Query         psy370
Match_columns 111
No_of_seqs    105 out of 1485
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 23:20:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy370.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/370hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 5.7E-23 1.2E-27  130.0   4.4   85   20-108   159-243 (279)
  2 KOG2462|consensus               99.9 3.2E-22 6.8E-27  126.7   3.3   82   18-101   183-264 (279)
  3 KOG3623|consensus               99.7 2.4E-17 5.1E-22  115.9   3.5   85   18-104   890-974 (1007)
  4 KOG3576|consensus               99.6 7.1E-17 1.5E-21   98.9   0.2   86   18-105   113-198 (267)
  5 KOG3623|consensus               99.5 2.3E-15   5E-20  106.1   0.6   83   18-102   236-331 (1007)
  6 KOG3576|consensus               99.4 2.4E-14 5.1E-19   87.9   1.3   95   14-108   137-240 (267)
  7 KOG1074|consensus               99.3 5.3E-13 1.2E-17   95.4   2.5   84   19-104   602-692 (958)
  8 PHA00733 hypothetical protein   99.2 1.1E-11 2.4E-16   72.3   3.1   81   20-104    38-123 (128)
  9 KOG3608|consensus               99.2 7.6E-12 1.6E-16   82.5   2.5   80   22-104   237-316 (467)
 10 KOG3608|consensus               99.2 9.4E-12   2E-16   82.1   1.9   92   15-110   200-293 (467)
 11 PHA02768 hypothetical protein;  99.1 7.4E-11 1.6E-15   58.3   2.1   41   51-95      6-46  (55)
 12 PHA02768 hypothetical protein;  99.0 3.3E-10 7.1E-15   56.1   2.3   44   22-67      5-48  (55)
 13 KOG1074|consensus               99.0 3.4E-10 7.3E-15   81.5   2.7   53   22-74    879-931 (958)
 14 PLN03086 PRLI-interacting fact  98.9 5.2E-09 1.1E-13   73.7   7.0   84   13-103   444-537 (567)
 15 PF13465 zf-H2C2_2:  Zinc-finge  98.9 2.5E-09 5.3E-14   45.5   2.5   25   65-91      1-25  (26)
 16 PLN03086 PRLI-interacting fact  98.8 9.3E-09   2E-13   72.5   5.5   79   21-105   477-565 (567)
 17 PHA00733 hypothetical protein   98.8 1.5E-08 3.2E-13   59.2   5.4   56   17-74     68-123 (128)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.7 1.6E-08 3.5E-13   43.0   2.2   25   37-61      1-25  (26)
 19 PHA00616 hypothetical protein   98.6 2.5E-08 5.4E-13   47.1   1.9   34   22-55      1-34  (44)
 20 PHA00732 hypothetical protein   98.6 4.9E-08 1.1E-12   52.3   3.2   45   22-72      1-46  (79)
 21 KOG3993|consensus               98.3 6.1E-08 1.3E-12   65.6  -0.6   89   20-108   265-384 (500)
 22 PHA00732 hypothetical protein   98.3 6.9E-07 1.5E-11   47.9   2.9   52   50-109     1-53  (79)
 23 PF05605 zf-Di19:  Drought indu  98.2 2.3E-06 4.9E-11   42.6   3.4   51   51-104     3-53  (54)
 24 PHA00616 hypothetical protein   98.2 7.7E-07 1.7E-11   42.1   1.4   34   50-85      1-34  (44)
 25 PF00096 zf-C2H2:  Zinc finger,  98.2 1.5E-06 3.2E-11   35.6   1.8   23   23-45      1-23  (23)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2 5.3E-07 1.1E-11   37.0   0.3   22   81-102     1-22  (23)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.1 1.7E-06 3.7E-11   36.8   1.6   26   80-105     1-26  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.0 1.6E-06 3.4E-11   35.6   0.8   24   81-104     1-24  (24)
 29 PF05605 zf-Di19:  Drought indu  98.0   3E-05 6.6E-10   38.5   4.5   50   22-74      2-53  (54)
 30 COG5189 SFP1 Putative transcri  97.9 3.5E-06 7.5E-11   55.6   0.9   71   20-102   347-420 (423)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.9   6E-06 1.3E-10   45.8   1.4   72   24-103     1-73  (100)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.4E-05   3E-10   33.9   1.4   24   22-45      1-24  (27)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.7 3.2E-05 6.9E-10   31.5   2.0   23   23-45      1-23  (24)
 34 KOG3993|consensus               97.4 4.8E-05   1E-09   52.0   0.2   56   50-107   267-322 (500)
 35 smart00355 ZnF_C2H2 zinc finge  97.3 0.00028 6.1E-09   29.0   2.5   23   23-45      1-23  (26)
 36 smart00355 ZnF_C2H2 zinc finge  97.2 0.00013 2.7E-09   30.1   0.5   23   81-103     1-23  (26)
 37 PRK04860 hypothetical protein;  97.1 0.00044 9.6E-09   42.0   2.3   39   50-94    119-157 (160)
 38 PF12874 zf-met:  Zinc-finger o  97.0 0.00042   9E-09   28.6   1.3   22   23-44      1-22  (25)
 39 PF12874 zf-met:  Zinc-finger o  96.9 0.00046   1E-08   28.5   0.9   22   81-102     1-22  (25)
 40 PF12171 zf-C2H2_jaz:  Zinc-fin  96.8 0.00065 1.4E-08   28.7   1.1   22   81-102     2-23  (27)
 41 PF09237 GAGA:  GAGA factor;  I  96.7  0.0024 5.1E-08   31.1   2.7   22   50-71     24-45  (54)
 42 PF13909 zf-H2C2_5:  C2H2-type   96.7 0.00056 1.2E-08   28.0   0.4   23   81-104     1-23  (24)
 43 PRK04860 hypothetical protein;  96.6  0.0013 2.9E-08   39.9   1.8   38   22-63    119-156 (160)
 44 PF09237 GAGA:  GAGA factor;  I  96.3   0.011 2.4E-07   28.8   3.5   33   18-50     20-52  (54)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3  0.0011 2.4E-08   28.0   0.0   21   23-43      2-22  (27)
 46 PF13913 zf-C2HC_2:  zinc-finge  96.1  0.0027 5.8E-08   26.4   0.9   21   81-102     3-23  (25)
 47 smart00451 ZnF_U1 U1-like zinc  95.2   0.015 3.2E-07   25.8   1.5   23   80-102     3-25  (35)
 48 COG4049 Uncharacterized protei  94.0   0.017 3.7E-07   28.6   0.2   28   77-104    14-41  (65)
 49 PF12756 zf-C2H2_2:  C2H2 type   93.6     0.1 2.2E-06   28.5   2.9   23   50-72     50-72  (100)
 50 COG5048 FOG: Zn-finger [Genera  93.5   0.027   6E-07   38.4   0.6   55   50-106   289-349 (467)
 51 KOG2186|consensus               93.3   0.055 1.2E-06   35.1   1.6   47   22-71      3-49  (276)
 52 KOG2231|consensus               93.2    0.17 3.8E-06   37.4   4.1   85   23-108   100-210 (669)
 53 cd00350 rubredoxin_like Rubred  92.1   0.071 1.5E-06   23.5   0.7   11   23-33      2-12  (33)
 54 COG4049 Uncharacterized protei  91.8    0.11 2.4E-06   25.8   1.3   30   15-44     10-39  (65)
 55 COG5048 FOG: Zn-finger [Genera  91.8   0.054 1.2E-06   37.0   0.2   62   21-84    288-355 (467)
 56 COG5189 SFP1 Putative transcri  91.2   0.069 1.5E-06   36.0   0.3   22   20-41    396-417 (423)
 57 PF09538 FYDLN_acid:  Protein o  91.2    0.21 4.5E-06   28.4   2.1   29   24-63     11-39  (108)
 58 cd00729 rubredoxin_SM Rubredox  90.7    0.16 3.5E-06   22.6   1.1   10   79-88     17-26  (34)
 59 PRK06266 transcription initiat  90.0    0.21 4.5E-06   31.0   1.6   31   49-90    116-146 (178)
 60 COG1592 Rubrerythrin [Energy p  89.3    0.25 5.4E-06   30.3   1.5   25   49-88    133-157 (166)
 61 TIGR00373 conserved hypothetic  88.5    0.35 7.5E-06   29.4   1.8   36   45-91    104-139 (158)
 62 KOG1146|consensus               88.2    0.16 3.5E-06   40.1   0.2   25   78-102   516-540 (1406)
 63 KOG1146|consensus               87.8    0.49 1.1E-05   37.6   2.5   83   20-102   463-611 (1406)
 64 PF09986 DUF2225:  Uncharacteri  87.6   0.056 1.2E-06   34.4  -2.1   20   20-39      3-22  (214)
 65 KOG2893|consensus               87.4    0.26 5.7E-06   32.0   0.8   32   24-59     12-43  (341)
 66 smart00531 TFIIE Transcription  87.1    0.48   1E-05   28.4   1.8   41   46-92     95-135 (147)
 67 PRK14890 putative Zn-ribbon RN  86.4    0.86 1.9E-05   23.0   2.1   10   79-88     47-56  (59)
 68 KOG2893|consensus               86.1     0.2 4.4E-06   32.5  -0.2   39   53-97     13-51  (341)
 69 smart00614 ZnF_BED BED zinc fi  85.3    0.64 1.4E-05   22.4   1.4   22   81-102    19-45  (50)
 70 KOG2593|consensus               84.6    0.76 1.6E-05   32.3   2.0   38   18-58    124-161 (436)
 71 KOG2186|consensus               84.6    0.73 1.6E-05   30.1   1.8   46   51-101     4-49  (276)
 72 PF13719 zinc_ribbon_5:  zinc-r  84.1    0.92   2E-05   20.5   1.5   33   52-91      4-36  (37)
 73 COG2888 Predicted Zn-ribbon RN  84.0     1.4 3.1E-05   22.2   2.3   11   78-88     48-58  (61)
 74 PF05290 Baculo_IE-1:  Baculovi  83.4    0.48   1E-05   27.9   0.5   57   20-95     78-136 (140)
 75 PF04959 ARS2:  Arsenite-resist  83.2    0.37 8.1E-06   30.8   0.1   28   78-105    75-102 (214)
 76 TIGR02098 MJ0042_CXXC MJ0042 f  82.8    0.76 1.7E-05   20.6   1.0   11   80-90     25-35  (38)
 77 KOG4167|consensus               82.0    0.21 4.5E-06   37.3  -1.6   27   81-107   793-819 (907)
 78 PF13717 zinc_ribbon_4:  zinc-r  81.9       1 2.3E-05   20.2   1.3   32   52-90      4-35  (36)
 79 PF13878 zf-C2H2_3:  zinc-finge  81.7    0.65 1.4E-05   21.6   0.5   24   81-104    14-39  (41)
 80 TIGR02300 FYDLN_acid conserved  80.1     1.3 2.8E-05   25.9   1.5   29   24-63     11-39  (129)
 81 PRK00464 nrdR transcriptional   80.1    0.41 8.9E-06   29.0  -0.6   12   51-62     29-40  (154)
 82 PF11931 DUF3449:  Domain of un  80.1    0.55 1.2E-05   29.6   0.0   35    9-43     88-123 (196)
 83 KOG4167|consensus               79.8    0.94   2E-05   34.1   1.1   27   20-46    790-816 (907)
 84 COG1198 PriA Primosomal protei  79.0    0.51 1.1E-05   35.5  -0.4   13   77-89    472-484 (730)
 85 PF02892 zf-BED:  BED zinc fing  78.8     1.2 2.5E-05   20.8   0.9   25   78-102    14-42  (45)
 86 COG5236 Uncharacterized conser  78.4       1 2.2E-05   31.0   0.9   26   82-107   222-247 (493)
 87 smart00734 ZnF_Rad18 Rad18-lik  78.0     2.8 6.2E-05   17.3   1.9   18   24-42      3-20  (26)
 88 PRK09678 DNA-binding transcrip  78.0    0.75 1.6E-05   24.2   0.1   18   77-94     24-43  (72)
 89 COG1996 RPC10 DNA-directed RNA  76.8     1.7 3.7E-05   21.1   1.2   12   49-60      5-16  (49)
 90 PF12013 DUF3505:  Protein of u  75.3     1.7 3.7E-05   24.5   1.1   25   81-105    81-109 (109)
 91 TIGR00622 ssl1 transcription f  74.8     4.6  0.0001   23.2   2.7   79   21-104    14-105 (112)
 92 smart00659 RPOLCX RNA polymera  74.2     1.8   4E-05   20.4   0.9   11   80-90     19-29  (44)
 93 KOG4173|consensus               73.2     1.8 3.9E-05   27.6   0.9   77   23-102    80-168 (253)
 94 PF10571 UPF0547:  Uncharacteri  72.0     2.1 4.5E-05   17.8   0.7    9   82-90     16-24  (26)
 95 PF07754 DUF1610:  Domain of un  70.7     2.5 5.5E-05   17.2   0.8   11   78-88     14-24  (24)
 96 KOG2636|consensus               70.4     2.8 6.2E-05   29.8   1.4   35    9-43    388-423 (497)
 97 PF08790 zf-LYAR:  LYAR-type C2  69.9     2.9 6.4E-05   17.7   0.9   20   81-101     1-20  (28)
 98 PF09723 Zn-ribbon_8:  Zinc rib  69.2     2.7 5.8E-05   19.5   0.8   17   81-97      6-22  (42)
 99 smart00834 CxxC_CXXC_SSSS Puta  68.6     2.9 6.3E-05   18.8   0.9   14   81-94      6-19  (41)
100 smart00154 ZnF_AN1 AN1-like Zi  68.3     3.3 7.1E-05   18.9   1.0   14   80-93     12-25  (39)
101 KOG2231|consensus               68.1     6.4 0.00014   29.6   2.9   47   52-104   184-236 (669)
102 KOG2785|consensus               67.2     6.4 0.00014   27.5   2.6   73   22-101   166-241 (390)
103 PF06524 NOA36:  NOA36 protein;  66.5     3.5 7.6E-05   27.3   1.2   86   18-104   138-233 (314)
104 PF02176 zf-TRAF:  TRAF-type zi  66.3     4.7  0.0001   19.8   1.5   42   50-93      9-55  (60)
105 PF04959 ARS2:  Arsenite-resist  65.7       5 0.00011   25.8   1.8   28   19-46     74-102 (214)
106 PRK03824 hypA hydrogenase nick  65.5       2 4.2E-05   25.5  -0.1   13   50-62     70-82  (135)
107 PHA00626 hypothetical protein   65.4     3.8 8.3E-05   20.4   1.0   16   79-94     22-37  (59)
108 KOG2785|consensus               65.1      15 0.00033   25.7   4.0   24   49-72    216-242 (390)
109 PLN03238 probable histone acet  64.4       5 0.00011   26.9   1.6   23   49-71     47-69  (290)
110 PF15269 zf-C2H2_7:  Zinc-finge  62.5      16 0.00035   17.3   3.2   21   23-43     21-41  (54)
111 COG3364 Zn-ribbon containing p  62.0     5.4 0.00012   22.5   1.2   15   22-36      2-16  (112)
112 PF12907 zf-met2:  Zinc-binding  62.0     3.3 7.1E-05   19.2   0.3   25   82-106     3-30  (40)
113 TIGR02605 CxxC_CxxC_SSSS putat  60.6     4.8  0.0001   19.3   0.8   13   81-93      6-18  (52)
114 smart00440 ZnF_C2C2 C2C2 Zinc   60.5     1.1 2.4E-05   20.6  -1.4   12   80-91     28-39  (40)
115 PF01428 zf-AN1:  AN1-like Zinc  60.1     4.2   9E-05   18.9   0.5   15   79-93     12-26  (43)
116 PRK14873 primosome assembly pr  59.9     1.7 3.7E-05   32.5  -1.2    9   80-88    422-430 (665)
117 PF01363 FYVE:  FYVE zinc finge  59.4     7.5 0.00016   19.8   1.5    9   24-32     11-19  (69)
118 PF13451 zf-trcl:  Probable zin  57.9     6.2 0.00013   19.1   0.9   17   78-94      2-18  (49)
119 TIGR00595 priA primosomal prot  56.6     2.4 5.3E-05   30.6  -0.9    9   80-88    253-261 (505)
120 PLN03239 histone acetyltransfe  56.3     6.4 0.00014   27.2   1.1   24   78-101   104-127 (351)
121 COG0068 HypF Hydrogenase matur  56.0     1.8 3.9E-05   32.6  -1.6   60   21-89    121-182 (750)
122 PF08271 TF_Zn_Ribbon:  TFIIB z  56.0     3.7 8.1E-05   19.0  -0.0   12   81-92     20-31  (43)
123 PF10013 DUF2256:  Uncharacteri  55.4     5.1 0.00011   18.7   0.4   13   82-94     10-22  (42)
124 PTZ00064 histone acetyltransfe  55.3     7.4 0.00016   28.3   1.3   33   78-110   278-314 (552)
125 KOG2482|consensus               55.0     5.7 0.00012   27.4   0.7   22   80-101   195-216 (423)
126 PF10537 WAC_Acf1_DNA_bd:  ATP-  54.9      20 0.00044   20.2   2.8   39   20-59      1-39  (102)
127 PF08274 PhnA_Zn_Ribbon:  PhnA   54.8       7 0.00015   16.8   0.8   11   79-89     18-28  (30)
128 KOG3408|consensus               54.8     6.9 0.00015   22.8   0.9   25   78-102    55-79  (129)
129 PLN02294 cytochrome c oxidase   54.7     7.8 0.00017   24.0   1.2   17   77-93    138-154 (174)
130 COG3091 SprT Zn-dependent meta  54.6     6.2 0.00014   23.9   0.8   35   49-90    116-150 (156)
131 PLN00104 MYST -like histone ac  54.6     7.1 0.00015   28.0   1.1   24   78-101   196-219 (450)
