sum_probs=29.4

Q ss_pred             ccCCCCCCCCCCCCeeeeCCcCCCccchhh-ccCCCCCccCCc
Q psy3656         109 FICTHCNQELGTRNFFERDSRPYCEPDYHN-LFSPRCSYCNGP  150 (185)
Q Consensus       109 f~C~~C~~~L~~~~~~~~~g~~yC~~~~~~-~~~~~C~~C~~~  150 (185)
                      ++|..|...|   .|....+.+.|..|-.+ .....|..|+..
T Consensus       445 ~~Cp~Cd~~l---t~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         445 AECPNCDSPL---TLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             ccCCCCCcce---EEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            3788888776   45566689999988655 445789999987


No 65 
>KOG2462|consensus
Probab=48.16  E-value=12  Score=29.89  Aligned_cols=14  Identities=43%  Similarity=1.156  Sum_probs=9.2

Q ss_pred             cCcccccCCCccCC
Q psy3656         166 EHFFCAQCGKQFGE  179 (185)
Q Consensus       166 ~Cf~C~~C~~~l~~  179 (185)
                      .=|.|..|+|.|.+
T Consensus       214 KPF~C~hC~kAFAD  227 (279)
T KOG2462|consen  214 KPFSCPHCGKAFAD  227 (279)
T ss_pred             CCccCCcccchhcc
Confidence            34677778777643


No 66 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=47.96  E-value=3.2  Score=22.44  Aligned_cols=27  Identities=15%  Similarity=0.283  Sum_probs=13.7

Q ss_pred             CCCCCCCCCCCeeeeCCcCCCccchhh
Q psy3656         112 THCNQELGTRNFFERDSRPYCEPDYHN  138 (185)
Q Consensus       112 ~~C~~~L~~~~~~~~~g~~yC~~~~~~  138 (185)
                      ..|...+........=|..||..|..+
T Consensus         2 ~iC~~~~~~~~~~~~CGH~fC~~C~~~   28 (39)
T PF13923_consen    2 PICLDELRDPVVVTPCGHSFCKECIEK   28 (39)
T ss_dssp             TTTTSB-SSEEEECTTSEEEEHHHHHH
T ss_pred             CCCCCcccCcCEECCCCCchhHHHHHH
Confidence            445444433223456667777766554


No 67 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=46.95  E-value=7.7  Score=17.96  Aligned_cols=12  Identities=42%  Similarity=1.132  Sum_probs=9.1

Q ss_pred             cccccCCCccCC
Q psy3656         168 FFCAQCGKQFGE  179 (185)
Q Consensus       168 f~C~~C~~~l~~  179 (185)
                      |.|..|++.+..
T Consensus         1 y~C~~C~~~f~~   12 (23)
T PF00096_consen    1 YKCPICGKSFSS   12 (23)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCccCC
Confidence            678888887754


No 68 
>PRK12495 hypothetical protein; Provisional
Probab=46.87  E-value=13  Score=28.72  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=6.2

Q ss_pred             ccCCCCCCCC
Q psy3656         109 FICTHCNQEL  118 (185)
Q Consensus       109 f~C~~C~~~L  118 (185)
                      +.|..|+.+|
T Consensus        43 ~hC~~CG~PI   52 (226)
T PRK12495         43 AHCDECGDPI   52 (226)
T ss_pred             hhcccccCcc
Confidence            4566666666


No 69 
>KOG4739|consensus
Probab=46.79  E-value=15  Score=28.66  Aligned_cols=34  Identities=24%  Similarity=0.459  Sum_probs=27.0

Q ss_pred             CCCee-eeCCcCCCccchhhccCCCCCccCCcccC
Q psy3656         120 TRNFF-ERDSRPYCEPDYHNLFSPRCSYCNGPILD  153 (185)
Q Consensus       120 ~~~~~-~~~g~~yC~~~~~~~~~~~C~~C~~~i~~  153 (185)
                      ...|+ .--+.++|..|...-.+..|..|++.|..
T Consensus        15 ~~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir~   49 (233)
T KOG4739|consen   15 QDPFFLTACRHVFCEPCLKASSPDVCPLCKKSIRI   49 (233)
T ss_pred             CCceeeeechhhhhhhhcccCCccccccccceeee
Confidence            34454 66778999999888887899999999764


No 70 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=45.59  E-value=3.9  Score=21.68  Aligned_cols=15  Identities=20%  Similarity=0.654  Sum_probs=10.1

Q ss_pred             cccccCCCccCCCCe
Q psy3656         168 FFCAQCGKQFGEAMV  182 (185)
Q Consensus       168 f~C~~C~~~l~~~~~  182 (185)
                      |.|..|++++...+|
T Consensus         5 ~~C~nC~R~v~a~Rf   19 (33)
T PF08209_consen    5 VECPNCGRPVAASRF   19 (33)
T ss_dssp             EE-TTTSSEEEGGGH
T ss_pred             EECCCCcCCcchhhh
Confidence            568888888766665


No 71 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=45.31  E-value=8.7  Score=21.52  Aligned_cols=10  Identities=50%  Similarity=1.341  Sum_probs=5.0

Q ss_pred             CCccCCcccC
Q psy3656         144 CSYCNGPILD  153 (185)
Q Consensus       144 C~~C~~~i~~  153 (185)
                      |..|+++|.|
T Consensus         3 Cd~C~~~i~G   12 (43)
T cd02340           3 CDGCQGPIVG   12 (43)
T ss_pred             CCCCCCcCcC
Confidence            4455554444


No 72 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=44.88  E-value=10  Score=18.59  Aligned_cols=13  Identities=38%  Similarity=1.122  Sum_probs=9.6

Q ss_pred             cccccCCCccCCC
Q psy3656         168 FFCAQCGKQFGEA  180 (185)
Q Consensus       168 f~C~~C~~~l~~~  180 (185)
                      |.|..|++.+.++
T Consensus         2 ~~C~~C~k~f~~~   14 (27)
T PF12171_consen    2 FYCDACDKYFSSE   14 (27)
T ss_dssp             CBBTTTTBBBSSH
T ss_pred             CCcccCCCCcCCH
Confidence            6788888887654


No 73 
>KOG2114|consensus
Probab=44.11  E-value=9.3  Score=35.23  Aligned_cols=35  Identities=23%  Similarity=0.564  Sum_probs=27.4

Q ss_pred             CCCccCCcccCceEE-eCCCeecccCcc-----cccCCCcc
Q psy3656         143 RCSYCNGPILDKCVT-ALEKTWHTEHFF-----CAQCGKQF  177 (185)
Q Consensus       143 ~C~~C~~~i~~~~~~-~~~~~~H~~Cf~-----C~~C~~~l  177 (185)
                      +|..|...+.-..|. .-++.||..||.     |..|...+
T Consensus       842 kCs~C~~~LdlP~VhF~CgHsyHqhC~e~~~~~CP~C~~e~  882 (933)
T KOG2114|consen  842 KCSACEGTLDLPFVHFLCGHSYHQHCLEDKEDKCPKCLPEL  882 (933)
T ss_pred             eecccCCccccceeeeecccHHHHHhhccCcccCCccchhh
Confidence            699999988766665 458999999987     88887644


No 74 
>KOG3579|consensus
Probab=43.95  E-value=11  Score=30.32  Aligned_cols=47  Identities=17%  Similarity=0.421  Sum_probs=32.2

Q ss_pred             Cccccccccccc-ceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCcc
Q psy3656          83 GCCSSCDKPIVG-QVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEP  134 (185)
Q Consensus        83 ~~C~~C~~~i~~-~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~  134 (185)
                      -.|..|.+.+.| .+|..-.-.-|+.||-|+.=.  +.   -....|.+||..
T Consensus       269 LcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSRes--IK---~Qg~sgevYCPS  316 (352)
T KOG3579|consen  269 LCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRES--IK---QQGASGEVYCPS  316 (352)
T ss_pred             eeehhhhhhhccCceeecCCCcccceecccCHHH--HH---hhcCCCceeCCC
Confidence            578999999975 578888888899999887321  11   112345778853


No 75 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=43.90  E-value=4.5  Score=20.57  Aligned_cols=15  Identities=33%  Similarity=0.784  Sum_probs=11.7

Q ss_pred             cccccCCCccCCCCe
Q psy3656         168 FFCAQCGKQFGEAMV  182 (185)
Q Consensus       168 f~C~~C~~~l~~~~~  182 (185)
                      |.|..|++.|.++.|
T Consensus         1 ~sCiDC~~~F~~~~y   15 (28)
T PF08790_consen    1 FSCIDCSKDFDGDSY   15 (28)
T ss_dssp             EEETTTTEEEEGGGT
T ss_pred             CeeecCCCCcCcCCc
Confidence            678999998876654


No 76 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=43.04  E-value=16  Score=33.20  Aligned_cols=83  Identities=22%  Similarity=0.606  Sum_probs=58.6

Q ss_pred             CCCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchh-hccCCCCCccCCcccCceEEeC
Q psy3656          81 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYH-NLFSPRCSYCNGPILDKCVTAL  159 (185)
Q Consensus        81 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~-~~~~~~C~~C~~~i~~~~~~~~  159 (185)
                      +..+|..|.+.|.+    -.++.||=---.|..|+-.     |.+.+..+|=+.... +.| +-|..|.+    ++-...
T Consensus       100 D~a~C~~Cl~Ei~d----p~~rrY~YPF~~CT~CGPR-----fTIi~alPYDR~nTsM~~F-~lC~~C~~----EY~dP~  165 (750)
T COG0068         100 DAATCEDCLEEIFD----PNSRRYLYPFINCTNCGPR-----FTIIEALPYDRENTSMADF-PLCPFCDK----EYKDPL  165 (750)
T ss_pred             chhhhHHHHHHhcC----CCCcceeccccccCCCCcc-----eeeeccCCCCcccCccccC-cCCHHHHH----HhcCcc
Confidence            34679999887754    3456777666788989664     456666666544332 333 77888876    334457


