Diaphorina citri psyllid: psy369


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MGVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPTSSVSGTVQITITSDS
ccccccccccccccccEEEEEccccccccccccccccEEEcccEEEEEEECccHHHHHHHHHHHHHccccccCEEEEEEcccEEEEEcccccccccccEEEEEcccc
********RQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGL************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPTSSVSGTVQITITSDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
JNK-interacting protein 1 The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins.confidentQ9W0K0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000165 [BP]MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HQC, chain A
Confidence level:very confident
Coverage over the Query: 35-93
View the alignment between query and template
View the model in PyMOL
Template: 2FPF, chain A
Confidence level:confident
Coverage over the Query: 2-22
View the alignment between query and template
View the model in PyMOL