132 KOG0320|consensus               53.9      12 0.00027   23.4   2.0   56   18-95    127-182 (187)
133 KOG1842|consensus               53.4     5.1 0.00011   28.6   0.3   28   80-107    15-42  (505)
134 cd00924 Cyt_c_Oxidase_Vb Cytoc  53.2     8.7 0.00019   21.5   1.2   22   69-93     71-92  (97)
135 COG1571 Predicted DNA-binding   53.1     8.8 0.00019   27.3   1.4   13   50-62    367-379 (421)
136 PF05443 ROS_MUCR:  ROS/MUCR tr  53.1      11 0.00023   22.4   1.5   23   22-47     72-94  (132)
137 KOG2747|consensus               52.4     6.3 0.00014   27.7   0.6   33   78-110   156-192 (396)
138 TIGR00100 hypA hydrogenase nic  52.1     8.7 0.00019   22.0   1.1   12   51-62     71-82  (115)
139 PF12760 Zn_Tnp_IS1595:  Transp  51.6      26 0.00056   16.4   2.7   10   79-88     36-45  (46)
140 PF10276 zf-CHCC:  Zinc-finger   51.4     7.8 0.00017   17.9   0.7   12   79-90     28-39  (40)
141 KOG0978|consensus               51.4     6.1 0.00013   29.8   0.5   19   79-97    677-695 (698)
142 PRK12380 hydrogenase nickel in  51.0       9 0.00019   21.9   1.0   12   51-62     71-82  (113)
143 PRK00398 rpoP DNA-directed RNA  50.1     9.8 0.00021   17.8   0.9   29   50-91      3-32  (46)
144 PF08209 Sgf11:  Sgf11 (transcr  50.0      16 0.00035   16.1   1.5   20   80-100     4-23  (33)
145 KOG0717|consensus               49.4      10 0.00023   27.3   1.3   22   23-44    293-314 (508)
146 KOG3214|consensus               49.4     7.1 0.00015   21.9   0.4   43   18-64     19-61  (109)
147 PF01927 Mut7-C:  Mut7-C RNAse   48.5      16 0.00034   21.9   1.8   46   23-68     92-142 (147)
148 PF07975 C1_4:  TFIIH C1-like d  48.0     9.9 0.00022   18.6   0.8   25   79-103    20-44  (51)
149 PRK00564 hypA hydrogenase nick  47.1      12 0.00025   21.6   1.1   12   51-62     72-83  (117)
150 COG1675 TFA1 Transcription ini  46.9      17 0.00037   22.7   1.9   10   81-90    133-142 (176)
151 KOG2593|consensus               45.7      35 0.00077   24.4   3.4   40   46-90    124-163 (436)
152 PF01155 HypA:  Hydrogenase exp  44.5      13 0.00028   21.2   1.0   12   23-34     71-82  (113)
153 PF06397 Desulfoferrod_N:  Desu  43.5       9  0.0002   17.3   0.2   12   21-32      5-16  (36)
154 COG3357 Predicted transcriptio  43.3      10 0.00022   20.9   0.4   14   79-92     57-70  (97)
155 COG1773 Rubredoxin [Energy pro  43.1      13 0.00028   18.5   0.8   12   80-91      3-14  (55)
156 cd00065 FYVE FYVE domain; Zinc  43.0      21 0.00044   17.2   1.5   14   49-62     17-30  (57)
157 PF04423 Rad50_zn_hook:  Rad50   43.0     9.3  0.0002   18.6   0.2   13   24-36     22-34  (54)
158 COG3677 Transposase and inacti  41.5      14  0.0003   21.8   0.8   18   77-94     50-67  (129)
159 COG4338 Uncharacterized protei  41.5      12 0.00026   18.1   0.5   16   52-67     14-29  (54)
160 PF07282 OrfB_Zn_ribbon:  Putat  41.2      46 0.00099   16.8   2.7   17   77-93     43-59  (69)
161 PRK03681 hypA hydrogenase nick  40.6      16 0.00036   20.9   1.0   10   51-60     71-80  (114)
162 PRK05978 hypothetical protein;  40.6      14  0.0003   22.4   0.8    8   23-30     34-41  (148)
163 KOG2907|consensus               40.1      21 0.00045   20.6   1.4   39   51-92     75-114 (116)
164 PRK04023 DNA polymerase II lar  40.0      26 0.00057   28.0   2.2   10   22-31    626-635 (1121)
165 COG1594 RPB9 DNA-directed RNA   39.9       8 0.00017   22.2  -0.3   40   51-92     73-112 (113)
166 smart00064 FYVE Protein presen  39.5      23  0.0005   17.8   1.4   27   24-62     12-38  (68)
167 TIGR00515 accD acetyl-CoA carb  39.3      22 0.00048   24.0   1.6   33   23-64     27-59  (285)
168 COG4391 Uncharacterized protei  39.0      15 0.00031   18.7   0.6   42   43-91     17-59  (62)
169 COG4530 Uncharacterized protei  38.9      15 0.00032   21.1   0.7   16   78-93     24-39  (129)
170 PHA02998 RNA polymerase subuni  38.5     5.8 0.00013   24.7  -1.1   41   51-93    144-184 (195)
171 PF09845 DUF2072:  Zn-ribbon co  38.3      17 0.00036   21.6   0.8   15   22-36      1-15  (131)
172 PRK05580 primosome assembly pr  38.2     7.3 0.00016   29.4  -0.8    9   80-88    421-429 (679)
173 COG2331 Uncharacterized protei  38.1     6.3 0.00014   21.0  -0.8   11   22-32     12-22  (82)
174 COG4888 Uncharacterized Zn rib  37.7      34 0.00073   19.3   1.9   39   18-60     18-56  (104)
175 PF14353 CpXC:  CpXC protein     37.7      11 0.00023   21.9  -0.0   17   80-96     38-54  (128)
176 COG5216 Uncharacterized conser  37.1      21 0.00046   18.0   1.0   12   77-88     41-52  (67)
177 KOG2482|consensus               36.7      27 0.00058   24.3   1.7   24   22-45    195-218 (423)
178 PF01096 TFIIS_C:  Transcriptio  36.1      18 0.00038   16.4   0.6   10   81-90     29-38  (39)
179 COG1997 RPL43A Ribosomal prote  35.6      21 0.00046   19.6   0.9   33   49-93     34-66  (89)
180 COG5112 UFD2 U1-like Zn-finger  35.5      16 0.00034   20.8   0.4   22   80-101    55-76  (126)
181 PRK12496 hypothetical protein;  35.4      29 0.00063   21.3   1.6   11   51-61    128-138 (164)
182 PTZ00043 cytochrome c oxidase   35.1      21 0.00046   23.3   1.0   17   77-93    178-194 (268)
183 COG1326 Uncharacterized archae  34.9      50  0.0011   21.0   2.5   12   79-90     29-40  (201)
184 KOG1280|consensus               34.2      59  0.0013   22.7   3.0   38   20-57     77-116 (381)
185 CHL00174 accD acetyl-CoA carbo  33.9      31 0.00068   23.4   1.7   34   23-65     39-72  (296)
186 COG5236 Uncharacterized conser  33.8      26 0.00057   24.5   1.3   46   25-71    223-272 (493)
187 PF03604 DNA_RNApol_7kD:  DNA d  33.5      30 0.00066   15.0   1.1   10   82-91      2-11  (32)
188 PRK05654 acetyl-CoA carboxylas  33.4      29 0.00063   23.5   1.5   33   23-64     28-60  (292)
189 PF01215 COX5B:  Cytochrome c o  33.3      18 0.00039   21.6   0.4   16   78-93    110-125 (136)
190 PF02748 PyrI_C:  Aspartate car  33.0      25 0.00055   17.2   0.9   17   77-93     32-48  (52)
191 PF04780 DUF629:  Protein of un  32.7      37  0.0008   24.7   1.9   25   23-47     58-83  (466)
192 KOG1994|consensus               32.3      42 0.00091   22.0   2.0   21   80-100   239-259 (268)
193 PF04780 DUF629:  Protein of un  32.3      22 0.00049   25.7   0.8   25   48-72     55-79  (466)
194 KOG1842|consensus               32.0      34 0.00074   24.7   1.7   29   20-48     13-42  (505)
195 PF13824 zf-Mss51:  Zinc-finger  31.8      27 0.00058   17.4   0.8   17   77-93     11-27  (55)
196 TIGR00244 transcriptional regu  31.7      22 0.00048   21.5   0.6   13   81-93     29-41  (147)
197 TIGR01031 rpmF_bact ribosomal   31.5      50  0.0011   16.3   1.8    8   23-30     27-34  (55)
198 PTZ00303 phosphatidylinositol   30.4      34 0.00073   26.9   1.5   32   24-62    462-493 (1374)
199 PRK04351 hypothetical protein;  30.2      32 0.00069   20.8   1.2   14   78-91    130-143 (149)
200 PF00301 Rubredoxin:  Rubredoxi  30.2      27 0.00059   16.7   0.7   12   81-92      2-13  (47)
201 PF01286 XPA_N:  XPA protein N-  30.2      26 0.00056   15.6   0.6   14   81-94      4-17  (34)
202 PF04606 Ogr_Delta:  Ogr/Delta-  29.9      13 0.00028   17.6  -0.5   16   78-93     23-40  (47)
203 PF01780 Ribosomal_L37ae:  Ribo  29.8      23 0.00051   19.5   0.5   32   49-92     34-65  (90)
204 PTZ00448 hypothetical protein;  29.5      50  0.0011   23.2   2.1   23   22-44    314-336 (373)
205 KOG4477|consensus               29.3      54  0.0012   20.7   2.0   27   17-57     19-45  (228)
206 PF12230 PRP21_like_P:  Pre-mRN  29.3      18 0.00039   23.3   0.0   25   79-104   167-191 (229)
207 PF05191 ADK_lid:  Adenylate ki  29.2      19 0.00042   16.1   0.1   10   24-33      3-12  (36)
208 PF11672 DUF3268:  Protein of u  29.0      18 0.00038   20.5  -0.1   10   22-31      2-11  (102)
209 COG5188 PRP9 Splicing factor 3  28.9      42  0.0009   23.6   1.6   33   11-43    363-396 (470)
210 COG5027 SAS2 Histone acetyltra  28.5      28 0.00061   24.3   0.8   25   79-103   157-181 (395)
211 TIGR00280 L37a ribosomal prote  28.2      32  0.0007   19.0   0.8   33   49-93     34-66  (91)
212 smart00661 RPOL9 RNA polymeras  28.1      27 0.00059   16.4   0.5   14   80-93     20-33  (52)
213 TIGR03831 YgiT_finger YgiT-typ  28.0      27 0.00059   15.8   0.5   13   22-34     32-44  (46)
214 PRK00420 hypothetical protein;  27.9      26 0.00056   20.2   0.5    8   51-58     41-48  (112)
215 cd00730 rubredoxin Rubredoxin;  27.6      28  0.0006   16.9   0.5   11   23-33      2-12  (50)
216 COG4640 Predicted membrane pro  27.6      40 0.00087   24.0   1.4   26   15-40      8-33  (465)
217 TIGR00686 phnA alkylphosphonat  27.5      40 0.00086   19.3   1.2   11   50-60     19-29  (109)
218 PRK00762 hypA hydrogenase nick  27.4      21 0.00046   20.7   0.1   11   51-62     71-81  (124)
219 PTZ00255 60S ribosomal protein  27.2      35 0.00075   18.9   0.9   33   49-93     35-67  (90)
220 PF14787 zf-CCHC_5:  GAG-polypr  26.7      38 0.00082   15.3   0.8   14   82-95      4-17  (36)
221 TIGR01206 lysW lysine biosynth  26.6      31 0.00067   17.0   0.6   13   81-93      3-15  (54)
222 KOG2071|consensus               26.6      35 0.00076   25.4   1.0   27   78-104   416-442 (579)
223 COG1327 Predicted transcriptio  26.5      29 0.00063   21.2   0.5   13   81-93     29-41  (156)
224 PF07295 DUF1451:  Protein of u  26.3      19 0.00041   21.7  -0.3   11   49-59    111-121 (146)
225 PF11789 zf-Nse:  Zinc-finger o  26.1      36 0.00078   16.9   0.8   12   51-62     25-36  (57)
226 COG4847 Uncharacterized protei  25.9      33 0.00071   19.2   0.6   13   77-89      3-15  (103)
227 PF14446 Prok-RING_1:  Prokaryo  25.9      23  0.0005   17.5   0.0   14   81-94      6-19  (54)
228 PRK03976 rpl37ae 50S ribosomal  25.9      38 0.00082   18.7   0.9   33   49-93     35-67  (90)
229 PF13821 DUF4187:  Domain of un  25.8      84  0.0018   15.5   2.0   17   81-97     28-44  (55)
230 TIGR00319 desulf_FeS4 desulfof  25.7      42  0.0009   14.5   0.9   12   80-91      7-18  (34)
231 cd00974 DSRD Desulforedoxin (D  25.2      43 0.00093   14.4   0.9   12   80-91      4-15  (34)
232 COG0675 Transposase and inacti  25.0      49  0.0011   22.1   1.5   15   79-93    321-335 (364)
233 PRK14714 DNA polymerase II lar  24.6      74  0.0016   26.3   2.5    9   23-31    668-676 (1337)
234 smart00731 SprT SprT homologue  24.5      44 0.00096   19.8   1.1    9   81-89    134-142 (146)
235 KOG4727|consensus               24.3      46   0.001   20.8   1.1   22   22-43     75-96  (193)
236 PF08792 A2L_zn_ribbon:  A2L zi  24.2      44 0.00096   14.6   0.8   11   81-91     22-32  (33)
237 PRK05452 anaerobic nitric oxid  24.2      44 0.00095   24.2   1.2   17   18-34    421-437 (479)
238 PLN02748 tRNA dimethylallyltra  24.1      65  0.0014   23.5   2.0   24   49-72    417-441 (468)
239 PF11023 DUF2614:  Protein of u  23.5      33 0.00071   19.8   0.3   12   21-32     68-79  (114)
240 COG3024 Uncharacterized protei  23.1      43 0.00094   17.2   0.7   13   81-93      8-20  (65)
241 TIGR01384 TFS_arch transcripti  23.0      13 0.00027   20.7  -1.4   14   21-34     15-28  (104)
242 KOG1701|consensus               22.9      17 0.00036   26.0  -1.1   41   24-66    276-318 (468)
243 PF10263 SprT-like:  SprT-like   22.9      28 0.00061   20.7  -0.0   11   80-90    143-153 (157)
244 TIGR00155 pqiA_fam integral me  22.7      92   0.002   22.2   2.5   10   23-32     14-23  (403)
245 TIGR03829 YokU_near_AblA uncha  22.7      67  0.0015   17.7   1.4   18   22-39     35-52  (89)
246 KOG1940|consensus               22.6      83  0.0018   21.2   2.1   18   23-41    197-214 (276)
247 PF14255 Cys_rich_CPXG:  Cystei  22.6      41 0.00088   16.5   0.6    6   53-58      3-8   (52)
248 PF01844 HNH:  HNH endonuclease  22.6      22 0.00047   16.2  -0.4   11   83-93      1-11  (47)
249 PF06220 zf-U1:  U1 zinc finger  22.5      70  0.0015   14.4   1.3   14   80-93      3-16  (38)
250 COG4306 Uncharacterized protei  22.4      28  0.0006   20.5  -0.1   16   48-63     66-81  (160)
251 PF13453 zf-TFIIB:  Transcripti  22.2      67  0.0015   14.5   1.2   18   80-97     19-36  (41)
252 PRK10220 hypothetical protein;  21.9      36 0.00079   19.5   0.3   29   24-63      5-33  (111)
253 PF14354 Lar_restr_allev:  Rest  21.7      51  0.0011   16.2   0.8    6   83-88     32-37  (61)
254 PF02891 zf-MIZ:  MIZ/SP-RING z  21.5      40 0.00087   16.2   0.4    9   22-30     41-49  (50)
255 PF14311 DUF4379:  Domain of un  21.5      58  0.0013   15.7   1.0   16   80-95     28-43  (55)
256 KOG4118|consensus               20.9      37  0.0008   17.6   0.2   24   81-104    39-62  (74)
257 KOG0782|consensus               20.8     9.2  0.0002   28.5  -2.7   51   37-94    240-290 (1004)
258 KOG1088|consensus               20.8      68  0.0015   18.7   1.3   19   77-95     95-113 (124)
259 PRK01343 zinc-binding protein;  20.7      48   0.001   16.6   0.6   12   22-33      9-20  (57)
260 PRK06260 threonine synthase; V  20.7      72  0.0016   22.4   1.6   29   23-63      4-32  (397)
261 KOG3014|consensus               20.5      41 0.00088   22.3   0.4   23   82-104    39-63  (257)
262 COG1655 Uncharacterized protei  20.5      37  0.0008   22.3   0.2   24   48-71     17-40  (267)
263 KOG3352|consensus               20.5      49  0.0011   20.1   0.7   16   78-93    131-146 (153)
264 COG0846 SIR2 NAD-dependent pro  20.4      70  0.0015   21.2   1.5   13   49-61    121-133 (250)
265 PF10083 DUF2321:  Uncharacteri  20.4      36 0.00078   20.8   0.1   18   77-94     65-82  (158)