Q ss_pred             CCeecccCcccccCCCcc
Q psy3656         160 EKTWHTEHFFCAQCGKQF  177 (185)
Q Consensus       160 ~~~~H~~Cf~C~~C~~~l  177 (185)
                      ++.||-+=..|..|+..+
T Consensus       166 nRRfHAQp~aCp~CGP~~  183 (750)
T COG0068         166 NRRFHAQPIACPKCGPHL  183 (750)
T ss_pred             ccccccccccCcccCCCe
Confidence            899999999999999876


No 77 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=42.64  E-value=13  Score=23.75  Aligned_cols=50  Identities=22%  Similarity=0.585  Sum_probs=18.2

Q ss_pred             CCCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchh--hccC-CCCCccCCc
Q psy3656          81 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYH--NLFS-PRCSYCNGP  150 (185)
Q Consensus        81 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~--~~~~-~~C~~C~~~  150 (185)
                      ...+|..|+..|-   +...|..|    -.|..|.-+             .|+.||.  ++-+ ..|..|+.+
T Consensus         8 ~~qiCqiCGD~VG---l~~~Ge~F----VAC~eC~fP-------------vCr~CyEYErkeg~q~CpqCkt~   60 (80)
T PF14569_consen    8 NGQICQICGDDVG---LTENGEVF----VACHECAFP-------------VCRPCYEYERKEGNQVCPQCKTR   60 (80)
T ss_dssp             SS-B-SSS--B-----B-SSSSB------S-SSS------------------HHHHHHHHHTS-SB-TTT--B
T ss_pred             CCcccccccCccc---cCCCCCEE----EEEcccCCc-------------cchhHHHHHhhcCcccccccCCC
Confidence            3567888888771   22334433    245555444             4787775  3333 567777643


No 78 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=42.50  E-value=14  Score=21.77  Aligned_cols=25  Identities=20%  Similarity=0.652  Sum_probs=13.4

Q ss_pred             cCCCCCCCCCCCCeeeeCCcCCCcc
Q psy3656         110 ICTHCNQELGTRNFFERDSRPYCEP  134 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~yC~~  134 (185)
                      .|..|...+...+-...+|+.||-+
T Consensus         9 aC~~C~C~V~~~~Ai~~dGk~YCS~   33 (52)
T PF02069_consen    9 ACPSCSCVVSEEEAIQKDGKYYCSE   33 (52)
T ss_dssp             SSTT----B-TTTSEESSS-EESSH
T ss_pred             cCCCCEeEECchHhHHhCCEeeecH
Confidence            4667777776566678888888853


No 79 
>PRK05580 primosome assembly protein PriA; Validated
Probab=42.47  E-value=20  Score=32.53  Aligned_cols=38  Identities=21%  Similarity=0.484  Sum_probs=25.5

Q ss_pred             cCCCCCCCCCCCCeeeeCCcCCCccchhh-ccCCCCCccCCc
Q psy3656         110 ICTHCNQELGTRNFFERDSRPYCEPDYHN-LFSPRCSYCNGP  150 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~yC~~~~~~-~~~~~C~~C~~~  150 (185)
                      +|..|+..|   .|....+.+.|..|-.. .+...|..|+..
T Consensus       392 ~C~~C~~~l---~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        392 ECPHCDASL---TLHRFQRRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             CCCCCCCce---eEECCCCeEECCCCcCCCCCCCCCCCCcCC
Confidence            667777666   33445677788888554 345689999775


No 80 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=42.34  E-value=10  Score=19.30  Aligned_cols=26  Identities=19%  Similarity=0.324  Sum_probs=13.7

Q ss_pred             CCccCCcccCceEEeCCCeecccCcc
Q psy3656         144 CSYCNGPILDKCVTALEKTWHTEHFF  169 (185)
Q Consensus       144 C~~C~~~i~~~~~~~~~~~~H~~Cf~  169 (185)
                      |..|.+......+..-+..||.+|+.
T Consensus         1 C~iC~~~~~~~~~~~C~H~~c~~C~~   26 (39)
T smart00184        1 CPICLEELKDPVVLPCGHTFCRSCIR   26 (39)
T ss_pred             CCcCccCCCCcEEecCCChHHHHHHH
Confidence            44555554434444456666666653


No 81 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=42.15  E-value=5.4  Score=24.37  Aligned_cols=11  Identities=45%  Similarity=0.936  Sum_probs=5.6

Q ss_pred             ccccCCCccCC
Q psy3656         169 FCAQCGKQFGE  179 (185)
Q Consensus       169 ~C~~C~~~l~~  179 (185)
                      +|.+|++.+++
T Consensus         6 RCFTCGkvi~~   16 (62)
T PRK04016          6 RCFTCGKVIAE   16 (62)
T ss_pred             EecCCCCChHH
Confidence            34555555544


No 82 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=42.13  E-value=33  Score=32.57  Aligned_cols=52  Identities=17%  Similarity=0.309  Sum_probs=35.7

Q ss_pred             CCCCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCcccC
Q psy3656          80 TQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD  153 (185)
Q Consensus        80 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~~  153 (185)
                      .+...|..|+...              .=|+|..|+..        .....+|..|-.......|..|+..+.+
T Consensus       624 Vg~RfCpsCG~~t--------------~~frCP~CG~~--------Te~i~fCP~CG~~~~~y~CPKCG~El~~  675 (1121)
T PRK04023        624 IGRRKCPSCGKET--------------FYRRCPFCGTH--------TEPVYRCPRCGIEVEEDECEKCGREPTP  675 (1121)
T ss_pred             ccCccCCCCCCcC--------------CcccCCCCCCC--------CCcceeCccccCcCCCCcCCCCCCCCCc
Confidence            3467899999863              11788999876        1223468888555555679999887763


No 83 
>KOG3002|consensus
Probab=41.89  E-value=19  Score=29.33  Aligned_cols=43  Identities=23%  Similarity=0.427  Sum_probs=28.9

Q ss_pred             ccCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCccc
Q psy3656         109 FICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL  152 (185)
Q Consensus       109 f~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~  152 (185)
                      +.|..|-..|..-.+.-.+|.+.|..|-.++ ..+|..|..+|.
T Consensus        49 leCPvC~~~l~~Pi~QC~nGHlaCssC~~~~-~~~CP~Cr~~~g   91 (299)
T KOG3002|consen   49 LDCPVCFNPLSPPIFQCDNGHLACSSCRTKV-SNKCPTCRLPIG   91 (299)
T ss_pred             ccCchhhccCcccceecCCCcEehhhhhhhh-cccCCccccccc
Confidence            4566666666555566677788887775433 377888888775


No 84 
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=41.39  E-value=17  Score=28.96  Aligned_cols=29  Identities=14%  Similarity=0.150  Sum_probs=20.1

Q ss_pred             ccCCCCCccCCcccCceEEeCCCeecccC
Q psy3656         139 LFSPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       139 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      +.+..|..|+.+|.-..+.-+...|.|.|
T Consensus       243 R~g~pC~~Cg~~I~~~~~~gR~t~~CP~C  271 (274)
T PRK01103        243 REGEPCRRCGTPIEKIKQGGRSTFFCPRC  271 (274)
T ss_pred             CCCCCCCCCCCeeEEEEECCCCcEECcCC
Confidence            34578999999997555555566666655


No 85 
>PHA02929 N1R/p28-like protein; Provisional
Probab=40.26  E-value=14  Score=28.92  Aligned_cols=36  Identities=22%  Similarity=0.584  Sum_probs=22.6

Q ss_pred             CCCCccCCcccCc--------eEEeCCCeecccCc--------ccccCCCcc
Q psy3656         142 PRCSYCNGPILDK--------CVTALEKTWHTEHF--------FCAQCGKQF  177 (185)
Q Consensus       142 ~~C~~C~~~i~~~--------~~~~~~~~~H~~Cf--------~C~~C~~~l  177 (185)
                      ..|+.|...+.+.        .+..-++.||.+|+        .|..|...+
T Consensus       175 ~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~  226 (238)
T PHA02929        175 KECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPF  226 (238)
T ss_pred             CCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEe
Confidence            4577777765532        22335677777777        577777665


No 86 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=40.24  E-value=18  Score=20.32  Aligned_cols=11  Identities=36%  Similarity=0.869  Sum_probs=6.3

Q ss_pred             CCCccCCcccC
Q psy3656         143 RCSYCNGPILD  153 (185)
Q Consensus       143 ~C~~C~~~i~~  153 (185)
                      .|..|+++|.|
T Consensus         2 ~C~~C~~~i~g   12 (46)
T cd02249           2 SCDGCLKPIVG   12 (46)
T ss_pred             CCcCCCCCCcC
Confidence            36666665554


No 87 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=39.11  E-value=20  Score=27.18  Aligned_cols=30  Identities=20%  Similarity=0.449  Sum_probs=22.1

Q ss_pred             CccCCCCCCCCCCCCeeeeCCcCCCccchhh
Q psy3656         108 HFICTHCNQELGTRNFFERDSRPYCEPDYHN  138 (185)
Q Consensus       108 Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~  138 (185)
                      .|.|..|...+. ......=|..||..|..+
T Consensus        18 ~~~CpICld~~~-dPVvT~CGH~FC~~CI~~   47 (193)
T PLN03208         18 DFDCNICLDQVR-DPVVTLCGHLFCWPCIHK   47 (193)
T ss_pred             ccCCccCCCcCC-CcEEcCCCchhHHHHHHH
Confidence            478999987663 345567888999888754


No 88 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=38.71  E-value=2.3  Score=22.80  Aligned_cols=13  Identities=31%  Similarity=0.836  Sum_probs=7.0

Q ss_pred             cccccccccccce
Q psy3656          84 CCSSCDKPIVGQV   96 (185)
Q Consensus        84 ~C~~C~~~i~~~~   96 (185)
                      .|..|++.|..++
T Consensus         5 ~C~~CGe~I~~~R   17 (36)
T PF01258_consen    5 ICEDCGEPIPEER   17 (36)
T ss_dssp             B-TTTSSBEEHHH
T ss_pred             CccccCChHHHHH
Confidence            3677777664433


No 89 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=37.35  E-value=13  Score=17.52  Aligned_cols=13  Identities=38%  Similarity=1.134  Sum_probs=9.7

Q ss_pred             cccccCCCccCCC
Q psy3656         168 FFCAQCGKQFGEA  180 (185)
Q Consensus       168 f~C~~C~~~l~~~  180 (185)
                      |.|..|++.+.++
T Consensus         1 ~~C~~C~~~f~s~   13 (25)
T PF12874_consen    1 FYCDICNKSFSSE   13 (25)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCCCCCCcCCH
Confidence            6788888887553


No 90 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=36.78  E-value=22  Score=28.36  Aligned_cols=28  Identities=18%  Similarity=0.331  Sum_probs=20.5

Q ss_pred             cCCCCCccCCcccCceEEeCCCeecccC
Q psy3656         140 FSPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       140 ~~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      -+..|..|+.+|.-..+.-+...|.|.|
T Consensus       243 ~g~pCprCG~~I~~~~~~gR~t~~CP~C  270 (272)
T PRK14810        243 TGEPCLNCKTPIRRVVVAGRSSHYCPHC  270 (272)
T ss_pred             CCCcCCCCCCeeEEEEECCCccEECcCC
Confidence            3578999999997555555667777766


No 91 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=36.12  E-value=16  Score=16.51  Aligned_cols=11  Identities=55%  Similarity=1.265  Sum_probs=6.3

Q ss_pred             cccccCCCccC
Q psy3656         168 FFCAQCGKQFG  178 (185)
Q Consensus       168 f~C~~C~~~l~  178 (185)
                      |.|..|++.+.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            57888887764


No 92 
>KOG0978|consensus
Probab=35.80  E-value=11  Score=34.13  Aligned_cols=27  Identities=19%  Similarity=0.587  Sum_probs=13.9

Q ss_pred             eeCCcCCCccchhhccC---CCCCccCCcc
Q psy3656         125 ERDSRPYCEPDYHNLFS---PRCSYCNGPI  151 (185)
Q Consensus       125 ~~~g~~yC~~~~~~~~~---~~C~~C~~~i  151 (185)
                      ..-+++||..|-..++.   .+|..|+...
T Consensus       659 ~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aF  688 (698)
T KOG0978|consen  659 TKCGHVFCEECVQTRYETRQRKCPKCNAAF  688 (698)
T ss_pred             HhcchHHHHHHHHHHHHHhcCCCCCCCCCC
Confidence            34444555555444443   4566666653


No 93 
>PRK10445 endonuclease VIII; Provisional
Probab=35.75  E-value=24  Score=28.06  Aligned_cols=29  Identities=17%  Similarity=0.313  Sum_probs=20.8

Q ss_pred             ccCCCCCccCCcccCceEEeCCCeecccC
Q psy3656         139 LFSPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       139 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      +.+..|..|+.+|.-..+.-+...|.|.|
T Consensus       233 r~g~~Cp~Cg~~I~~~~~~gR~t~~CP~C  261 (263)
T PRK10445        233 RDGEACERCGGIIEKTTLSSRPFYWCPGC  261 (263)
T ss_pred             CCCCCCCCCCCEeEEEEECCCCcEECCCC
Confidence            34578999999997555555666776666


No 94 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=35.47  E-value=54  Score=21.58  Aligned_cols=11  Identities=27%  Similarity=1.093  Sum_probs=6.7

Q ss_pred             CCccccccccc
Q psy3656          82 KGCCSSCDKPI   92 (185)
Q Consensus        82 ~~~C~~C~~~i   92 (185)
                      ...|..|++++
T Consensus        33 rS~C~~C~~~L   43 (92)
T PF06750_consen   33 RSHCPHCGHPL   43 (92)
T ss_pred             CCcCcCCCCcC
Confidence            34566666666


No 95 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=35.32  E-value=30  Score=20.26  Aligned_cols=29  Identities=24%  Similarity=0.311  Sum_probs=19.8

Q ss_pred             CCCCccCCccc-C--c-eEEeCCCeecccCccc
Q psy3656         142 PRCSYCNGPIL-D--K-CVTALEKTWHTEHFFC  170 (185)
Q Consensus       142 ~~C~~C~~~i~-~--~-~~~~~~~~~H~~Cf~C  170 (185)
                      ..|..|+..|. |  . .+...+++|.--+-+|
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~Fcs~KC   34 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILYFCSSKC   34 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEEEeCHHH
Confidence            36888999887 3  2 3567788887555444


No 96 
>KOG3970|consensus
Probab=35.20  E-value=19  Score=28.04  Aligned_cols=53  Identities=13%  Similarity=0.209  Sum_probs=33.1

Q ss_pred             ecCcccccCCccCCCCCCCCCCCCee-eeCCcCCCccchhhcc----------CCCCCccCCcccCc
Q psy3656          99 ALGKTWHPEHFICTHCNQELGTRNFF-ERDSRPYCEPDYHNLF----------SPRCSYCNGPILDK  154 (185)
Q Consensus        99 ~~~~~~H~~Cf~C~~C~~~L~~~~~~-~~~g~~yC~~~~~~~~----------~~~C~~C~~~i~~~  154 (185)
                      ..+..|..+|   ..|+.+|..++.. ..--.++..+|+..+-          |-+|..|++.|.+.
T Consensus        44 L~DsDY~pNC---~LC~t~La~gdt~RLvCyhlfHW~ClneraA~lPanTAPaGyqCP~Cs~eiFPp  107 (299)
T KOG3970|consen   44 LQDSDYNPNC---RLCNTPLASGDTTRLVCYHLFHWKCLNERAANLPANTAPAGYQCPCCSQEIFPP  107 (299)
T ss_pred             HhhcCCCCCC---ceeCCccccCcceeehhhhhHHHHHhhHHHhhCCCcCCCCcccCCCCCCccCCC
Confidence            3456666665   6677888755432 4444555566654432          23799999999864


No 97 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=34.93  E-value=28  Score=17.60  Aligned_cols=9  Identities=33%  Similarity=0.781  Sum_probs=4.1

Q ss_pred             CCccCCccc
Q psy3656         144 CSYCNGPIL  152 (185)
Q Consensus       144 C~~C~~~i~  152 (185)
                      |..|++.+.
T Consensus         3 C~~C~~~~~   11 (30)
T PF03107_consen    3 CDVCRRKID   11 (30)
T ss_pred             CCCCCCCcC
Confidence            444444444


No 98 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=34.72  E-value=26  Score=27.96  Aligned_cols=27  Identities=19%  Similarity=0.369  Sum_probs=17.7

Q ss_pred             CCCCCccCCcccCceEEeCCCeecccC
Q psy3656         141 SPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       141 ~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      +..|..|+.+|.-..+.-+...|.|.|
T Consensus       235 g~pC~~Cg~~I~~~~~~gR~ty~Cp~C  261 (269)
T PRK14811        235 GQPCPRCGTPIEKIVVGGRGTHFCPQC  261 (269)
T ss_pred             cCCCCcCCCeeEEEEECCCCcEECCCC
Confidence            578999999987544444455554443


No 99 
>KOG0978|consensus
Probab=34.44  E-value=7.8  Score=35.07  Aligned_cols=44  Identities=30%  Similarity=0.540  Sum_probs=26.3

Q ss_pred             CCCCccCCcccCceEEeCCCeecccCc---------ccccCCCccCCCCeeeC
Q psy3656         142 PRCSYCNGPILDKCVTALEKTWHTEHF---------FCAQCGKQFGEAMVKFI  185 (185)
Q Consensus       142 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf---------~C~~C~~~l~~~~~~~~  185 (185)
                      -+|..|+..--+.+|.--+++|.-+|-         +|..|+..||-..|+-|
T Consensus       644 LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  644 LKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             eeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccccccc
Confidence            457777744333343333333333332         48899999998888765


No 100
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.89  E-value=26  Score=27.90  Aligned_cols=27  Identities=19%  Similarity=0.324  Sum_probs=20.1

Q ss_pred             CCCCCccCCcccCceEEeCCCeecccC
Q psy3656         141 SPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       141 ~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      +..|..|+.+|.-..+.-+...|.|.|
T Consensus       245 g~pC~~Cg~~I~~~~~~gR~t~~CP~C  271 (272)
T TIGR00577       245 GEPCRRCGTPIEKIKVGGRGTHFCPQC  271 (272)
T ss_pred             CCCCCCCCCeeEEEEECCCCCEECCCC
Confidence            568999999997555555667777766


No 101
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=33.54  E-value=26  Score=17.68  Aligned_cols=9  Identities=44%  Similarity=1.043  Sum_probs=2.0

Q ss_pred             CCccCCccc
Q psy3656         144 CSYCNGPIL  152 (185)
Q Consensus       144 C~~C~~~i~  152 (185)
                      |..|++++.
T Consensus         3 C~~C~~~~~   11 (30)
T PF07649_consen    3 CDACGKPID   11 (30)
T ss_dssp             -TTTS----
T ss_pred             CCcCCCcCC
Confidence            445555544