No 1  
>KOG2462|consensus
Probab=99.87  E-value=5.7e-23  Score=130.04  Aligned_cols=85  Identities=21%  Similarity=0.461  Sum_probs=74.7

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHHhh
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVATQS   99 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~~h   99 (111)
                      .+.+.|++|++.|.....|..|+++|+  .+++|.+||+.|.+++-|+.|+|.|+  |||||.|+.|++.|..++.|+-|
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHT--GEKPF~C~hC~kAFADRSNLRAH  234 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHT--GEKPFSCPHCGKAFADRSNLRAH  234 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccccccc--CCCCccCCcccchhcchHHHHHH
Confidence            667889999999999989999999887  68899999999999999999999998  89999999999999999999999


Q ss_pred             ccccCcccc
Q psy370          100 SKYPGQQNQ  108 (111)
Q Consensus       100 ~~~~~~~~~  108 (111)
                      +.+|-+..+
T Consensus       235 mQTHS~~K~  243 (279)
T KOG2462|consen  235 MQTHSDVKK  243 (279)
T ss_pred             HHhhcCCcc
Confidence            988876654


No 2  
>KOG2462|consensus
Probab=99.85  E-value=3.2e-22  Score=126.70  Aligned_cols=82  Identities=28%  Similarity=0.619  Sum_probs=77.4

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHH
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVAT   97 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~   97 (111)
                      |..-++.|.+||+.|...=.|+.|+|+|+||+||.|..|+++|...++|.-||+.|.  +.|+|.|..|+|+|...+.|.
T Consensus       183 TH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS--~~K~~qC~~C~KsFsl~SyLn  260 (279)
T KOG2462|consen  183 THTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHS--DVKKHQCPRCGKSFALKSYLN  260 (279)
T ss_pred             ccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhc--CCccccCcchhhHHHHHHHHH
Confidence            334589999999999999999999999999999999999999999999999999998  889999999999999999999


Q ss_pred             hhcc
Q psy370           98 QSSK  101 (111)
Q Consensus        98 ~h~~  101 (111)
                      +|.-
T Consensus       261 KH~E  264 (279)
T KOG2462|consen  261 KHSE  264 (279)
T ss_pred             Hhhh
Confidence            9974


No 3  
>KOG3623|consensus
Probab=99.68  E-value=2.4e-17  Score=115.92  Aligned_cols=85  Identities=22%  Similarity=0.364  Sum_probs=80.1

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHH
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVAT   97 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~   97 (111)
                      +.+..|-|..|+++|-..+.|.+|.--|+|.+||.|.+|.++|..+..|..|+|.|.  |||||.|..|+|+|+.+....
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHS--GEKPfQCdKClKRFSHSGSYS  967 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHS--GEKPFQCDKCLKRFSHSGSYS  967 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhcc--CCCcchhhhhhhhcccccchH
Confidence            556789999999999999999999999999999999999999999999999999998  999999999999999999999


Q ss_pred             hhccccC
Q psy370           98 QSSKYPG  104 (111)
Q Consensus        98 ~h~~~~~  104 (111)
                      +||.-+.
T Consensus       968 QHMNHRY  974 (1007)
T KOG3623|consen  968 QHMNHRY  974 (1007)
T ss_pred             hhhccch
Confidence            9996443


No 4  
>KOG3576|consensus
Probab=99.61  E-value=7.1e-17  Score=98.86  Aligned_cols=86  Identities=22%  Similarity=0.419  Sum_probs=79.3

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHH
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVAT   97 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~   97 (111)
                      .+...|.|.+|++.|.-...|..|++.|...+.+.|..||+.|...-.|..|+|.|+  |-+||+|..|++.|+.+-.|.
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rtht--gvrpykc~~c~kaftqrcsle  190 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHT--GVRPYKCSLCEKAFTQRCSLE  190 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhcccc--CccccchhhhhHHHHhhccHH
Confidence            346679999999999999999999999999999999999999999999999999998  899999999999999999999


Q ss_pred             hhccccCc
Q psy370           98 QSSKYPGQ  105 (111)
Q Consensus        98 ~h~~~~~~  105 (111)
                      .|.+.-|+
T Consensus       191 shl~kvhg  198 (267)
T KOG3576|consen  191 SHLKKVHG  198 (267)
T ss_pred             HHHHHHcC
Confidence            99875554


No 5  
>KOG3623|consensus
Probab=99.51  E-value=2.3e-15  Score=106.11  Aligned_cols=83  Identities=17%  Similarity=0.403  Sum_probs=75.0

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCC-------------CCCccccccCcccCCHHHHHHHHHhccCCCCCceecC
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDN-------------EMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCE   84 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~-------------~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~   84 (111)
                      -.+..|.|..|..+|.....|.+|+.+|..             .+-|+|..||++|..+..|..|+|+|.  |||||+|+
T Consensus       236 kne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHS--GEKPfeCp  313 (1007)
T KOG3623|consen  236 KNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHS--GEKPFECP  313 (1007)
T ss_pred             hCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeec--CCCCcCCc
Confidence            446678999999999999999999988752             255999999999999999999999998  99999999


Q ss_pred             CCccccccchhHHhhccc
Q psy370           85 ICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        85 ~C~~~~~~~~~l~~h~~~  102 (111)
                      .|+|+|+.+..+.+||..
T Consensus       314 nCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  314 NCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccccccCCcccccccc
Confidence            999999999999999853


No 6  
>KOG3576|consensus
Probab=99.44  E-value=2.4e-14  Score=87.90  Aligned_cols=95  Identities=20%  Similarity=0.349  Sum_probs=82.3

Q ss_pred             CCCccccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccC---------CCCCceecC
Q psy370           14 PGSYTIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLS---------MEERGFVCE   84 (111)
Q Consensus        14 ~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~---------~~~~~~~C~   84 (111)
                      .+-|+..+.|-|..||+.|.+.-+|..|.++|+|.+||.|..|+++|...-+|..|++.=++         +.++.|.|+
T Consensus       137 ~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vce  216 (267)
T KOG3576|consen  137 LKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCE  216 (267)
T ss_pred             hhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeec
Confidence            34567788899999999999999999999999999999999999999999999988774322         245779999


Q ss_pred             CCccccccchhHHhhccccCcccc
Q psy370           85 ICGHVVDEMPVATQSSKYPGQQNQ  108 (111)
Q Consensus        85 ~C~~~~~~~~~l~~h~~~~~~~~~  108 (111)
                      .||.+-.....+..|++.+|...-
T Consensus       217 dcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  217 DCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             ccCCCCCChhHHHHHHHhcCCCCH
Confidence            999999999999999999986543


No 7  
>KOG1074|consensus
Probab=99.33  E-value=5.3e-13  Score=95.43  Aligned_cols=84  Identities=23%  Similarity=0.463  Sum_probs=75.6