No 102
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=33.48  E-value=53  Score=18.65  Aligned_cols=28  Identities=14%  Similarity=0.169  Sum_probs=16.4

Q ss_pred             CCCCccCCcccC---ceEE--eCCCeecccCcc
Q psy3656         142 PRCSYCNGPILD---KCVT--ALEKTWHTEHFF  169 (185)
Q Consensus       142 ~~C~~C~~~i~~---~~~~--~~~~~~H~~Cf~  169 (185)
                      ..|..|++.|.+   ..+.  .-+...|.+|..
T Consensus        12 ~~C~~C~~~i~g~~~~g~~C~~C~~~~H~~C~~   44 (53)
T PF00130_consen   12 TYCDVCGKFIWGLGKQGYRCSWCGLVCHKKCLS   44 (53)
T ss_dssp             EB-TTSSSBECSSSSCEEEETTTT-EEETTGGC
T ss_pred             CCCcccCcccCCCCCCeEEECCCCChHhhhhhh
Confidence            568888888843   3343  235677777764


No 103
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=33.47  E-value=26  Score=20.15  Aligned_cols=9  Identities=44%  Similarity=0.992  Sum_probs=5.0

Q ss_pred             CCccCC-ccc
Q psy3656         144 CSYCNG-PIL  152 (185)
Q Consensus       144 C~~C~~-~i~  152 (185)
                      |..|+. +|.
T Consensus         3 Cd~C~~~pI~   12 (48)
T cd02341           3 CDSCGIEPIP   12 (48)
T ss_pred             CCCCCCCccc
Confidence            556655 554


No 104
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=33.09  E-value=31  Score=20.87  Aligned_cols=11  Identities=36%  Similarity=0.942  Sum_probs=6.1

Q ss_pred             CCCCccCCccc
Q psy3656         142 PRCSYCNGPIL  152 (185)
Q Consensus       142 ~~C~~C~~~i~  152 (185)
                      ++|.+|+..|.
T Consensus         8 ~~CtSCg~~i~   18 (59)
T PRK14890          8 PKCTSCGIEIA   18 (59)
T ss_pred             ccccCCCCccc
Confidence            44555655555


No 105
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=32.68  E-value=17  Score=17.46  Aligned_cols=12  Identities=50%  Similarity=1.245  Sum_probs=8.8

Q ss_pred             cccccCCCccCC
Q psy3656         168 FFCAQCGKQFGE  179 (185)
Q Consensus       168 f~C~~C~~~l~~  179 (185)
                      |.|..|++.+..
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            578888887754


No 106
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.36  E-value=19  Score=30.48  Aligned_cols=44  Identities=18%  Similarity=0.464  Sum_probs=29.9

Q ss_pred             CccCCCCCCCCCCCCeeeeCCcCCCccchhhccC--CCCCccCCccc
Q psy3656         108 HFICTHCNQELGTRNFFERDSRPYCEPDYHNLFS--PRCSYCNGPIL  152 (185)
Q Consensus       108 Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~--~~C~~C~~~i~  152 (185)
                      -+.|..|...+. ..+...=|+.||..|....+.  ..|..|...+.
T Consensus        26 ~l~C~IC~d~~~-~PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~~   71 (397)
T TIGR00599        26 SLRCHICKDFFD-VPVLTSCSHTFCSLCIRRCLSNQPKCPLCRAEDQ   71 (397)
T ss_pred             ccCCCcCchhhh-CccCCCCCCchhHHHHHHHHhCCCCCCCCCCccc
Confidence            368888877663 234466788888888765443  46888888765


No 107
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.01  E-value=27  Score=29.62  Aligned_cols=37  Identities=22%  Similarity=0.330  Sum_probs=20.6

Q ss_pred             CCcccccccccccceeeecCcccccCCc--------cCCCCCCCC
Q psy3656          82 KGCCSSCDKPIVGQVITALGKTWHPEHF--------ICTHCNQEL  118 (185)
Q Consensus        82 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf--------~C~~C~~~L  118 (185)
                      .-.|..|...+...++..-|..|...|+        .|..|...+
T Consensus        26 ~l~C~IC~d~~~~PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~   70 (397)
T TIGR00599        26 SLRCHICKDFFDVPVLTSCSHTFCSLCIRRCLSNQPKCPLCRAED   70 (397)
T ss_pred             ccCCCcCchhhhCccCCCCCCchhHHHHHHHHhCCCCCCCCCCcc
Confidence            4579999987755444433433433333        255555544


No 108
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.78  E-value=43  Score=21.12  Aligned_cols=42  Identities=19%  Similarity=0.500  Sum_probs=26.5

Q ss_pred             CCCCCCCCCCCC---eeeeCCcCCCccchhhccCCCCCccCCccc
Q psy3656         111 CTHCNQELGTRN---FFERDSRPYCEPDYHNLFSPRCSYCNGPIL  152 (185)
Q Consensus       111 C~~C~~~L~~~~---~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~  152 (185)
                      |.-|.+.|....   ..-.-.-.||-+|...+++..|.-|+..+.
T Consensus         8 CECCDrDLpp~s~dA~ICtfEcTFCadCae~~l~g~CPnCGGelv   52 (84)
T COG3813           8 CECCDRDLPPDSTDARICTFECTFCADCAENRLHGLCPNCGGELV   52 (84)
T ss_pred             CcccCCCCCCCCCceeEEEEeeehhHhHHHHhhcCcCCCCCchhh
Confidence            444556664221   112223457888888888899999988654


No 109
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=30.51  E-value=7.5  Score=25.90  Aligned_cols=43  Identities=16%  Similarity=0.354  Sum_probs=21.3

Q ss_pred             ccccccccccc-eeeecCcccccCCccCCCCCCCCCCCCeeeeC
Q psy3656          85 CSSCDKPIVGQ-VITALGKTWHPEHFICTHCNQELGTRNFFERD  127 (185)
Q Consensus        85 C~~C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~  127 (185)
                      |..|...+... +....-..++..+..|..|...|.-.+|...+
T Consensus        38 Cy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~   81 (105)
T COG4357          38 CYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCG   81 (105)
T ss_pred             HHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcC
Confidence            44444444322 22233355666666777776666444444333


No 110
>KOG2932|consensus
Probab=30.46  E-value=24  Score=28.79  Aligned_cols=43  Identities=12%  Similarity=0.326  Sum_probs=26.6

Q ss_pred             cCCCCCCCCCCCCeeeeCCcCCCccchhhccCCCCCccCCccc
Q psy3656         110 ICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL  152 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~~C~~C~~~i~  152 (185)
                      -|..|+.++.--.-.+.-...||.+|....-...|..|.+.|.
T Consensus        92 fCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~Vq  134 (389)
T KOG2932|consen   92 FCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRVQ  134 (389)
T ss_pred             eecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHHH
Confidence            4667777663222235556777777754333357999988875


No 111
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.40  E-value=41  Score=27.49  Aligned_cols=28  Identities=25%  Similarity=0.515  Sum_probs=18.1

Q ss_pred             eCCcCCCccchhhccC---CCCCccCCcccC
Q psy3656         126 RDSRPYCEPDYHNLFS---PRCSYCNGPILD  153 (185)
Q Consensus       126 ~~g~~yC~~~~~~~~~---~~C~~C~~~i~~  153 (185)
                      .=|+.+|..|..+.|.   ..|..|+..+.-
T Consensus        25 ~CGH~~C~sCv~~l~~~~~~~CP~C~~~lrk   55 (309)
T TIGR00570        25 VCGHTLCESCVDLLFVRGSGSCPECDTPLRK   55 (309)
T ss_pred             CCCCcccHHHHHHHhcCCCCCCCCCCCccch
Confidence            3456667666665542   468888887763


No 112
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=30.31  E-value=33  Score=27.55  Aligned_cols=27  Identities=19%  Similarity=0.443  Sum_probs=19.3

Q ss_pred             CCCCCccCCcccCceEEeCCCeecccC
Q psy3656         141 SPRCSYCNGPILDKCVTALEKTWHTEH  167 (185)
Q Consensus       141 ~~~C~~C~~~i~~~~~~~~~~~~H~~C  167 (185)
                      +..|..|+.+|.-..+.-+...|.|.|
T Consensus       254 g~pC~~Cg~~I~~~~~~gR~t~~CP~C  280 (282)
T PRK13945        254 GKPCRKCGTPIERIKLAGRSTHWCPNC  280 (282)
T ss_pred             cCCCCcCCCeeEEEEECCCccEECCCC
Confidence            578999999997555544556666665


No 113
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=30.30  E-value=93  Score=22.22  Aligned_cols=36  Identities=17%  Similarity=0.385  Sum_probs=20.8

Q ss_pred             CCcccccccccc-c--c----eeeecCcccccCCccCCCCCCC
Q psy3656          82 KGCCSSCDKPIV-G--Q----VITALGKTWHPEHFICTHCNQE  117 (185)
Q Consensus        82 ~~~C~~C~~~i~-~--~----~~~~~~~~~H~~Cf~C~~C~~~  117 (185)
                      ...|..|+..+. .  +    .+...-...+...++|..|++-
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~ki  133 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKI  133 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCE
Confidence            468999998772 1  1    1222223334556788888764


No 114
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=30.05  E-value=59  Score=21.55  Aligned_cols=13  Identities=38%  Similarity=0.894  Sum_probs=6.3

Q ss_pred             hccCCCCCccCCc
Q psy3656         138 NLFSPRCSYCNGP  150 (185)
Q Consensus       138 ~~~~~~C~~C~~~  150 (185)
                      +.|+.+|..|+..
T Consensus        35 rv~~Q~C~~C~~~   47 (98)
T PF13695_consen   35 RVFGQRCKKCNPL   47 (98)
T ss_pred             EEECCCCCCCCCC
Confidence            3445555555433


No 115
>KOG2186|consensus
Probab=30.03  E-value=12  Score=29.64  Aligned_cols=41  Identities=12%  Similarity=0.374  Sum_probs=26.1

Q ss_pred             CcccccccccccceeeecCcccccCCccCCCCCCCCCCCCe
Q psy3656          83 GCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNF  123 (185)
Q Consensus        83 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~  123 (185)
                      ..|..|+..|.-..+.----..|..+|.|..|+..+....|
T Consensus         4 FtCnvCgEsvKKp~vekH~srCrn~~fSCIDC~k~F~~~sY   44 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQVEKHMSRCRNAYFSCIDCGKTFERVSY   44 (276)
T ss_pred             EehhhhhhhccccchHHHHHhccCCeeEEeecccccccchh
Confidence            35899999884222221111235588999999999866444


No 116
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=29.73  E-value=38  Score=26.99  Aligned_cols=11  Identities=18%  Similarity=0.350  Sum_probs=7.5

Q ss_pred             CCCCccCCccc
Q psy3656         142 PRCSYCNGPIL  152 (185)
Q Consensus       142 ~~C~~C~~~i~  152 (185)
                      ..|..|+..+.
T Consensus       210 ~PCPKCg~et~  220 (314)
T PF06524_consen  210 IPCPKCGYETQ  220 (314)
T ss_pred             CCCCCCCCccc
Confidence            45777777665


No 117
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=29.32  E-value=40  Score=24.18  Aligned_cols=35  Identities=23%  Similarity=0.462  Sum_probs=21.8

Q ss_pred             CCcccccccccc-cceeeecCcccccCCccCCCCCCCCC
Q psy3656          82 KGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELG  119 (185)
Q Consensus        82 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~L~  119 (185)
                      .-.|..|+.... .+.....+.   ..=|.|..|+..|.
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l~  134 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEELE  134 (147)
T ss_pred             EEECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEEE
Confidence            457999998773 333222221   22289999998874


No 118
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=29.13  E-value=38  Score=19.18  Aligned_cols=29  Identities=14%  Similarity=0.408  Sum_probs=15.2

Q ss_pred             cCCCCCCCCCCCCee-e-eCCcCCCccchhh
Q psy3656         110 ICTHCNQELGTRNFF-E-RDSRPYCEPDYHN  138 (185)
Q Consensus       110 ~C~~C~~~L~~~~~~-~-~~g~~yC~~~~~~  138 (185)
                      .|..|+..+..-.|. . ..+..+|..||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            466666666432222 1 2234567777764


No 119
>KOG3039|consensus
Probab=28.99  E-value=36  Score=26.89  Aligned_cols=75  Identities=15%  Similarity=0.232  Sum_probs=54.1

Q ss_pred             CCcccccccccc-cc----eeeec-------CcccccCCccCCCCCCCCCCC---CeeeeCCcCCCccchhhccC--CCC
Q psy3656          82 KGCCSSCDKPIV-GQ----VITAL-------GKTWHPEHFICTHCNQELGTR---NFFERDSRPYCEPDYHNLFS--PRC  144 (185)
Q Consensus        82 ~~~C~~C~~~i~-~~----~~~~~-------~~~~H~~Cf~C~~C~~~L~~~---~~~~~~g~~yC~~~~~~~~~--~~C  144 (185)
                      ..+|..=+++|. -+    .+..+       +..-|..-|.|..|...|.+.   .+...-|.++|.+|.+++..  .+|
T Consensus       183 ~v~CP~s~kplklkdL~~VkFT~l~s~~~et~l~a~s~ryiCpvtrd~LtNt~~ca~Lr~sg~Vv~~ecvEklir~D~v~  262 (303)
T KOG3039|consen  183 TVVCPVSGKPLKLKDLFAVKFTPLNSEETETKLIAASKRYICPVTRDTLTNTTPCAVLRPSGHVVTKECVEKLIRKDMVD  262 (303)
T ss_pred             eeeccCCCCccchhhcceeeeeecCCchhhhhhhhhccceecccchhhhcCccceEEeccCCcEeeHHHHHHhccccccc
Confidence            457888888882 21    22222       224566778999999999743   34478899999999887775  689


Q ss_pred             CccCCcccCceE
Q psy3656         145 SYCNGPILDKCV  156 (185)
Q Consensus       145 ~~C~~~i~~~~~  156 (185)
                      ..|++++.++.|
T Consensus       263 pv~d~plkdrdi  274 (303)
T KOG3039|consen  263 PVTDKPLKDRDI  274 (303)
T ss_pred             cCCCCcCcccce
Confidence            999999987544


No 120
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=28.51  E-value=48  Score=19.18  Aligned_cols=26  Identities=15%  Similarity=0.346  Sum_probs=19.5

Q ss_pred             CCCCccCCcccC---ceEEeCCCeecccC
Q psy3656         142 PRCSYCNGPILD---KCVTALEKTWHTEH  167 (185)
Q Consensus       142 ~~C~~C~~~i~~---~~~~~~~~~~H~~C  167 (185)
                      ..|..|+.-..|   -.|.+.+..|+..|
T Consensus        14 ~~Cp~CGN~~vGngEG~liV~edtfkRtC   42 (49)
T PF12677_consen   14 CKCPKCGNDKVGNGEGTLIVEEDTFKRTC   42 (49)
T ss_pred             ccCcccCCcEeecCcceEEEeccceeeee
Confidence            568888877663   35678888888877


No 121
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.18  E-value=35  Score=24.01  Aligned_cols=11  Identities=27%  Similarity=0.845  Sum_probs=5.7

Q ss_pred             CCCccCCcccC
Q psy3656         143 RCSYCNGPILD  153 (185)
Q Consensus       143 ~C~~C~~~i~~  153 (185)
                      .|..|+..|.|
T Consensus        41 qcp~csasirg   51 (160)
T COG4306          41 QCPICSASIRG   51 (160)
T ss_pred             cCCccCCcccc
Confidence            45555555554


No 122
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=27.80  E-value=33  Score=20.68  Aligned_cols=9  Identities=33%  Similarity=0.922  Sum_probs=5.5

Q ss_pred             cccCCCccC
Q psy3656         170 CAQCGKQFG  178 (185)
Q Consensus       170 C~~C~~~l~  178 (185)
                      |..|++.|+
T Consensus        19 C~~C~k~L~   27 (58)
T PF04570_consen   19 CYLCKKKLD   27 (58)
T ss_pred             HHccCCCCC
Confidence            666666664


No 123
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=27.78  E-value=43  Score=30.71  Aligned_cols=83  Identities=24%  Similarity=0.582  Sum_probs=53.1

Q ss_pred             CCCcccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccch-hhccCCCCCccCCcccCceEEeC
Q psy3656          81 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDY-HNLFSPRCSYCNGPILDKCVTAL  159 (185)
Q Consensus        81 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~-~~~~~~~C~~C~~~i~~~~~~~~  159 (185)
                      +..+|..|.+.+.+    -.++.|+=--..|..|+-..     .+....+|=.... ...| +.|..|.+...+.    .
T Consensus        67 D~a~C~~Cl~E~~d----p~~Rry~YpF~nCt~CGPr~-----~i~~~lpydr~~t~m~~f-~~C~~C~~ey~~p----~  132 (711)
T TIGR00143        67 DVATCSDCLEEMLD----KNDRRYLYPFISCTHCGPRF-----TIIEALPYDRENTSMADF-PLCPDCAKEYKDP----L  132 (711)
T ss_pred             chhhHHHHHHHhcC----CCcccccCCcccccCCCCCe-----EEeecCCCCCCCcCCCCC-cCCHHHHHHhcCC----c
Confidence            35679999887753    34566776667888897654     3333344433211 1222 5677777765432    6


Q ss_pred             CCeecccCcccccCCCcc
Q psy3656         160 EKTWHTEHFFCAQCGKQF  177 (185)
Q Consensus       160 ~~~~H~~Cf~C~~C~~~l  177 (185)
                      ++.||-.=-.|..|+..|
T Consensus       133 ~rr~h~~~~~C~~Cgp~l  150 (711)
T TIGR00143       133 DRRFHAQPIACPRCGPQL  150 (711)
T ss_pred             cccCCCCCccCCCCCcEE
Confidence            788888888888888877


No 124
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=27.44  E-value=22  Score=20.88  Aligned_cols=14  Identities=29%  Similarity=0.757  Sum_probs=9.7

Q ss_pred             CCCCcccccccccc
Q psy3656          80 TQKGCCSSCDKPIV   93 (185)
Q Consensus        80 ~~~~~C~~C~~~i~   93 (185)
                      .....|.+|+-.|.
T Consensus        20 v~~~~C~gC~~~l~   33 (56)
T PF02591_consen   20 VEGGTCSGCHMELP   33 (56)
T ss_pred             eeCCccCCCCEEcC
Confidence            34567888887773


No 125
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=27.20  E-value=45  Score=23.53  Aligned_cols=30  Identities=20%  Similarity=0.232  Sum_probs=21.2

Q ss_pred             CCCCccCCcccC----ceEEeCCCeecccCcccc
Q psy3656         142 PRCSYCNGPILD----KCVTALEKTWHTEHFFCA  171 (185)
Q Consensus       142 ~~C~~C~~~i~~----~~~~~~~~~~H~~Cf~C~  171 (185)
                      .+|.-|+..|.+    ++|...+++|+----+|.
T Consensus         5 e~CsFcG~kIyPG~G~~fVR~DGkvf~FcssKC~   38 (131)
T PRK14891          5 RTCDYTGEEIEPGTGTMFVRKDGTVLHFVDSKCE   38 (131)
T ss_pred             eeecCcCCcccCCCCcEEEecCCCEEEEecHHHH
Confidence            469999999974    456677888876544453