Q ss_pred             ccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCC----CceecC---CCccccc
Q psy370           19 IFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEE----RGFVCE---ICGHVVD   91 (111)
Q Consensus        19 ~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~----~~~~C~---~C~~~~~   91 (111)
                      ...+-+|-+|-+.....+.|+.|.++|+|++||+|.+||++|.++.+|..|+..|.  -.    .++.|+   .|.+.|.
T Consensus       602 ~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHk--a~p~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  602 RTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHK--AKPPARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             cCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccc--cCccccccccCCchhhhccccc
Confidence            34467899999999999999999999999999999999999999999999999985  22    346799   9999999


Q ss_pred             cchhHHhhccccC
Q psy370           92 EMPVATQSSKYPG  104 (111)
Q Consensus        92 ~~~~l~~h~~~~~  104 (111)
                      +--.|.+|++.|-
T Consensus       680 n~V~lpQhIriH~  692 (958)
T KOG1074|consen  680 NAVTLPQHIRIHL  692 (958)
T ss_pred             ccccccceEEeec
Confidence            9999999999876


No 8  
>PHA00733 hypothetical protein
Probab=99.21  E-value=1.1e-11  Score=72.30  Aligned_cols=81  Identities=21%  Similarity=0.347  Sum_probs=67.6

Q ss_pred             cCcccCCCcccccCCHHHHHHH--HH---HcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccch
Q psy370           20 FVASQCPVCKKIYTDQQLFQNH--LE---THDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMP   94 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h--~~---~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~   94 (111)
                      .+++.|.+|...|.....|..+  .+   .+.+.++|.|..|++.|.....|..|++.+    +.+|.|..|++.|....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h----~~~~~C~~CgK~F~~~~  113 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT----EHSKVCPVCGKEFRNTD  113 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC----CcCccCCCCCCccCCHH
Confidence            5678999999999888777655  21   233478999999999999999999999865    35799999999999999


Q ss_pred             hHHhhccccC
Q psy370           95 VATQSSKYPG  104 (111)
Q Consensus        95 ~l~~h~~~~~  104 (111)
                      .|..|+...|
T Consensus       114 sL~~H~~~~h  123 (128)
T PHA00733        114 STLDHVCKKH  123 (128)
T ss_pred             HHHHHHHHhc
Confidence            9999987665


No 9  
>KOG3608|consensus
Probab=99.20  E-value=7.6e-12  Score=82.53  Aligned_cols=80  Identities=23%  Similarity=0.484  Sum_probs=50.3

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHHhhcc
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      +|.|..|.+.|.++..|..|++.|.  ..|.|+.|+.+....++|.+|++..++ ..+||+|..|.+.|.+-++|.+|.-
T Consensus       237 ~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs-~dkpfKCd~Cd~~c~~esdL~kH~~  313 (467)
T KOG3608|consen  237 SFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHS-KDKPFKCDECDTRCVRESDLAKHVQ  313 (467)
T ss_pred             chHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhc-cCCCccccchhhhhccHHHHHHHHH
Confidence            3444444444444444444444332  346777777777777777777776543 5777888888877777777777776


Q ss_pred             ccC
Q psy370          102 YPG  104 (111)
Q Consensus       102 ~~~  104 (111)
                      +|.
T Consensus       314 ~HS  316 (467)
T KOG3608|consen  314 VHS  316 (467)
T ss_pred             hcc
Confidence            554


No 10 
>KOG3608|consensus
Probab=99.18  E-value=9.4e-12  Score=82.10  Aligned_cols=92  Identities=18%  Similarity=0.483  Sum_probs=60.6

Q ss_pred             CCccccCcccCCCcccccCCHHHHHHHHHHcC--CCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccccc
Q psy370           15 GSYTIFVASQCPVCKKIYTDQQLFQNHLETHD--NEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDE   92 (111)
Q Consensus        15 ~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~h~--~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~   92 (111)
                      .+|+++|..-|+.||..|.++..|..|.+..+  ...+|.|..|-+.|.+...|..|++.|.    .-|+|+.|..+.+.
T Consensus       200 r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv----n~ykCplCdmtc~~  275 (467)
T KOG3608|consen  200 RTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV----NCYKCPLCDMTCSS  275 (467)
T ss_pred             HhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh----hcccccccccCCCC
Confidence            34566666666666666666666665555433  2345666666666666666666666553    35788888888888


Q ss_pred             chhHHhhccccCcccccc
Q psy370           93 MPVATQSSKYPGQQNQLF  110 (111)
Q Consensus        93 ~~~l~~h~~~~~~~~~~~  110 (111)
                      .+.|..|+++.|++.+.|
T Consensus       276 ~ssL~~H~r~rHs~dkpf  293 (467)
T KOG3608|consen  276 ASSLTTHIRYRHSKDKPF  293 (467)
T ss_pred             hHHHHHHHHhhhccCCCc
Confidence            888888998888877655


No 11 
>PHA02768 hypothetical protein; Provisional
Probab=99.08  E-value=7.4e-11  Score=58.34  Aligned_cols=41  Identities=17%  Similarity=0.348  Sum_probs=21.7

Q ss_pred             ccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchh
Q psy370           51 YSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPV   95 (111)
Q Consensus        51 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~   95 (111)
                      |.|+.||+.|...++|..|++.|+    ++++|..|++.|...+.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~----k~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN----TNLKLSNCKRISLRTGE   46 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC----CcccCCcccceecccce
Confidence            455555555555555555555553    35555555555554443


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=98.99  E-value=3.3e-10  Score=56.06  Aligned_cols=44  Identities=20%  Similarity=0.517  Sum_probs=39.1

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHH
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMR   67 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~   67 (111)
                      -|.|++||+.|...+.|..|+++|+  +++.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3799999999999999999999998  6899999999998766553


No 13 
>KOG1074|consensus
Probab=98.96  E-value=3.4e-10  Score=81.49  Aligned_cols=53  Identities=25%  Similarity=0.676  Sum_probs=49.9

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhcc
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHL   74 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   74 (111)
                      ...|.+||+.|...++|++|+++|+++++|.|.+|+++|....+|..||..|.
T Consensus       879 ~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~  931 (958)
T KOG1074|consen  879 AHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHM  931 (958)
T ss_pred             hhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcccc
Confidence            47899999999999999999999999999999999999999999999999886


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.91  E-value=5.2e-09  Score=73.72  Aligned_cols=84  Identities=18%  Similarity=0.366  Sum_probs=62.6

Q ss_pred             CCCCccccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccccc
Q psy370           13 IPGSYTIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDE   92 (111)
Q Consensus        13 ~~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~   92 (111)
                      .-.....++.+.|+.|++.|. ...+..|+..+.  .++.|. |+..+ ....|..|+..|.  .++++.|..|++.|..
T Consensus       444 v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thC--p~Kpi~C~fC~~~v~~  516 (567)
T PLN03086        444 VLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTC--PLRLITCRFCGDMVQA  516 (567)
T ss_pred             eeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccC--CCCceeCCCCCCcccc
Confidence            334556677788999998885 567888888863  778888 88644 5688888888887  6888889989888842


Q ss_pred             ----------chhHHhhcccc
Q psy370           93 ----------MPVATQSSKYP  103 (111)
Q Consensus        93 ----------~~~l~~h~~~~  103 (111)
                                ...|..|...+
T Consensus       517 g~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        517 GGSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             CccccchhhhhhhHHHHHHhc
Confidence                      23577787664


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.86  E-value=2.5e-09  Score=45.50  Aligned_cols=25  Identities=28%  Similarity=0.836  Sum_probs=17.9

Q ss_pred             HHHHHHHhccCCCCCceecCCCccccc
Q psy370           65 DMRKHVHSHLSMEERGFVCEICGHVVD   91 (111)
Q Consensus        65 ~l~~h~~~h~~~~~~~~~C~~C~~~~~   91 (111)
                      +|..|++.|+  |++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~--~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHT--GEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHS--SSSSEEESSSSEEES
T ss_pred             CHHHHhhhcC--CCCCCCCCCCcCeeC
Confidence            3567777776  677777777777775


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.82  E-value=9.3e-09  Score=72.49  Aligned_cols=79  Identities=19%  Similarity=0.288  Sum_probs=66.2

Q ss_pred             CcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccC----------CHHHHHHHHHhccCCCCCceecCCCcccc
Q psy370           21 VASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFN----------CKSDMRKHVHSHLSMEERGFVCEICGHVV   90 (111)
Q Consensus        21 ~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~----------~~~~l~~h~~~h~~~~~~~~~C~~C~~~~   90 (111)
                      +++.|+ ||..+ ....|..|+.+|...+++.|.+|+..+.          ..+.+..|....   |.+++.|..||+.+
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C---G~rt~~C~~Cgk~V  551 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC---GSRTAPCDSCGRSV  551 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc---CCcceEccccCCee
Confidence            678999 99765 6688999999999999999999999884          235788998875   79999999999999


Q ss_pred             ccchhHHhhccccCc
Q psy370           91 DEMPVATQSSKYPGQ  105 (111)
Q Consensus        91 ~~~~~l~~h~~~~~~  105 (111)
                      ..++ +..|+...|.
T Consensus       552 rlrd-m~~H~~~~h~  565 (567)
T PLN03086        552 MLKE-MDIHQIAVHQ  565 (567)
T ss_pred             eehh-HHHHHHHhhc
Confidence            8885 7778766554


No 17 
>PHA00733 hypothetical protein
Probab=98.81  E-value=1.5e-08  Score=59.24  Aligned_cols=56  Identities=18%  Similarity=0.396  Sum_probs=49.4

Q ss_pred             ccccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhcc
Q psy370           17 YTIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHL   74 (111)
Q Consensus        17 ~~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   74 (111)
                      +.++++|.|+.|++.|.....|..|++.+  ..++.|..|++.|.....|..|+...+
T Consensus        68 ~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         68 SKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             cCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            34478999999999999999999999976  357999999999999999999988654


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.68  E-value=1.6e-08  Score=42.96  Aligned_cols=25  Identities=32%  Similarity=0.739  Sum_probs=22.6

Q ss_pred             HHHHHHHHcCCCCCccccccCcccC
Q psy370           37 LFQNHLETHDNEMDYSCEHCDMQFN   61 (111)
Q Consensus        37 ~l~~h~~~h~~~~~~~c~~c~~~f~   61 (111)
                      +|..|+++|+++++|.|..|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4789999999999999999999885


No 19 
>PHA00616 hypothetical protein
Probab=98.62  E-value=2.5e-08  Score=47.14  Aligned_cols=34  Identities=21%  Similarity=0.341  Sum_probs=27.3

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccc
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEH   55 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~   55 (111)
                      +|+|..||+.|...+.+..|++.|++++++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5788888888888888888888888888777653


No 20 
>PHA00732 hypothetical protein
Probab=98.61  E-value=4.9e-08  Score=52.33  Aligned_cols=45  Identities=20%  Similarity=0.498  Sum_probs=29.3

Q ss_pred             cccCCCcccccCCHHHHHHHHHH-cCCCCCccccccCcccCCHHHHHHHHHh
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLET-HDNEMDYSCEHCDMQFNCKSDMRKHVHS   72 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~c~~~f~~~~~l~~h~~~   72 (111)
                      +|.|..|++.|.....|..|++. |.+   +.|..|++.|.   .+..|...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhcc
Confidence            46677777777777777777763 442   36777777776   35555543


No 21 
>KOG3993|consensus
Probab=98.35  E-value=6.1e-08  Score=65.64  Aligned_cols=89  Identities=20%  Similarity=0.419  Sum_probs=66.4

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCC------C----------------
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSM------E----------------   77 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~------~----------------   77 (111)
                      ...|.|..|...|-+.-.|-+|.=.-.-...|.|..|++.|.-+.+|..|+|=|.-+      +                
T Consensus       265 iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  265 IGDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            335888888888887777777754333445688888888888888888887755210      0                


Q ss_pred             ---------CCceecCCCccccccchhHHhhccccCcccc
Q psy370           78 ---------ERGFVCEICGHVVDEMPVATQSSKYPGQQNQ  108 (111)
Q Consensus        78 ---------~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~  108 (111)
                               +--|.|..|++.|.+...|.+|+-+|+...+
T Consensus       345 a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~  384 (500)
T KOG3993|consen  345 AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPL  384 (500)
T ss_pred             ccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhcccc
Confidence                     1138899999999999999999998886654


No 22 
>PHA00732 hypothetical protein
Probab=98.31  E-value=6.9e-07  Score=47.92  Aligned_cols=52  Identities=15%  Similarity=0.271  Sum_probs=42.9

Q ss_pred             CccccccCcccCCHHHHHHHHHh-ccCCCCCceecCCCccccccchhHHhhccccCccccc
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVHS-HLSMEERGFVCEICGHVVDEMPVATQSSKYPGQQNQL  109 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~~-h~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~  109 (111)
                      +|.|..|++.|....++..|++. |.     ++.|+.|++.|.   .+..|+++..+-..|
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~-----~~~C~~CgKsF~---~l~~H~~~~~~~~~~   53 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT-----LTKCPVCNKSYR---RLNQHFYSQYDIEHL   53 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC-----CCccCCCCCEeC---ChhhhhcccCCccce
Confidence            57899999999999999999985 54     358999999998   477888777665554


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.21  E-value=2.3e-06  Score=42.65  Aligned_cols=51  Identities=20%  Similarity=0.404  Sum_probs=20.5

Q ss_pred             ccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHHhhccccC
Q psy370           51 YSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        51 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      |.|++|++. .....|..|....+....+.+.|+.|...+.  ..|..|+..+|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            344444442 2233444443322111223445555554333  24555554443


No 24 
>PHA00616 hypothetical protein
Probab=98.19  E-value=7.7e-07  Score=42.09  Aligned_cols=34  Identities=24%  Similarity=0.404  Sum_probs=25.8

Q ss_pred             CccccccCcccCCHHHHHHHHHhccCCCCCceecCC
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEI   85 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~   85 (111)
                      +|.|..||..|...+.+..|++.|+  |++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h--g~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH--KQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc--CCCccceeE
Confidence            4678888888888888888888777  677776654


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.17  E-value=1.5e-06  Score=35.59  Aligned_cols=23  Identities=26%  Similarity=0.843  Sum_probs=16.3

Q ss_pred             ccCCCcccccCCHHHHHHHHHHc
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETH   45 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h   45 (111)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777653


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.15  E-value=5.3e-07  Score=36.97  Aligned_cols=22  Identities=18%  Similarity=0.507  Sum_probs=15.5

Q ss_pred             eecCCCccccccchhHHhhccc
Q psy370           81 FVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777664


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.12  E-value=1.7e-06  Score=36.83  Aligned_cols=26  Identities=15%  Similarity=0.461  Sum_probs=20.5

Q ss_pred             ceecCCCccccccchhHHhhccccCc
Q psy370           80 GFVCEICGHVVDEMPVATQSSKYPGQ  105 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~~~~~~  105 (111)
                      +|.|..|++.|.+..+|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            47788888888888888888877764


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.05  E-value=1.6e-06  Score=35.61  Aligned_cols=24  Identities=25%  Similarity=0.463  Sum_probs=16.1

Q ss_pred             eecCCCccccccchhHHhhccccC
Q psy370           81 FVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      |.|+.|++.|.+..+|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777776654


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.95  E-value=3e-05  Score=38.54  Aligned_cols=50  Identities=24%  Similarity=0.535  Sum_probs=38.7

Q ss_pred             cccCCCcccccCCHHHHHHHHHH-cCCC-CCccccccCcccCCHHHHHHHHHhcc
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLET-HDNE-MDYSCEHCDMQFNCKSDMRKHVHSHL   74 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~-h~~~-~~~~c~~c~~~f~~~~~l~~h~~~h~   74 (111)
                      .|.|+.|++ ..+...|..|... |..+ +.+.|++|...+.  .++..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            589999999 6667889999765 6653 5799999997543  48888887653


No 30 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.91  E-value=3.5e-06  Score=55.61  Aligned_cols=71  Identities=21%  Similarity=0.351  Sum_probs=46.8

Q ss_pred             cCcccCCC--cccccCCHHHHHHHHHH-cCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhH
Q psy370           20 FVASQCPV--CKKIYTDQQLFQNHLET-HDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVA   96 (111)
Q Consensus        20 ~~~~~c~~--C~~~f~~~~~l~~h~~~-h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l   96 (111)
                      ++||+|++  |.+.|++...|+-|+.- |...+...-+--.          .+.-+-.  ..|||.|+.|+|.+.+...|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~----------~~~~F~~--~~KPYrCevC~KRYKNlNGL  414 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPE----------KMNIFSA--KDKPYRCEVCDKRYKNLNGL  414 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCcc----------ccccccc--cCCceeccccchhhccCccc
Confidence            47888876  88888888888877653 3333322221000          0111111  67999999999999999999


Q ss_pred             Hhhccc
Q psy370           97 TQSSKY  102 (111)
Q Consensus        97 ~~h~~~  102 (111)
                      .-|++-
T Consensus       415 KYHr~H  420 (423)
T COG5189         415 KYHRKH  420 (423)
T ss_pred             eecccc
Confidence            988763


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.89  E-value=6e-06  Score=45.78  Aligned_cols=72  Identities=11%  Similarity=0.310  Sum_probs=21.2

Q ss_pred             cCCCcccccCCHHHHHHHHHH-cCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHHhhccc
Q psy370           24 QCPVCKKIYTDQQLFQNHLET-HDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      +|..|+..|.+...+..|+.. |.-..+     ....+.....+..+.+...   ...+.|..|++.|.+..+|..|++.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~~---~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKKV---KESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             --------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccc-----ccccccccccccccccccc---CCCCCCCccCCCCcCHHHHHHHHcC
Confidence            588999999999999999864 432222     1111223333333433322   3368999999999999999999985


Q ss_pred             c
Q psy370          103 P  103 (111)
Q Consensus       103 ~  103 (111)
                      +
T Consensus        73 ~   73 (100)
T PF12756_consen   73 K   73 (100)
T ss_dssp             T
T ss_pred             c
Confidence            4


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.78  E-value=1.4e-05  Score=33.92  Aligned_cols=24  Identities=21%  Similarity=0.581  Sum_probs=15.5

Q ss_pred             cccCCCcccccCCHHHHHHHHHHc
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETH   45 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h   45 (111)
                      +|.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            356666666666666666666554


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.72  E-value=3.2e-05  Score=31.52  Aligned_cols=23  Identities=35%  Similarity=0.871  Sum_probs=13.8

Q ss_pred             ccCCCcccccCCHHHHHHHHHHc
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETH   45 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h   45 (111)
                      |.|+.|+..|.+...|..|++++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45667777777777777766553


No 34 
>KOG3993|consensus
Probab=97.36  E-value=4.8e-05  Score=52.04  Aligned_cols=56  Identities=14%  Similarity=0.377  Sum_probs=48.7

Q ss_pred             CccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHHhhccccCccc
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVATQSSKYPGQQN  107 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~  107 (111)
                      .|.|+.|...|...-.|.+|+....  .-.-|+|+.|+|+|.-...|.+|++-|-.+.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RI--V~vEYrCPEC~KVFsCPANLASHRRWHKPR~  322 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRI--VHVEYRCPECDKVFSCPANLASHRRWHKPRP  322 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCee--EEeeecCCcccccccCchhhhhhhcccCCch
Confidence            4899999999999999999988665  4456999999999999999999999886543


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.34  E-value=0.00028  Score=28.97  Aligned_cols=23  Identities=30%  Similarity=0.895  Sum_probs=14.1

Q ss_pred             ccCCCcccccCCHHHHHHHHHHc
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETH   45 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h   45 (111)
                      |.|..|++.|.....+..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666544


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.19  E-value=0.00013  Score=30.09  Aligned_cols=23  Identities=17%  Similarity=0.466  Sum_probs=16.1

Q ss_pred             eecCCCccccccchhHHhhcccc
Q psy370           81 FVCEICGHVVDEMPVATQSSKYP  103 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~~  103 (111)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45777777777777777777643


No 37 
>PRK04860 hypothetical protein; Provisional
Probab=97.07  E-value=0.00044  Score=41.98  Aligned_cols=39  Identities=23%  Similarity=0.499  Sum_probs=30.6

Q ss_pred             CccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccch
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMP   94 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~   94 (111)
                      +|.|. |+.   ...++..|.+.+.  ++++|.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~--g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVR--GEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhc--CCccEECCCCCceeEEec
Confidence            57887 876   5667788888887  788899999998887654


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.01  E-value=0.00042  Score=28.63  Aligned_cols=22  Identities=23%  Similarity=0.706  Sum_probs=14.2

Q ss_pred             ccCCCcccccCCHHHHHHHHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLET   44 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~   44 (111)
                      |.|..|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666667666666666553


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.90  E-value=0.00046  Score=28.49  Aligned_cols=22  Identities=23%  Similarity=0.490  Sum_probs=14.3

Q ss_pred             eecCCCccccccchhHHhhccc
Q psy370           81 FVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      |.|..|++.|.+...|.+|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566676777666666666653


No 40 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.83  E-value=0.00065  Score=28.71  Aligned_cols=22  Identities=23%  Similarity=0.427  Sum_probs=18.7

Q ss_pred             eecCCCccccccchhHHhhccc
Q psy370           81 FVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      |.|..|++.|.+...+.+|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788899999998888888875


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.71  E-value=0.0024  Score=31.10  Aligned_cols=22  Identities=18%  Similarity=0.549  Sum_probs=7.2

Q ss_pred             CccccccCcccCCHHHHHHHHH
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVH   71 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~   71 (111)
                      |..|++|+..+....+|..|+.
T Consensus        24 PatCP~C~a~~~~srnLrRHle   45 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLE   45 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHH
T ss_pred             CCCCCcchhhccchhhHHHHHH
Confidence            3334444444444444444433


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.68  E-value=0.00056  Score=28.01  Aligned_cols=23  Identities=13%  Similarity=0.222  Sum_probs=11.9

Q ss_pred             eecCCCccccccchhHHhhccccC
Q psy370           81 FVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      |.|..|..... ...|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666665555 555666665543


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.62  E-value=0.0013  Score=39.93  Aligned_cols=38  Identities=24%  Similarity=0.531  Sum_probs=32.4

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCH
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCK   63 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   63 (111)
                      +|.|. |+.   ....+..|.++++++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            69998 987   556688999999999999999999877543


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.30  E-value=0.011  Score=28.80  Aligned_cols=33  Identities=18%  Similarity=0.425  Sum_probs=22.1

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCC
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMD   50 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~   50 (111)
                      ..+.|-.|++|+..+....+|..|+..+.+.++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            446688999999999999999999976555444


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.28  E-value=0.0011  Score=28.00  Aligned_cols=21  Identities=19%  Similarity=0.683  Sum_probs=14.7

Q ss_pred             ccCCCcccccCCHHHHHHHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLE   43 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~   43 (111)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567777777777777776654


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.15  E-value=0.0027  Score=26.39  Aligned_cols=21  Identities=24%  Similarity=0.460  Sum_probs=14.7

Q ss_pred             eecCCCccccccchhHHhhccc
Q psy370           81 FVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      ..|+.||+.| ..+.|..|++.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3678888888 55567777654


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.17  E-value=0.015  Score=25.79  Aligned_cols=23  Identities=22%  Similarity=0.462  Sum_probs=18.4

Q ss_pred             ceecCCCccccccchhHHhhccc
Q psy370           80 GFVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      +|.|..|+..|.+..++..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888888888888763


No 48 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.99  E-value=0.017  Score=28.60  Aligned_cols=28  Identities=18%  Similarity=0.203  Sum_probs=21.4

Q ss_pred             CCCceecCCCccccccchhHHhhccccC
Q psy370           77 EERGFVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      ||.-+.|+.||..|..+.+...|+.-.|
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            6677788888888888888888875443


No 49 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=93.63  E-value=0.1  Score=28.51  Aligned_cols=23  Identities=22%  Similarity=0.759  Sum_probs=15.3

Q ss_pred             CccccccCcccCCHHHHHHHHHh
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVHS   72 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~~   72 (111)
                      .+.|..|+..|.....+..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            66777777777777777777664


No 50 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.54  E-value=0.027  Score=38.43  Aligned_cols=55  Identities=18%  Similarity=0.475  Sum_probs=37.4

Q ss_pred             CccccccCcccCCHHHHHHHHH--hccCCCC--CceecC--CCccccccchhHHhhccccCcc
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVH--SHLSMEE--RGFVCE--ICGHVVDEMPVATQSSKYPGQQ  106 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~--~h~~~~~--~~~~C~--~C~~~~~~~~~l~~h~~~~~~~  106 (111)
                      .+.|..|...|.....+..|.+  .|.  ++  +++.|.  .|++.|.+.+.+..|...+...
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~--~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHS--GESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCCccccCCccccccccccccccccc--cccCCceeeeccCCCccccccccccCCcccccCC
Confidence            4666667777777777777777  565  56  677777  5777777777777776666543


No 51 
>KOG2186|consensus
Probab=93.28  E-value=0.055  Score=35.13  Aligned_cols=47  Identities=21%  Similarity=0.485  Sum_probs=36.2

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHH
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVH   71 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~   71 (111)
                      -|.|..||.+..-+ .+..|+....+ ..|.|..|+..|.. .++..|..
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            37899999988766 46668776666 67899999999988 66666654


No 52 
>KOG2231|consensus
Probab=93.17  E-value=0.17  Score=37.36  Aligned_cols=85  Identities=11%  Similarity=0.320  Sum_probs=51.6

Q ss_pred             ccCCCcccccC---------------CHHHHHHHHHH-cCCCCCccccc------cCcccCCHHHHHHHHHhccCCCCCc
Q psy370           23 SQCPVCKKIYT---------------DQQLFQNHLET-HDNEMDYSCEH------CDMQFNCKSDMRKHVHSHLSMEERG   80 (111)
Q Consensus        23 ~~c~~C~~~f~---------------~~~~l~~h~~~-h~~~~~~~c~~------c~~~f~~~~~l~~h~~~h~~~~~~~   80 (111)
                      +.|.+|.+.+.               .-..|+.|+.. |....-..|..      +.....+...++.|+..-.. ++..
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~-d~~s  178 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDP-DDES  178 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCC-cccc
Confidence            56777777662               45667888754 43222112221      11233455677777764321 2222


Q ss_pred             ----eecCCCccccccchhHHhhccccCcccc
Q psy370           81 ----FVCEICGHVVDEMPVATQSSKYPGQQNQ  108 (111)
Q Consensus        81 ----~~C~~C~~~~~~~~~l~~h~~~~~~~~~  108 (111)
                          -.|..|...|.....|..|++..|..++
T Consensus       179 ~rGhp~C~~C~~~fld~~el~rH~~~~h~~ch  210 (669)
T KOG2231|consen  179 CRGHPLCKFCHERFLDDDELYRHLRFDHEFCH  210 (669)
T ss_pred             ccCCccchhhhhhhccHHHHHHhhccceehee
Confidence                3588999999999999999998886544


No 53 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.13  E-value=0.071  Score=23.53  Aligned_cols=11  Identities=55%  Similarity=1.186  Sum_probs=6.2

Q ss_pred             ccCCCcccccC
Q psy370           23 SQCPVCKKIYT   33 (111)
Q Consensus        23 ~~c~~C~~~f~   33 (111)
                      |.|.+||..+.
T Consensus         2 ~~C~~CGy~y~   12 (33)
T cd00350           2 YVCPVCGYIYD   12 (33)
T ss_pred             EECCCCCCEEC
Confidence            45666665543


No 54 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.81  E-value=0.11  Score=25.78  Aligned_cols=30  Identities=13%  Similarity=0.330  Sum_probs=24.7

Q ss_pred             CCccccCcccCCCcccccCCHHHHHHHHHH
Q psy370           15 GSYTIFVASQCPVCKKIYTDQQLFQNHLET   44 (111)
Q Consensus        15 ~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~   44 (111)
                      .+..||..+.|+-||..|....++..|...
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            356788889999999999988888888653


No 55 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.78  E-value=0.054  Score=37.01  Aligned_cols=62  Identities=18%  Similarity=0.398  Sum_probs=53.6