No 126
>smart00746 TRASH metallochaperone-like domain.
Probab=27.11  E-value=64  Score=15.60  Aligned_cols=21  Identities=29%  Similarity=0.510  Sum_probs=12.5

Q ss_pred             CCccCCccc-C---ceEEeCCCeec
Q psy3656         144 CSYCNGPIL-D---KCVTALEKTWH  164 (185)
Q Consensus       144 C~~C~~~i~-~---~~~~~~~~~~H  164 (185)
                      |..|+..|. .   ......++.||
T Consensus         1 c~~C~~~~~~~~~~~~~~~~g~~~~   25 (39)
T smart00746        1 CSFCGKDIYNPGTGIMVVNDGKVFY   25 (39)
T ss_pred             CCCCCCCccCCCCceEEEECCEEEE
Confidence            667888775 2   22345566665


No 127
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=27.06  E-value=45  Score=15.90  Aligned_cols=19  Identities=26%  Similarity=0.663  Sum_probs=8.9

Q ss_pred             CccchhhccC--CCCCccCCc
Q psy3656         132 CEPDYHNLFS--PRCSYCNGP  150 (185)
Q Consensus       132 C~~~~~~~~~--~~C~~C~~~  150 (185)
                      |..|....+.  ..|..|+.+
T Consensus         5 C~~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        5 CPACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             CCCCCCcChhhhccccccCCc
Confidence            4444333332  456666543


No 128
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=26.91  E-value=12  Score=20.96  Aligned_cols=8  Identities=25%  Similarity=1.103  Sum_probs=2.8

Q ss_pred             cccccccc
Q psy3656          85 CSSCDKPI   92 (185)
Q Consensus        85 C~~C~~~i   92 (185)
                      |..|.+.|
T Consensus         1 C~~C~~iv    8 (43)
T PF08746_consen    1 CEACKEIV    8 (43)
T ss_dssp             -TTT-SB-
T ss_pred             CcccchhH
Confidence            45565555


No 129
>PHA02768 hypothetical protein; Provisional
Probab=26.88  E-value=10  Score=22.64  Aligned_cols=11  Identities=18%  Similarity=0.552  Sum_probs=5.5

Q ss_pred             ccCCCCCCCCC
Q psy3656         109 FICTHCNQELG  119 (185)
Q Consensus       109 f~C~~C~~~L~  119 (185)
                      |.|..|++.+.
T Consensus         6 y~C~~CGK~Fs   16 (55)
T PHA02768          6 YECPICGEIYI   16 (55)
T ss_pred             cCcchhCCeec
Confidence            45555555443


No 130
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=26.56  E-value=42  Score=18.62  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=7.3

Q ss_pred             CCCCccCCcccC
Q psy3656         142 PRCSYCNGPILD  153 (185)
Q Consensus       142 ~~C~~C~~~i~~  153 (185)
                      ..|..|+.+|.+
T Consensus         5 ~~C~~C~~~i~g   16 (44)
T smart00291        5 YSCDTCGKPIVG   16 (44)
T ss_pred             cCCCCCCCCCcC
Confidence            457777765543


No 131
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=26.52  E-value=12  Score=25.47  Aligned_cols=28  Identities=21%  Similarity=0.453  Sum_probs=16.0

Q ss_pred             CCCCccCCcccCceEEeCCCeecccCcccccCC
Q psy3656         142 PRCSYCNGPILDKCVTALEKTWHTEHFFCAQCG  174 (185)
Q Consensus       142 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~  174 (185)
                      ..|-.|+++|....+.|     .|+.-.|..|+
T Consensus        81 G~C~~Cge~I~~~RL~a-----~P~a~~Cv~Cq  108 (110)
T TIGR02420        81 GYCEECGEEIGLRRLEA-----RPTATLCIDCK  108 (110)
T ss_pred             CchhccCCcccHHHHhh-----CCCccccHHhH
Confidence            46777777777555544     24444455543


No 132
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=26.32  E-value=43  Score=25.44  Aligned_cols=42  Identities=26%  Similarity=0.568  Sum_probs=25.0

Q ss_pred             CCccchhhccCCCCCccCC--cccC----ceEE--eCCCeecccCcc---cccCC
Q psy3656         131 YCEPDYHNLFSPRCSYCNG--PILD----KCVT--ALEKTWHTEHFF---CAQCG  174 (185)
Q Consensus       131 yC~~~~~~~~~~~C~~C~~--~i~~----~~~~--~~~~~~H~~Cf~---C~~C~  174 (185)
                      .|+.|-.+  |-.|..|+.  .|.+    ..+.  .-+.+||.+||.   |..|.
T Consensus       144 ~C~lC~~k--GfiCe~C~~~~~IfPF~~~~~~~C~~C~~v~H~~C~~~~~CpkC~  196 (202)
T PF13901_consen  144 SCELCQQK--GFICEICNSDDIIFPFQIDTTVRCPKCKSVFHKSCFRKKSCPKCA  196 (202)
T ss_pred             HhHHHHhC--CCCCccCCCCCCCCCCCCCCeeeCCcCccccchhhcCCCCCCCcH
Confidence            35555443  457888874  4443    2232  236899999997   55554


No 133
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=26.18  E-value=31  Score=20.93  Aligned_cols=9  Identities=56%  Similarity=1.353  Sum_probs=3.6

Q ss_pred             cccCCCccC
Q psy3656         170 CAQCGKQFG  178 (185)
Q Consensus       170 C~~C~~~l~  178 (185)
                      |.+|++.++
T Consensus         7 CFTCGkvi~   15 (60)
T PF01194_consen    7 CFTCGKVIG   15 (60)
T ss_dssp             -STTTSBTC
T ss_pred             cCCCCCChh
Confidence            444444443


No 134
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=25.99  E-value=30  Score=25.55  Aligned_cols=36  Identities=28%  Similarity=0.619  Sum_probs=25.1

Q ss_pred             CCCCccCCcccC----ceE---EeCCCeecccCcccccCCCcc
Q psy3656         142 PRCSYCNGPILD----KCV---TALEKTWHTEHFFCAQCGKQF  177 (185)
Q Consensus       142 ~~C~~C~~~i~~----~~~---~~~~~~~H~~Cf~C~~C~~~l  177 (185)
                      .+|..|+..+..    +..   --.-...|-++++|..|++..
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiY  140 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIY  140 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccc
Confidence            589999998862    222   112346778899999999865


No 135
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=25.87  E-value=56  Score=23.81  Aligned_cols=30  Identities=17%  Similarity=0.368  Sum_probs=21.0

Q ss_pred             CCccccccccc-ccceeeecCcccccCCccCCCCCCCCC
Q psy3656          82 KGCCSSCDKPI-VGQVITALGKTWHPEHFICTHCNQELG  119 (185)
Q Consensus        82 ~~~C~~C~~~i-~~~~~~~~~~~~H~~Cf~C~~C~~~L~  119 (185)
                      .=.|..|+... +.+.+.        .=|.|..|+..|.
T Consensus       109 ~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAME--------LNFTCPRCGAMLD  139 (158)
T ss_pred             eEECCCCCcEeeHHHHHH--------cCCcCCCCCCEee
Confidence            34699999776 333332        2589999999884


No 136
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=25.47  E-value=73  Score=17.84  Aligned_cols=10  Identities=20%  Similarity=0.249  Sum_probs=5.5

Q ss_pred             CCeecccCcc
Q psy3656         160 EKTWHTEHFF  169 (185)
Q Consensus       160 ~~~~H~~Cf~  169 (185)
                      ++.||..|..
T Consensus        21 ~~~~H~~C~~   30 (51)
T PF00628_consen   21 NRWYHQECVG   30 (51)
T ss_dssp             SCEEETTTST
T ss_pred             ChhhCcccCC
Confidence            3566666543


No 137
>PF04997 RNA_pol_Rpb1_1:  RNA polymerase Rpb1, domain 1;  InterPro: IPR007080 RNA polymerases catalyse the DNA-dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain, domain 1, represents the clamp domain, which is a mobile domain involved in positioning the DNA, maintenance of the transcription bubble and positioning of the nascent RNA strand [, ].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2Y0S_W 3QQC_A 1YNJ_D 1HQM_D 1YNN_D 1I6V_D 2GHO_D 2AUJ_D 1ZYR_D 1SMY_D ....
Probab=25.04  E-value=1.1e+02  Score=24.23  Aligned_cols=52  Identities=15%  Similarity=0.202  Sum_probs=30.6

Q ss_pred             eCCcCCCccchhhccCCCCCccCCcccC-----ceEEeCCCeecccCcc---------cccCCCcc
Q psy3656         126 RDSRPYCEPDYHNLFSPRCSYCNGPILD-----KCVTALEKTWHTEHFF---------CAQCGKQF  177 (185)
Q Consensus       126 ~~g~~yC~~~~~~~~~~~C~~C~~~i~~-----~~~~~~~~~~H~~Cf~---------C~~C~~~l  177 (185)
                      ..|.+|+..-........|..|+.....     .+|...-=+||++=|+         |..|.+.+
T Consensus        39 ~~~Gl~d~rlG~~~~~~~C~tC~~~~~~CpGHfGhI~L~~PV~h~~f~~~i~~iL~~~C~~C~~l~  104 (337)
T PF04997_consen   39 IKGGLYDPRLGPIDKKQICSTCGLNYTECPGHFGHIELALPVYHPGFFKEIPKILRCICKKCSRLL  104 (337)
T ss_dssp             BSSSSSSSSSS-SSSSSTSSSSSSSSSSCCCSEEEEEEEEEEETCCCHHHHHHHHTTSCTTTSCTS
T ss_pred             ccccccChhhcCCCcccccccccccccccCCceeEEEeCHHHHhhcccccceeeeccccccccccc
Confidence            3445566554444444578888877653     2455555678876443         66666655