Q ss_pred             CcccCCCcccccCCHHHHHHHHH--HcCCC--CCcccc--ccCcccCCHHHHHHHHHhccCCCCCceecC
Q psy370           21 VASQCPVCKKIYTDQQLFQNHLE--THDNE--MDYSCE--HCDMQFNCKSDMRKHVHSHLSMEERGFVCE   84 (111)
Q Consensus        21 ~~~~c~~C~~~f~~~~~l~~h~~--~h~~~--~~~~c~--~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~   84 (111)
                      .++.|..|...|.....+..|.+  .|.++  +++.|.  .|+..|.+...+..|...|.  +..++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT--SISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc--CCCccccc
Confidence            46889999999999999999999  79999  999999  79999999999999998887  55555543


No 56 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=91.24  E-value=0.069  Score=35.96  Aligned_cols=22  Identities=27%  Similarity=0.513  Sum_probs=15.8

Q ss_pred             cCcccCCCcccccCCHHHHHHH
Q psy370           20 FVASQCPVCKKIYTDQQLFQNH   41 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h   41 (111)
                      .|||.|++|++.|++...|+-|
T Consensus       396 ~KPYrCevC~KRYKNlNGLKYH  417 (423)
T COG5189         396 DKPYRCEVCDKRYKNLNGLKYH  417 (423)
T ss_pred             CCceeccccchhhccCccceec
Confidence            3778888888887777666555


No 57 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.18  E-value=0.21  Score=28.44  Aligned_cols=29  Identities=28%  Similarity=0.694  Sum_probs=18.7

Q ss_pred             cCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCH
Q psy370           24 QCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCK   63 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   63 (111)
                      .|+.||..|-..           +..|.+|+.||..|...
T Consensus        11 ~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            677777777433           22567777777766554


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.68  E-value=0.16  Score=22.58  Aligned_cols=10  Identities=40%  Similarity=0.816  Sum_probs=5.7

Q ss_pred             CceecCCCcc
Q psy370           79 RGFVCEICGH   88 (111)
Q Consensus        79 ~~~~C~~C~~   88 (111)
                      .|..|+.||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            3456666664


No 59 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.00  E-value=0.21  Score=30.99  Aligned_cols=31  Identities=32%  Similarity=0.890  Sum_probs=16.7

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVV   90 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~   90 (111)
                      .-|.|+.|+..|.....+.           -.|.|+.||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~-----------~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME-----------YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh-----------cCCcCCCCCCCC
Confidence            4466666665555444331           136666666544


No 60 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.31  E-value=0.25  Score=30.31  Aligned_cols=25  Identities=36%  Similarity=0.731  Sum_probs=19.1

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGH   88 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~   88 (111)
                      +.|+|.+||..             +.  |+.|.+|+.||.
T Consensus       133 ~~~vC~vCGy~-------------~~--ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT-------------HE--GEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc-------------cc--CCCCCcCCCCCC
Confidence            36999999853             22  678899999984


No 61 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.54  E-value=0.35  Score=29.41  Aligned_cols=36  Identities=28%  Similarity=0.655  Sum_probs=22.2

Q ss_pred             cCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccc
Q psy370           45 HDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVD   91 (111)
Q Consensus        45 h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~   91 (111)
                      ..+..-|.|+.|+..|.....+.           -.|.|+.||....
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~-----------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME-----------LNFTCPRCGAMLD  139 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH-----------cCCcCCCCCCEee
Confidence            33445677777776666655553           1378888876553


No 62 
>KOG1146|consensus
Probab=88.19  E-value=0.16  Score=40.11  Aligned_cols=25  Identities=8%  Similarity=0.175  Sum_probs=21.5

Q ss_pred             CCceecCCCccccccchhHHhhccc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      -++|.|..|...+...-.|..|+..
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            3688999999999999889988853


No 63 
>KOG1146|consensus
Probab=87.76  E-value=0.49  Score=37.65  Aligned_cols=83  Identities=20%  Similarity=0.438  Sum_probs=62.4

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHH-cC------------------------CCCCccccccCcccCCHHHHHHHHHhcc
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLET-HD------------------------NEMDYSCEHCDMQFNCKSDMRKHVHSHL   74 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~-h~------------------------~~~~~~c~~c~~~f~~~~~l~~h~~~h~   74 (111)
                      .+-+.|+.|+..|+..+.|..|+++ |.                        +.++|.|..|...+....+|..|+....
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS~~  542 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQSDL  542 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHHHh
Confidence            4678999999999999999999987 11                        1357889999999999999998866321


Q ss_pred             CC----------C------------------------------C-CceecCCCccccccchhHHhhccc
Q psy370           75 SM----------E------------------------------E-RGFVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        75 ~~----------~------------------------------~-~~~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      ..          |                              + ..|.|..|+.-..-...|+-|+..
T Consensus       543 h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmts  611 (1406)
T KOG1146|consen  543 HRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTA  611 (1406)
T ss_pred             hHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhcccccccc
Confidence            10          0                              0 136788898877777778878763


No 64 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.64  E-value=0.056  Score=34.45  Aligned_cols=20  Identities=25%  Similarity=0.534  Sum_probs=14.9

Q ss_pred             cCcccCCCcccccCCHHHHH
Q psy370           20 FVASQCPVCKKIYTDQQLFQ   39 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~   39 (111)
                      .+.+.|++|++.|..+....
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs   22 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRS   22 (214)
T ss_pred             CCceECCCCCCeeeeeEEEc
Confidence            46678999999998775443


No 65 
>KOG2893|consensus
Probab=87.39  E-value=0.26  Score=31.97  Aligned_cols=32  Identities=19%  Similarity=0.664  Sum_probs=23.6

Q ss_pred             cCCCcccccCCHHHHHHHHHHcCCCCCccccccCcc
Q psy370           24 QCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQ   59 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~   59 (111)
                      .|=.|++-|.....|.+|++.    +.|+|.+|-+.
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkk   43 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKK   43 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhh
Confidence            366788888888888887664    67788888654


No 66 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=87.06  E-value=0.48  Score=28.38  Aligned_cols=41  Identities=22%  Similarity=0.615  Sum_probs=25.5

Q ss_pred             CCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccccc
Q psy370           46 DNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDE   92 (111)
Q Consensus        46 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~   92 (111)
                      .+...|.|+.|+..|........   ...   +..|.|+.||.....
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~---~d~---~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQL---LDM---DGTFTCPRCGEELEE  135 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHh---cCC---CCcEECCCCCCEEEE
Confidence            34567899999987775433321   011   223999999986643


No 67 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=86.38  E-value=0.86  Score=22.96  Aligned_cols=10  Identities=30%  Similarity=1.022  Sum_probs=6.8

Q ss_pred             CceecCCCcc
Q psy370           79 RGFVCEICGH   88 (111)
Q Consensus        79 ~~~~C~~C~~   88 (111)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4677777774


No 68 
>KOG2893|consensus
Probab=86.11  E-value=0.2  Score=32.49  Aligned_cols=39  Identities=23%  Similarity=0.517  Sum_probs=29.2

Q ss_pred             ccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHH
Q psy370           53 CEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVAT   97 (111)
Q Consensus        53 c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~   97 (111)
                      |=.|.+.|....-|.+|++.      +-|+|..|.+..-+-..|.
T Consensus        13 cwycnrefddekiliqhqka------khfkchichkkl~sgpgls   51 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA------KHFKCHICHKKLFSGPGLS   51 (341)
T ss_pred             eeecccccchhhhhhhhhhh------ccceeeeehhhhccCCCce
Confidence            56689999999999998874      4499999987554443443


No 69 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=85.25  E-value=0.64  Score=22.40  Aligned_cols=22  Identities=14%  Similarity=0.353  Sum_probs=15.7

Q ss_pred             eecCCCccccccc-----hhHHhhccc
Q psy370           81 FVCEICGHVVDEM-----PVATQSSKY  102 (111)
Q Consensus        81 ~~C~~C~~~~~~~-----~~l~~h~~~  102 (111)
                      -.|..|++.+...     +.|..|++.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            4688888877654     468888873


No 70 
>KOG2593|consensus
Probab=84.63  E-value=0.76  Score=32.30  Aligned_cols=38  Identities=29%  Similarity=0.616  Sum_probs=21.9

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCc
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDM   58 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~   58 (111)
                      +...-|.|+.|++.|.....++   ........|.|..|+.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCC
Confidence            4455577777777766554443   2233345677777764


No 71 
>KOG2186|consensus
Probab=84.62  E-value=0.73  Score=30.15  Aligned_cols=46  Identities=20%  Similarity=0.432  Sum_probs=33.7

Q ss_pred             ccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchhHHhhcc
Q psy370           51 YSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        51 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      |.|.+||....-+..- .|+..-+  + ..|-|..|++.|... +..-|.+
T Consensus         4 FtCnvCgEsvKKp~ve-kH~srCr--n-~~fSCIDC~k~F~~~-sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQVE-KHMSRCR--N-AYFSCIDCGKTFERV-SYKNHTK   49 (276)
T ss_pred             EehhhhhhhccccchH-HHHHhcc--C-CeeEEeecccccccc-hhhhhhh
Confidence            7899999877665444 4776554  3 689999999999884 4666664


No 72 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=84.12  E-value=0.92  Score=20.48  Aligned_cols=33  Identities=30%  Similarity=0.705  Sum_probs=16.6

Q ss_pred             cccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccc
Q psy370           52 SCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVD   91 (111)
Q Consensus        52 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~   91 (111)
                      .|+.|+..|.-..+-..     .  +.....|..|+..|.
T Consensus         4 ~CP~C~~~f~v~~~~l~-----~--~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLP-----A--GGRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHHcc-----c--CCcEEECCCCCcEee
Confidence            45566655554432211     1  234566777776653


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=84.03  E-value=1.4  Score=22.22  Aligned_cols=11  Identities=27%  Similarity=0.845  Sum_probs=7.0

Q ss_pred             CCceecCCCcc
Q psy370           78 ERGFVCEICGH   88 (111)
Q Consensus        78 ~~~~~C~~C~~   88 (111)
                      ..+|.|+.||.
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            34677777764


No 74 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=83.42  E-value=0.48  Score=27.93  Aligned_cols=57  Identities=16%  Similarity=0.431  Sum_probs=32.4

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCH--HHHHHHHHhccCCCCCceecCCCccccccchh
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCK--SDMRKHVHSHLSMEERGFVCEICGHVVDEMPV   95 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~--~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~   95 (111)
                      .+.|+|..|.++......|          +|-+|  ||......  ..|+.+-..+       -+|+.|.-+|.+++.
T Consensus        78 ~~lYeCnIC~etS~ee~FL----------KPneC--CgY~iCn~Cya~LWK~~~~y-------pvCPvCkTSFKss~~  136 (140)
T PF05290_consen   78 PKLYECNICKETSAEERFL----------KPNEC--CGYSICNACYANLWKFCNLY-------PVCPVCKTSFKSSSS  136 (140)
T ss_pred             CCceeccCcccccchhhcC----------Ccccc--cchHHHHHHHHHHHHHcccC-------CCCCccccccccccc
Confidence            4678888888776555433          23333  34322222  3444443333       379999999977653


No 75 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=83.24  E-value=0.37  Score=30.79  Aligned_cols=28  Identities=14%  Similarity=0.330  Sum_probs=19.0

Q ss_pred             CCceecCCCccccccchhHHhhccccCc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSKYPGQ  105 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~  105 (111)
                      +..|.|..|+|.|.-.....+|+...|.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            3457888888888888888888876663


No 76 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=82.81  E-value=0.76  Score=20.65  Aligned_cols=11  Identities=45%  Similarity=0.924  Sum_probs=6.6

Q ss_pred             ceecCCCcccc
Q psy370           80 GFVCEICGHVV   90 (111)
Q Consensus        80 ~~~C~~C~~~~   90 (111)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~~   35 (38)
T TIGR02098        25 KVRCGKCGHVW   35 (38)
T ss_pred             EEECCCCCCEE
Confidence            35666666655


No 77 
>KOG4167|consensus
Probab=81.96  E-value=0.21  Score=37.29  Aligned_cols=27  Identities=30%  Similarity=0.468  Sum_probs=23.8

Q ss_pred             eecCCCccccccchhHHhhccccCccc
Q psy370           81 FVCEICGHVVDEMPVATQSSKYPGQQN  107 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~~~~~~  107 (111)
                      |.|..|+++|-....+.-|||+|...+
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~q~  819 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQQE  819 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHHHH
Confidence            899999999999999999999987443


No 78 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=81.92  E-value=1  Score=20.21  Aligned_cols=32  Identities=25%  Similarity=0.709  Sum_probs=16.2

Q ss_pred             cccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccc
Q psy370           52 SCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVV   90 (111)
Q Consensus        52 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~   90 (111)
                      .|+.|...|.-......     .  ......|..|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~ip-----~--~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKIP-----P--KGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHHCC-----C--CCcEEECCCCCCEe
Confidence            45556555554433221     1  23456677777665


No 79 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=81.67  E-value=0.65  Score=21.56  Aligned_cols=24  Identities=21%  Similarity=0.379  Sum_probs=16.3

Q ss_pred             eecCCCccccccc--hhHHhhccccC
Q psy370           81 FVCEICGHVVDEM--PVATQSSKYPG  104 (111)
Q Consensus        81 ~~C~~C~~~~~~~--~~l~~h~~~~~  104 (111)
                      -.|..||.++...  .+-..|.++|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            4788888877444  45667777663


No 80 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.06  E-value=1.3  Score=25.93  Aligned_cols=29  Identities=21%  Similarity=0.211  Sum_probs=16.8

Q ss_pred             cCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCH
Q psy370           24 QCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCK   63 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   63 (111)
                      .|+.||+.|-..           +..|..|+.||..|...
T Consensus        11 ~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        11 ICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            567777666321           23566777777665444


No 81 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=80.05  E-value=0.41  Score=29.03  Aligned_cols=12  Identities=25%  Similarity=0.695  Sum_probs=5.9

Q ss_pred             ccccccCcccCC
Q psy370           51 YSCEHCDMQFNC   62 (111)
Q Consensus        51 ~~c~~c~~~f~~   62 (111)
                      +.|+.||.+|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            455555554443


No 82 
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=80.05  E-value=0.55  Score=29.60  Aligned_cols=35  Identities=17%  Similarity=0.385  Sum_probs=0.0

Q ss_pred             CCccCCCCccccCcccCCCccc-ccCCHHHHHHHHH
Q psy370            9 QSEIIPGSYTIFVASQCPVCKK-IYTDQQLFQNHLE   43 (111)
Q Consensus         9 ~~~~~~~~~~~~~~~~c~~C~~-~f~~~~~l~~h~~   43 (111)
                      ++-|..+-|...+.|.|.+||. +|.-...+..|..
T Consensus        88 IPyWLYKLhGL~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   88 IPYWLYKLHGLGVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             ------------------------------------
T ss_pred             ccHHHHHHhCCCCeeeeEeCCCcceecHHHHHHhcC
Confidence            5678888888888899999987 4545567777754


No 83 
>KOG4167|consensus
Probab=79.79  E-value=0.94  Score=34.05  Aligned_cols=27  Identities=22%  Similarity=0.401  Sum_probs=23.3

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHHcC
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLETHD   46 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~h~   46 (111)
                      ..-|.|.+|++.|-....+..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            456999999999988888999999886


No 84 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=78.98  E-value=0.51  Score=35.52  Aligned_cols=13  Identities=31%  Similarity=0.509  Sum_probs=9.0

Q ss_pred             CCCceecCCCccc
Q psy370           77 EERGFVCEICGHV   89 (111)
Q Consensus        77 ~~~~~~C~~C~~~   89 (111)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            3567788888854


No 85 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=78.83  E-value=1.2  Score=20.76  Aligned_cols=25  Identities=20%  Similarity=0.399  Sum_probs=12.8

Q ss_pred             CCceecCCCccccccc----hhHHhhccc
Q psy370           78 ERGFVCEICGHVVDEM----PVATQSSKY  102 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~----~~l~~h~~~  102 (111)
                      ..-..|..|++.+...    ..|..|++.
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            4446777777776553    457777643


No 86 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=78.45  E-value=1  Score=30.96  Aligned_cols=26  Identities=8%  Similarity=0.171  Sum_probs=20.4

Q ss_pred             ecCCCccccccchhHHhhccccCccc
Q psy370           82 VCEICGHVVDEMPVATQSSKYPGQQN  107 (111)
Q Consensus        82 ~C~~C~~~~~~~~~l~~h~~~~~~~~  107 (111)
                      .|..|...|...+.|..|++..|...
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE~C  247 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHEAC  247 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhhhh
Confidence            48888888888888888888777543


No 87 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.04  E-value=2.8  Score=17.30  Aligned_cols=18  Identities=44%  Similarity=0.936  Sum_probs=10.4

Q ss_pred             cCCCcccccCCHHHHHHHH
Q psy370           24 QCPVCKKIYTDQQLFQNHL   42 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~   42 (111)
                      .|++|++.+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            577777776 334455554


No 88 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=78.02  E-value=0.75  Score=24.23  Aligned_cols=18  Identities=22%  Similarity=0.388  Sum_probs=11.9

Q ss_pred             CCCceecC--CCccccccch
Q psy370           77 EERGFVCE--ICGHVVDEMP   94 (111)
Q Consensus        77 ~~~~~~C~--~C~~~~~~~~   94 (111)
                      .+..+.|.  .||.+|..--
T Consensus        24 ~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678         24 KERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             heeeeecCCCCCCCEEEEEE
Confidence            34566776  7888776553


No 89 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=76.80  E-value=1.7  Score=21.06  Aligned_cols=12  Identities=33%  Similarity=1.074  Sum_probs=7.0

Q ss_pred             CCccccccCccc
Q psy370           49 MDYSCEHCDMQF   60 (111)
Q Consensus        49 ~~~~c~~c~~~f   60 (111)
                      ..|.|..||..|
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            345666666655


No 90 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=75.28  E-value=1.7  Score=24.53  Aligned_cols=25  Identities=12%  Similarity=0.316  Sum_probs=22.5

Q ss_pred             eec----CCCccccccchhHHhhccccCc
Q psy370           81 FVC----EICGHVVDEMPVATQSSKYPGQ  105 (111)
Q Consensus        81 ~~C----~~C~~~~~~~~~l~~h~~~~~~  105 (111)
                      |.|    ..|+..+.+...+..|.+..|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    9999999999999999988774


No 91 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=74.78  E-value=4.6  Score=23.19  Aligned_cols=79  Identities=15%  Similarity=0.243  Sum_probs=45.3

Q ss_pred             CcccCCCcccccCCHHHHHHHHHHcC------CCC-------CccccccCcccCCHHHHHHHHHhccCCCCCceecCCCc
Q psy370           21 VASQCPVCKKIYTDQQLFQNHLETHD------NEM-------DYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICG   87 (111)
Q Consensus        21 ~~~~c~~C~~~f~~~~~l~~h~~~h~------~~~-------~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~   87 (111)
                      =|..|+.||-+......|.+.-- |.      .+.       .-.|..|...|........-. . .  ....|.|+.|.
T Consensus        14 LP~~CpiCgLtLVss~HLARSyH-HLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~~-~-~--~~~~y~C~~C~   88 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYH-HLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFDE-L-K--DSHRYVCAVCK   88 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhh-ccCCCcccccccccccCCCCcccCcCCCCCCcccccccc-c-c--cccceeCCCCC
Confidence            36778889888777766654211 10      011       123777777776542111000 0 1  23468999999


Q ss_pred             cccccchhHHhhccccC
Q psy370           88 HVVDEMPVATQSSKYPG  104 (111)
Q Consensus        88 ~~~~~~~~l~~h~~~~~  104 (111)
                      ..|=..-++--|..+|.
T Consensus        89 ~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        89 NVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CccccccchhhhhhccC
Confidence            99977776666776653


No 92 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=74.16  E-value=1.8  Score=20.39  Aligned_cols=11  Identities=27%  Similarity=0.637  Sum_probs=6.4

Q ss_pred             ceecCCCcccc
Q psy370           80 GFVCEICGHVV   90 (111)
Q Consensus        80 ~~~C~~C~~~~   90 (111)
                      +..|+.||...
T Consensus        19 ~irC~~CG~rI   29 (44)
T smart00659       19 VVRCRECGYRI   29 (44)
T ss_pred             ceECCCCCceE
Confidence            35666666543


No 93 
>KOG4173|consensus
Probab=73.17  E-value=1.8  Score=27.60  Aligned_cols=77  Identities=17%  Similarity=0.347  Sum_probs=48.5

Q ss_pred             ccCCC--cccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccC--------CCCCceec--CCCcccc
Q psy370           23 SQCPV--CKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLS--------MEERGFVC--EICGHVV   90 (111)
Q Consensus        23 ~~c~~--C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~--------~~~~~~~C--~~C~~~~   90 (111)
                      +.|++  |-+.|.....+..|-.+-.+   -.|.+|.+.|.+..-|..|+.-.+.        +|.--|.|  +.|+-.|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            44544  66777777777776544222   2788888888888777777653211        24445777  4588888


Q ss_pred             ccchhHHhhccc
Q psy370           91 DEMPVATQSSKY  102 (111)
Q Consensus        91 ~~~~~l~~h~~~  102 (111)
                      .+..+-..|+-.
T Consensus       157 kT~r~RkdH~I~  168 (253)
T KOG4173|consen  157 KTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhHHHH
Confidence            777666666543


No 94 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=72.00  E-value=2.1  Score=17.78  Aligned_cols=9  Identities=33%  Similarity=0.814  Sum_probs=4.9

Q ss_pred             ecCCCcccc
Q psy370           82 VCEICGHVV   90 (111)
Q Consensus        82 ~C~~C~~~~   90 (111)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            455555555


No 95 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=70.73  E-value=2.5  Score=17.24  Aligned_cols=11  Identities=36%  Similarity=0.842  Sum_probs=7.2

Q ss_pred             CCceecCCCcc
Q psy370           78 ERGFVCEICGH   88 (111)
Q Consensus        78 ~~~~~C~~C~~   88 (111)
                      ...|.|+.||.
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            34677777773


No 96 
>KOG2636|consensus
Probab=70.40  E-value=2.8  Score=29.78  Aligned_cols=35  Identities=14%  Similarity=0.380  Sum_probs=26.5

Q ss_pred             CCccCCCCccccCcccCCCcc-cccCCHHHHHHHHH
Q psy370            9 QSEIIPGSYTIFVASQCPVCK-KIYTDQQLFQNHLE   43 (111)
Q Consensus         9 ~~~~~~~~~~~~~~~~c~~C~-~~f~~~~~l~~h~~   43 (111)
                      .+-|..+.|.....|.|.+|| .+|.-...+..|..
T Consensus       388 iPyWLyKLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  388 IPYWLYKLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             CchHHHhhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            456777778888888888888 57777777777765


No 97 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=69.91  E-value=2.9  Score=17.74  Aligned_cols=20  Identities=20%  Similarity=0.330  Sum_probs=9.9

Q ss_pred             eecCCCccccccchhHHhhcc
Q psy370           81 FVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      |-|..|++.|. ......|.+
T Consensus         1 ~sCiDC~~~F~-~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDFD-GDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEEE-GGGTTT---
T ss_pred             CeeecCCCCcC-cCCcCCCCc
Confidence            35677777773 334555544


No 98 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=69.23  E-value=2.7  Score=19.48  Aligned_cols=17  Identities=29%  Similarity=0.802  Sum_probs=12.6

Q ss_pred             eecCCCccccccchhHH
Q psy370           81 FVCEICGHVVDEMPVAT   97 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~   97 (111)
                      |.|..||..|.....+.
T Consensus         6 y~C~~Cg~~fe~~~~~~   22 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSIS   22 (42)
T ss_pred             EEeCCCCCEEEEEEEcC
Confidence            78999998887664433


No 99 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=68.65  E-value=2.9  Score=18.85  Aligned_cols=14  Identities=36%  Similarity=0.999  Sum_probs=11.0

Q ss_pred             eecCCCccccccch
Q psy370           81 FVCEICGHVVDEMP   94 (111)
Q Consensus        81 ~~C~~C~~~~~~~~   94 (111)
                      |.|..||..|....
T Consensus         6 y~C~~Cg~~fe~~~   19 (41)
T smart00834        6 YRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEcCCCCCEEEEEE
Confidence            78999999886543


No 100
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=68.29  E-value=3.3  Score=18.94  Aligned_cols=14  Identities=36%  Similarity=0.876  Sum_probs=11.5

Q ss_pred             ceecCCCccccccc
Q psy370           80 GFVCEICGHVVDEM   93 (111)
Q Consensus        80 ~~~C~~C~~~~~~~   93 (111)
                      ||.|..|++.|=..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            89999999988544


No 101
>KOG2231|consensus
Probab=68.13  E-value=6.4  Score=29.60  Aligned_cols=47  Identities=13%  Similarity=0.350  Sum_probs=25.6

Q ss_pred             cccccCcccCCHHHHHHHHHhccCCCCCceecCCCc------cccccchhHHhhccccC
Q psy370           52 SCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICG------HVVDEMPVATQSSKYPG  104 (111)
Q Consensus        52 ~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~------~~~~~~~~l~~h~~~~~  104 (111)
                      .|..|...|.....+..|++.++      |.|..|.      ..|..-++|..|.+..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h------~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH------EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce------eheeecCcccccchhcccchHHHHHhhhcC
Confidence            45666666666666666666544      4454442      22333345666665554


No 102
>KOG2785|consensus
Probab=67.16  E-value=6.4  Score=27.46  Aligned_cols=73  Identities=12%  Similarity=0.283  Sum_probs=40.0

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCc---cccccchhHHh
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICG---HVVDEMPVATQ   98 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~---~~~~~~~~l~~   98 (111)
                      |-.|-.|++.+.+...-..||..+.+-  |...  .........|...+..-.   ...|.|-.|.   +.|.+..+..+
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~Hgf--fIPd--reYL~D~~GLl~YLgeKV---~~~~~CL~CN~~~~~f~sleavr~  238 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGF--FIPD--REYLTDEKGLLKYLGEKV---GIGFICLFCNELGRPFSSLEAVRA  238 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCC--cCCc--hHhhhchhHHHHHHHHHh---ccCceEEEeccccCcccccHHHHH
Confidence            345666666666655555555543321  1100  011223333444443332   2457888888   99999999999


Q ss_pred             hcc
Q psy370           99 SSK  101 (111)
Q Consensus        99 h~~  101 (111)
                      ||.
T Consensus       239 HM~  241 (390)
T KOG2785|consen  239 HMR  241 (390)
T ss_pred             HHh
Confidence            994


No 103
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=66.52  E-value=3.5  Score=27.32  Aligned_cols=86  Identities=15%  Similarity=0.268  Sum_probs=49.4

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHc--CCCCCccccccCcccCCH------HHHHHHHHhcc--CCCCCceecCCCc
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETH--DNEMDYSCEHCDMQFNCK------SDMRKHVHSHL--SMEERGFVCEICG   87 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h--~~~~~~~c~~c~~~f~~~------~~l~~h~~~h~--~~~~~~~~C~~C~   87 (111)
                      -|-+.|+|..|..-...-..|. |+.+-  .....|+|.-|.+.-..+      -....|.+.-.  ....+++.|+.||
T Consensus       138 hGGrif~CsfC~~flCEDDQFE-HQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg  216 (314)
T PF06524_consen  138 HGGRIFKCSFCDNFLCEDDQFE-HQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCG  216 (314)
T ss_pred             CCCeEEEeecCCCeeeccchhh-hhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCC
Confidence            3455789999986655555444 44432  234567776666532211      11224444210  0134788999999