No 138
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=24.75  E-value=49  Score=23.21  Aligned_cols=28  Identities=18%  Similarity=0.342  Sum_probs=19.4

Q ss_pred             CCCCccCCcccCceEEeCCCeecccCcccc
Q psy3656         142 PRCSYCNGPILDKCVTALEKTWHTEHFFCA  171 (185)
Q Consensus       142 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~  171 (185)
                      -.|..|+.+  +..|...++.|-..|-.|.
T Consensus        94 VlC~~C~sp--dT~l~k~~r~~~l~C~aCG  121 (125)
T PF01873_consen   94 VLCPECGSP--DTELIKEGRLIFLKCKACG  121 (125)
T ss_dssp             SSCTSTSSS--SEEEEEETTCCEEEETTTS
T ss_pred             EEcCCCCCC--ccEEEEcCCEEEEEecccC
Confidence            679999877  3444445888877776664


No 139
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=24.58  E-value=63  Score=17.55  Aligned_cols=29  Identities=31%  Similarity=0.637  Sum_probs=12.7

Q ss_pred             Ccccccccccc-cceeeecCcccccCCccCCCCCC
Q psy3656          83 GCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQ  116 (185)
Q Consensus        83 ~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~  116 (185)
                      .+|..|+--|. -..+...++.|     +|..|+.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~w-----~C~~C~~   32 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKTW-----ICNFCGT   32 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTEE-----EETTT--
T ss_pred             cccCCCCCEECCcceEcCCCCEE-----ECcCCCC
Confidence            45777777663 23344445555     6666654


No 140
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=24.53  E-value=83  Score=30.85  Aligned_cols=48  Identities=17%  Similarity=0.398  Sum_probs=0.0

Q ss_pred             cccccccccccceeeecCcccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhhccCC-----CCCccCCcccC
Q psy3656          84 CCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSP-----RCSYCNGPILD  153 (185)
Q Consensus        84 ~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~~~~~-----~C~~C~~~i~~  153 (185)
                      +|..|+..+..              +.|..|+..+        .-...|..|-...-..     .|..|+.++..
T Consensus       669 kCPkCG~~t~~--------------~fCP~CGs~t--------e~vy~CPsCGaev~~des~a~~CP~CGtplv~  721 (1337)
T PRK14714        669 RCPSCGTETYE--------------NRCPDCGTHT--------EPVYVCPDCGAEVPPDESGRVECPRCDVELTP  721 (1337)
T ss_pred             ECCCCCCcccc--------------ccCcccCCcC--------CCceeCccCCCccCCCccccccCCCCCCcccc


No 141
>KOG3576|consensus
Probab=24.48  E-value=4.2  Score=31.09  Aligned_cols=10  Identities=30%  Similarity=0.660  Sum_probs=4.9

Q ss_pred             Cccccccccc
Q psy3656          83 GCCSSCDKPI   92 (185)
Q Consensus        83 ~~C~~C~~~i   92 (185)
                      -.|..|+|..
T Consensus       118 ftCrvCgK~F  127 (267)
T KOG3576|consen  118 FTCRVCGKKF  127 (267)
T ss_pred             eeeehhhhhh
Confidence            3455555543


No 142
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=24.34  E-value=31  Score=16.72  Aligned_cols=10  Identities=50%  Similarity=1.344  Sum_probs=6.1

Q ss_pred             cccccCCCcc
Q psy3656         168 FFCAQCGKQF  177 (185)
Q Consensus       168 f~C~~C~~~l  177 (185)
                      |.|..|++.+
T Consensus        15 ~~C~~C~k~F   24 (26)
T PF13465_consen   15 YKCPYCGKSF   24 (26)
T ss_dssp             EEESSSSEEE
T ss_pred             CCCCCCcCee
Confidence            5666666654


No 143
>smart00355 ZnF_C2H2 zinc finger.
Probab=24.17  E-value=39  Score=15.24  Aligned_cols=12  Identities=42%  Similarity=1.146  Sum_probs=8.1

Q ss_pred             cccccCCCccCC
Q psy3656         168 FFCAQCGKQFGE  179 (185)
Q Consensus       168 f~C~~C~~~l~~  179 (185)
                      |.|..|++.+..
T Consensus         1 ~~C~~C~~~f~~   12 (26)
T smart00355        1 YRCPECGKVFKS   12 (26)
T ss_pred             CCCCCCcchhCC
Confidence            467778777644


No 144
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=23.97  E-value=41  Score=22.16  Aligned_cols=19  Identities=26%  Similarity=0.765  Sum_probs=13.6

Q ss_pred             chhhccC--CCCCccCCcccC
Q psy3656         135 DYHNLFS--PRCSYCNGPILD  153 (185)
Q Consensus       135 ~~~~~~~--~~C~~C~~~i~~  153 (185)
                      ||.++..  ++|+.|+.++-|
T Consensus        26 h~~kK~~~~p~C~~cg~pL~G   46 (93)
T COG2174          26 HYEKKKPTIPKCAICGRPLGG   46 (93)
T ss_pred             eeeeccCCCCcccccCCccCC
Confidence            3554444  789999998865


No 145
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=23.24  E-value=57  Score=27.86  Aligned_cols=33  Identities=27%  Similarity=0.805  Sum_probs=23.7

Q ss_pred             CCCCCccCCcccCceEEeCCCeecccCcccccCCCccCCCCe
Q psy3656         141 SPRCSYCNGPILDKCVTALEKTWHTEHFFCAQCGKQFGEAMV  182 (185)
Q Consensus       141 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~  182 (185)
                      .|+|..|+..     |...|+.    -|+|..|+..+....+
T Consensus       350 ~p~Cp~Cg~~-----m~S~G~~----g~rC~kCg~~~~~~~~  382 (421)
T COG1571         350 NPVCPRCGGR-----MKSAGRN----GFRCKKCGTRARETLI  382 (421)
T ss_pred             CCCCCccCCc-----hhhcCCC----CcccccccccCCcccc
Confidence            3789999876     3445554    6899999988766544


No 146
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=23.22  E-value=61  Score=19.64  Aligned_cols=11  Identities=36%  Similarity=0.905  Sum_probs=7.2

Q ss_pred             CCCCccCCccc
Q psy3656         142 PRCSYCNGPIL  152 (185)
Q Consensus       142 ~~C~~C~~~i~  152 (185)
                      +.|.+|+..|.
T Consensus        10 ~~CtSCg~~i~   20 (61)
T COG2888          10 PVCTSCGREIA   20 (61)
T ss_pred             ceeccCCCEec
Confidence            56777777663


No 147
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=22.64  E-value=23  Score=19.43  Aligned_cols=27  Identities=15%  Similarity=0.310  Sum_probs=17.1

Q ss_pred             CCCccCCccc-Cc-eE-EeCCCeecccCcc
Q psy3656         143 RCSYCNGPIL-DK-CV-TALEKTWHTEHFF  169 (185)
Q Consensus       143 ~C~~C~~~i~-~~-~~-~~~~~~~H~~Cf~  169 (185)
                      .|..|.+.+. ++ .+ ..-++.||.+|+.
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~   31 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCIK   31 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHHH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHHH
Confidence            4777877775 22 22 2347888888764


No 148
>PF13832 zf-HC5HC2H_2:  PHD-zinc-finger like domain
Probab=22.17  E-value=55  Score=21.88  Aligned_cols=29  Identities=21%  Similarity=0.516  Sum_probs=18.8

Q ss_pred             ccCCCCCccCCcccCceEEeC----CCeecccCc
Q psy3656         139 LFSPRCSYCNGPILDKCVTAL----EKTWHTEHF  168 (185)
Q Consensus       139 ~~~~~C~~C~~~i~~~~~~~~----~~~~H~~Cf  168 (185)
                      ++..+|..|++. .|-.+.-.    ...||+.|-
T Consensus        53 ~~~~~C~iC~~~-~G~~i~C~~~~C~~~fH~~CA   85 (110)
T PF13832_consen   53 RFKLKCSICGKS-GGACIKCSHPGCSTAFHPTCA   85 (110)
T ss_pred             hcCCcCcCCCCC-CceeEEcCCCCCCcCCCHHHH
Confidence            456788888887 44444422    477888774


No 149
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=21.98  E-value=73  Score=30.63  Aligned_cols=30  Identities=20%  Similarity=0.506  Sum_probs=18.9

Q ss_pred             CCcccccccccccceeeecCcccccCCccCCCCCCCC
Q psy3656          82 KGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQEL  118 (185)
Q Consensus        82 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L  118 (185)
                      ..+|..|+..|-   +.++|..|    -.|..|+-++
T Consensus        17 ~qiCqICGD~vg---~~~~Ge~F----VAC~eC~FPV   46 (1079)
T PLN02638         17 GQVCQICGDNVG---KTVDGEPF----VACDVCAFPV   46 (1079)
T ss_pred             CceeeecccccC---cCCCCCEE----EEeccCCCcc
Confidence            468999998872   23445545    3566666655


No 150
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=21.81  E-value=1.8e+02  Score=23.89  Aligned_cols=10  Identities=20%  Similarity=0.703  Sum_probs=7.4

Q ss_pred             CCcccccccc
Q psy3656          82 KGCCSSCDKP   91 (185)
Q Consensus        82 ~~~C~~C~~~   91 (185)
                      ...|..||..
T Consensus       187 ~~~CPvCGs~  196 (309)
T PRK03564        187 RQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCc
Confidence            4678888864


No 151
>PLN02436 cellulose synthase A
Probab=21.63  E-value=79  Score=30.39  Aligned_cols=31  Identities=23%  Similarity=0.599  Sum_probs=19.3

Q ss_pred             CCCcccccccccccceeeecCcccccCCccCCCCCCCC
Q psy3656          81 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQEL  118 (185)
Q Consensus        81 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L  118 (185)
                      ...+|..|+..|-   +.++|..|    -.|..|+-++
T Consensus        35 ~~~iCqICGD~Vg---~t~dGe~F----VACn~C~fpv   65 (1094)
T PLN02436         35 SGQTCQICGDEIE---LTVDGEPF----VACNECAFPV   65 (1094)
T ss_pred             CCccccccccccC---cCCCCCEE----EeeccCCCcc
Confidence            3568999998872   23455545    3566666655


No 152
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=21.62  E-value=67  Score=18.99  Aligned_cols=25  Identities=24%  Similarity=0.401  Sum_probs=17.5

Q ss_pred             CCCCccCCcccC----ceEEeCCCeeccc
Q psy3656         142 PRCSYCNGPILD----KCVTALEKTWHTE  166 (185)
Q Consensus       142 ~~C~~C~~~i~~----~~~~~~~~~~H~~  166 (185)
                      ..|.-|+..|.+    ++|...+++|+=-
T Consensus         4 ~~C~f~g~~I~PG~G~~~Vr~Dgkv~~F~   32 (54)
T cd00472           4 EKCSFCGYKIYPGHGKMYVRNDGKVFRFC   32 (54)
T ss_pred             EEecCcCCeecCCCccEEEecCCCEEEEE
Confidence            468889998874    3566677777643


No 153
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=21.57  E-value=45  Score=21.72  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=6.6

Q ss_pred             CCCccCCccc
Q psy3656         143 RCSYCNGPIL  152 (185)
Q Consensus       143 ~C~~C~~~i~  152 (185)
                      .|..|+.+|.
T Consensus         2 ~C~HCg~~~p   11 (88)
T PF12156_consen    2 KCYHCGLPVP   11 (88)
T ss_pred             CCCCCCCCCC
Confidence            4667777764


No 154
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=21.53  E-value=1.3e+02  Score=23.77  Aligned_cols=19  Identities=32%  Similarity=0.538  Sum_probs=13.8

Q ss_pred             CCCCCccCC-cccCceEEeC
Q psy3656         141 SPRCSYCNG-PILDKCVTAL  159 (185)
Q Consensus       141 ~~~C~~C~~-~i~~~~~~~~  159 (185)
                      -++|..|+. .|.+.++-+.
T Consensus       146 ~p~C~~Cg~~~lrP~VV~fG  165 (250)
T COG0846         146 IPRCPKCGGPVLRPDVVWFG  165 (250)
T ss_pred             CCcCccCCCccccCCEEEeC
Confidence            388999999 6667666543


No 156
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=21.46  E-value=52  Score=22.23  Aligned_cols=33  Identities=12%  Similarity=0.428  Sum_probs=23.3

Q ss_pred             cccccCCccCCCCCCCCCCCCeeeeCCcCCCccchhh
Q psy3656         102 KTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHN  138 (185)
Q Consensus       102 ~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~yC~~~~~~  138 (185)
                      ..+...--.|..|    ++..|++.++.+.|..|-.+
T Consensus        29 g~~~va~daCeiC----~~~GY~q~g~~lvC~~C~~~   61 (102)
T PF10080_consen   29 GSYRVAFDACEIC----GPKGYYQEGDQLVCKNCGVR   61 (102)
T ss_pred             CCEEEEEEecccc----CCCceEEECCEEEEecCCCE
Confidence            3444444467888    45678899999999988544


No 157
>PF14279 HNH_5:  HNH endonuclease
Probab=21.34  E-value=32  Score=21.52  Aligned_cols=22  Identities=23%  Similarity=0.688  Sum_probs=16.2

Q ss_pred             EeCCCeecccCcccccCCCccCC
Q psy3656         157 TALEKTWHTEHFFCAQCGKQFGE  179 (185)
Q Consensus       157 ~~~~~~~H~~Cf~C~~C~~~l~~  179 (185)
                      .+.|..++... .|..|+..||.
T Consensus        21 ~sLGG~~~~~~-vC~~CN~~~g~   42 (71)
T PF14279_consen   21 ESLGGKLKINN-VCDKCNNKFGS   42 (71)
T ss_pred             hhcCCcccccc-hhHHHhHHHhH
Confidence            56677777777 88888877753


No 158
>PRK11595 DNA utilization protein GntX; Provisional
Probab=21.16  E-value=68  Score=24.69  Aligned_cols=10  Identities=40%  Similarity=1.045  Sum_probs=5.6

Q ss_pred             Cccccccccc
Q psy3656          83 GCCSSCDKPI   92 (185)
Q Consensus        83 ~~C~~C~~~i   92 (185)
                      +.|..|++.+
T Consensus         6 ~~C~~C~~~~   15 (227)
T PRK11595          6 GLCWLCRMPL   15 (227)
T ss_pred             CcCccCCCcc
Confidence            3466666554


No 159
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=21.15  E-value=66  Score=23.96  Aligned_cols=18  Identities=22%  Similarity=0.371  Sum_probs=12.9

Q ss_pred             eeeeCCcCCCccchhhcc
Q psy3656         123 FFERDSRPYCEPDYHNLF  140 (185)
Q Consensus       123 ~~~~~g~~yC~~~~~~~~  140 (185)
                      ++.-+-.++|..|..-+|
T Consensus       154 ~~~F~~~lFC~~ClFPLF  171 (173)
T PF11077_consen  154 FTYFNFNLFCKNCLFPLF  171 (173)
T ss_pred             EEecChhhcccccCcccc
Confidence            557777888888866555


No 160
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=20.97  E-value=26  Score=23.55  Aligned_cols=11  Identities=36%  Similarity=0.842  Sum_probs=8.5

Q ss_pred             eeCCcCCCccc
Q psy3656         125 ERDSRPYCEPD  135 (185)
Q Consensus       125 ~~~g~~yC~~~  135 (185)
                      ..+|++||.+|
T Consensus        88 ~~~g~~iC~DC   98 (99)
T PF13834_consen   88 EKDGQPICRDC   98 (99)
T ss_pred             ccCCCEecccc
Confidence            56788888877


No 161
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=20.90  E-value=1.8e+02  Score=19.31  Aligned_cols=34  Identities=26%  Similarity=0.525  Sum_probs=16.0

Q ss_pred             CCCCccCCcccCceEEeCC-CeecccCcccccCCCc
Q psy3656         142 PRCSYCNGPILDKCVTALE-KTWHTEHFFCAQCGKQ  176 (185)
Q Consensus       142 ~~C~~C~~~i~~~~~~~~~-~~~H~~Cf~C~~C~~~  176 (185)
                      .+=+.|+..+.+..|.+.. +-|-.- -+|..|+..
T Consensus        42 DRas~C~g~M~Pi~v~~~~~g~w~ii-HrC~~Cg~l   76 (92)
T PF12647_consen   42 DRASDCGGRMEPIAVWVRRDGEWMII-HRCTRCGEL   76 (92)
T ss_pred             CccccCCCeeeEEEEEEEcCCCEEEE-EecCCCCCc
Confidence            3444566665555454433 333221 145666553


No 162
>PLN02400 cellulose synthase
Probab=20.24  E-value=83  Score=30.27  Aligned_cols=31  Identities=19%  Similarity=0.594  Sum_probs=18.7

Q ss_pred             CCCcccccccccccceeeecCcccccCCccCCCCCCCC
Q psy3656          81 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQEL  118 (185)
Q Consensus        81 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~L  118 (185)
                      ...+|..|+..|-   +..+|..|    -.|..|.-++
T Consensus        35 ~gqiCqICGD~VG---~t~dGe~F----VAC~eCaFPV   65 (1085)
T PLN02400         35 NGQICQICGDDVG---VTETGDVF----VACNECAFPV   65 (1085)
T ss_pred             CCceeeecccccC---cCCCCCEE----EEEccCCCcc
Confidence            3568999998872   23444444    3556665555


No 163
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=20.24  E-value=58  Score=18.78  Aligned_cols=22  Identities=14%  Similarity=0.304  Sum_probs=13.6

Q ss_pred             CcCCCccchhhcc--CCCCCccCC
Q psy3656         128 SRPYCEPDYHNLF--SPRCSYCNG  149 (185)
Q Consensus       128 g~~yC~~~~~~~~--~~~C~~C~~  149 (185)
                      .+..|..||.++-  +..|..|+-
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            3456777776543  256777764


No 164
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=20.20  E-value=1e+02  Score=22.96  Aligned_cols=30  Identities=20%  Similarity=0.503  Sum_probs=21.0

Q ss_pred             CCccccccccc-ccceeeecCcccccCCccCCCCCCCCC
Q psy3656          82 KGCCSSCDKPI-VGQVITALGKTWHPEHFICTHCNQELG  119 (185)
Q Consensus        82 ~~~C~~C~~~i-~~~~~~~~~~~~H~~Cf~C~~C~~~L~  119 (185)
                      .-.|..|+... +.+.+   .     .-|.|..|+..|.
T Consensus       117 ~Y~Cp~C~~rytf~eA~---~-----~~F~Cp~Cg~~L~  147 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAM---E-----YGFRCPQCGEMLE  147 (178)
T ss_pred             EEECCCCCcEEeHHHHh---h-----cCCcCCCCCCCCe
Confidence            44799999777 33332   2     2589999999884


Done!