Q ss_pred             cccccchhHHhhccccC
Q psy370           88 HVVDEMPVATQSSKYPG  104 (111)
Q Consensus        88 ~~~~~~~~l~~h~~~~~  104 (111)
                      .-.....+|....+.|-
T Consensus       217 ~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  217 YETQETKDLSMSTRSHK  233 (314)
T ss_pred             Ccccccccceeeeecch
Confidence            88877777776666553


No 104
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=66.31  E-value=4.7  Score=19.80  Aligned_cols=42  Identities=17%  Similarity=0.422  Sum_probs=19.0

Q ss_pred             Cccccc-cCcccCCHHHHHHHHHhccCCCCCceecCC----Cccccccc
Q psy370           50 DYSCEH-CDMQFNCKSDMRKHVHSHLSMEERGFVCEI----CGHVVDEM   93 (111)
Q Consensus        50 ~~~c~~-c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~----C~~~~~~~   93 (111)
                      +..|+. |+..-.....+..|+...-  ..++..|..    |+..+...
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C--~~~~v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENEC--PKRPVPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTS--TTSEEE-SS----S--EEEHH
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccC--CCCcEECCCCCCCCCCccchh
Confidence            344544 3323233446666766443  345667777    77666554


No 105
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=65.75  E-value=5  Score=25.78  Aligned_cols=28  Identities=21%  Similarity=0.553  Sum_probs=20.9

Q ss_pred             ccCcccCCCcccccCCHHHHHHHHHH-cC
Q psy370           19 IFVASQCPVCKKIYTDQQLFQNHLET-HD   46 (111)
Q Consensus        19 ~~~~~~c~~C~~~f~~~~~l~~h~~~-h~   46 (111)
                      .+..|.|+.|+|-|.-......|+.. |.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            34469999999999999999999875 44


No 106
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=65.50  E-value=2  Score=25.47  Aligned_cols=13  Identities=15%  Similarity=0.626  Sum_probs=8.1

Q ss_pred             CccccccCcccCC
Q psy370           50 DYSCEHCDMQFNC   62 (111)
Q Consensus        50 ~~~c~~c~~~f~~   62 (111)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3667777765544


No 107
>PHA00626 hypothetical protein
Probab=65.44  E-value=3.8  Score=20.43  Aligned_cols=16  Identities=25%  Similarity=0.476  Sum_probs=12.9

Q ss_pred             CceecCCCccccccch
Q psy370           79 RGFVCEICGHVVDEMP   94 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~~   94 (111)
                      ..|+|..||..|+...
T Consensus        22 nrYkCkdCGY~ft~~~   37 (59)
T PHA00626         22 DDYVCCDCGYNDSKDA   37 (59)
T ss_pred             cceEcCCCCCeechhh
Confidence            3599999999887664


No 108
>KOG2785|consensus
Probab=65.11  E-value=15  Score=25.71  Aligned_cols=24  Identities=21%  Similarity=0.649  Sum_probs=18.8

Q ss_pred             CCccccccC---cccCCHHHHHHHHHh
Q psy370           49 MDYSCEHCD---MQFNCKSDMRKHVHS   72 (111)
Q Consensus        49 ~~~~c~~c~---~~f~~~~~l~~h~~~   72 (111)
                      .-+.|-+|.   +.|.+....+.||..
T Consensus       216 ~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  216 IGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cCceEEEeccccCcccccHHHHHHHhh
Confidence            446777777   888888888988874


No 109
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=64.40  E-value=5  Score=26.95  Aligned_cols=23  Identities=26%  Similarity=0.452  Sum_probs=14.4

Q ss_pred             CCccccccCcccCCHHHHHHHHH
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVH   71 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~   71 (111)
                      ..|.|..|-+.|.....+..|+.
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHH
Confidence            45666666666666666666655


No 110
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=62.48  E-value=16  Score=17.33  Aligned_cols=21  Identities=19%  Similarity=0.453  Sum_probs=11.0

Q ss_pred             ccCCCcccccCCHHHHHHHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLE   43 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~   43 (111)
                      |+|-+|.-+-..++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            445555544445555555554


No 111
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=61.99  E-value=5.4  Score=22.49  Aligned_cols=15  Identities=27%  Similarity=0.802  Sum_probs=11.5

Q ss_pred             cccCCCcccccCCHH
Q psy370           22 ASQCPVCKKIYTDQQ   36 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~   36 (111)
                      |++|..||..|...+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            678888888887753


No 112
>PF12907 zf-met2:  Zinc-binding
Probab=61.98  E-value=3.3  Score=19.17  Aligned_cols=25  Identities=16%  Similarity=0.497  Sum_probs=11.8

Q ss_pred             ecCCCcccc---ccchhHHhhccccCcc
Q psy370           82 VCEICGHVV---DEMPVATQSSKYPGQQ  106 (111)
Q Consensus        82 ~C~~C~~~~---~~~~~l~~h~~~~~~~  106 (111)
                      .|..|..+|   .+...|..|....|..
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            455555333   2334455555544443


No 113
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=60.57  E-value=4.8  Score=19.29  Aligned_cols=13  Identities=31%  Similarity=1.012  Sum_probs=10.5

Q ss_pred             eecCCCccccccc
Q psy370           81 FVCEICGHVVDEM   93 (111)
Q Consensus        81 ~~C~~C~~~~~~~   93 (111)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            7899999988655


No 114
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=60.49  E-value=1.1  Score=20.63  Aligned_cols=12  Identities=42%  Similarity=0.883  Sum_probs=8.6

Q ss_pred             ceecCCCccccc
Q psy370           80 GFVCEICGHVVD   91 (111)
Q Consensus        80 ~~~C~~C~~~~~   91 (111)
                      -|.|..|+..|.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            367888887664


No 115
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=60.08  E-value=4.2  Score=18.89  Aligned_cols=15  Identities=27%  Similarity=0.498  Sum_probs=9.4

Q ss_pred             CceecCCCccccccc
Q psy370           79 RGFVCEICGHVVDEM   93 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~   93 (111)
                      .|+.|..|++.|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            578999999988433


No 116
>PRK14873 primosome assembly protein PriA; Provisional
Probab=59.92  E-value=1.7  Score=32.54  Aligned_cols=9  Identities=33%  Similarity=1.043  Sum_probs=5.6

Q ss_pred             ceecCCCcc
Q psy370           80 GFVCEICGH   88 (111)
Q Consensus        80 ~~~C~~C~~   88 (111)
                      ++.|+.||.
T Consensus       422 p~~Cp~Cgs  430 (665)
T PRK14873        422 DWRCPRCGS  430 (665)
T ss_pred             CccCCCCcC
Confidence            556666664


No 117
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=59.36  E-value=7.5  Score=19.77  Aligned_cols=9  Identities=33%  Similarity=1.091  Sum_probs=2.6

Q ss_pred             cCCCccccc
Q psy370           24 QCPVCKKIY   32 (111)
Q Consensus        24 ~c~~C~~~f   32 (111)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            455555555


No 118
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=57.89  E-value=6.2  Score=19.14  Aligned_cols=17  Identities=18%  Similarity=0.464  Sum_probs=13.4

Q ss_pred             CCceecCCCccccccch
Q psy370           78 ERGFVCEICGHVVDEMP   94 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~   94 (111)
                      ++.+.|..||..|....
T Consensus         2 Dk~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTA   18 (49)
T ss_pred             CeeEEcccCCCeEEEeh
Confidence            46788999999887764


No 119
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=56.56  E-value=2.4  Score=30.63  Aligned_cols=9  Identities=33%  Similarity=0.818  Sum_probs=5.1

Q ss_pred             ceecCCCcc
Q psy370           80 GFVCEICGH   88 (111)
Q Consensus        80 ~~~C~~C~~   88 (111)
                      |..|+.||.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            455666654


No 120
>PLN03239 histone acetyltransferase; Provisional
Probab=56.30  E-value=6.4  Score=27.22  Aligned_cols=24  Identities=13%  Similarity=0.110  Sum_probs=19.0

Q ss_pred             CCceecCCCccccccchhHHhhcc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      +.-|.|+.|.+-|.+...|..|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            356889999988888888888764


No 121
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=55.99  E-value=1.8  Score=32.56  Aligned_cols=60  Identities=18%  Similarity=0.399  Sum_probs=34.7

Q ss_pred             Cccc-CCCcccccCCHHHHHHHHHHcCCCCCc-cccccCcccCCHHHHHHHHHhccCCCCCceecCCCccc
Q psy370           21 VASQ-CPVCKKIYTDQQLFQNHLETHDNEMDY-SCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHV   89 (111)
Q Consensus        21 ~~~~-c~~C~~~f~~~~~l~~h~~~h~~~~~~-~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~   89 (111)
                      -||. |..||..|+....|-= -|-++....| .|..|.+.+..+    ..+|.|.    .|.-|+.||-.
T Consensus       121 YPF~~CT~CGPRfTIi~alPY-DR~nTsM~~F~lC~~C~~EY~dP----~nRRfHA----Qp~aCp~CGP~  182 (750)
T COG0068         121 YPFINCTNCGPRFTIIEALPY-DRENTSMADFPLCPFCDKEYKDP----LNRRFHA----QPIACPKCGPH  182 (750)
T ss_pred             ccccccCCCCcceeeeccCCC-CcccCccccCcCCHHHHHHhcCc----ccccccc----ccccCcccCCC
Confidence            3555 8889999886655421 1122322222 477777655554    2345564    46789999963


No 122
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=55.96  E-value=3.7  Score=19.00  Aligned_cols=12  Identities=50%  Similarity=1.146  Sum_probs=6.0

Q ss_pred             eecCCCcccccc
Q psy370           81 FVCEICGHVVDE   92 (111)
Q Consensus        81 ~~C~~C~~~~~~   92 (111)
                      +.|..||.+...
T Consensus        20 ~vC~~CG~Vl~e   31 (43)
T PF08271_consen   20 LVCPNCGLVLEE   31 (43)
T ss_dssp             EEETTT-BBEE-
T ss_pred             EECCCCCCEeec
Confidence            566667655543


No 123
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=55.42  E-value=5.1  Score=18.73  Aligned_cols=13  Identities=23%  Similarity=0.708  Sum_probs=10.3

Q ss_pred             ecCCCccccccch
Q psy370           82 VCEICGHVVDEMP   94 (111)
Q Consensus        82 ~C~~C~~~~~~~~   94 (111)
                      .|..||+.|+.+.
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            5888988888764


No 124
>PTZ00064 histone acetyltransferase; Provisional
Probab=55.30  E-value=7.4  Score=28.31  Aligned_cols=33  Identities=12%  Similarity=0.140  Sum_probs=24.4

Q ss_pred             CCceecCCCccccccchhHHhhcc----ccCcccccc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSK----YPGQQNQLF  110 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~----~~~~~~~~~  110 (111)
                      ..-|.|+.|.+-|.....|..|+.    .|+.++.+|
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~C~~rhPPG~EIY  314 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSRCQLRHPPGNEIY  314 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhcCCCCCCCCCeEE
Confidence            456889999999999888998985    445554443


No 125
>KOG2482|consensus
Probab=54.98  E-value=5.7  Score=27.44  Aligned_cols=22  Identities=9%  Similarity=0.354  Sum_probs=20.3

Q ss_pred             ceecCCCccccccchhHHhhcc
Q psy370           80 GFVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      .+.|-+|.+.|..+..|+.||+
T Consensus       195 r~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHH
Confidence            4689999999999999999996


No 126
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=54.94  E-value=20  Score=20.18  Aligned_cols=39  Identities=15%  Similarity=0.225  Sum_probs=28.7

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcc
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQ   59 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~   59 (111)
                      ++.|.|+.-|+.|.+...+...+... ..+.|.|...|+.
T Consensus         1 eeVf~i~~T~EiF~dYe~Y~~R~~~y-~~~vwtC~~TGk~   39 (102)
T PF10537_consen    1 EEVFYIPFTGEIFRDYEEYLKRMILY-NQRVWTCEITGKS   39 (102)
T ss_pred             CceEEeCCCCcccCCHHHHHHHHHHH-hCCeeEEecCCCC
Confidence            35688899999999998776654433 3477899888864


No 127
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=54.81  E-value=7  Score=16.82  Aligned_cols=11  Identities=45%  Similarity=0.966  Sum_probs=6.4

Q ss_pred             CceecCCCccc
Q psy370           79 RGFVCEICGHV   89 (111)
Q Consensus        79 ~~~~C~~C~~~   89 (111)
                      ..+.|+.|+..
T Consensus        18 ~~~vCp~C~~e   28 (30)
T PF08274_consen   18 ELLVCPECGHE   28 (30)
T ss_dssp             SSEEETTTTEE
T ss_pred             CEEeCCccccc
Confidence            44666666643


No 128
>KOG3408|consensus
Probab=54.79  E-value=6.9  Score=22.80  Aligned_cols=25  Identities=16%  Similarity=0.211  Sum_probs=17.1

Q ss_pred             CCceecCCCccccccchhHHhhccc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSKY  102 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~~  102 (111)
                      .-.|.|..|.+-|.+...|..|.+.
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3346777777777777777777654


No 129
>PLN02294 cytochrome c oxidase subunit Vb
Probab=54.72  E-value=7.8  Score=23.99  Aligned_cols=17  Identities=18%  Similarity=0.612  Sum_probs=13.7

Q ss_pred             CCCceecCCCccccccc
Q psy370           77 EERGFVCEICGHVVDEM   93 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~   93 (111)
                      ..++..|..||..|.-.
T Consensus       138 kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        138 KGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCCceeCCCCCCEEEEE
Confidence            35789999999988654


No 130
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=54.62  E-value=6.2  Score=23.94  Aligned_cols=35  Identities=20%  Similarity=0.518  Sum_probs=19.0

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVV   90 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~   90 (111)
                      -+|.|. |+.-+.+..-...   ...  |+ -|.|..|+-..
T Consensus       116 ~~Y~C~-C~q~~l~~RRhn~---~~~--g~-~YrC~~C~gkL  150 (156)
T COG3091         116 YPYRCQ-CQQHYLRIRRHNT---VRR--GE-VYRCGKCGGKL  150 (156)
T ss_pred             eeEEee-cCCccchhhhccc---ccc--cc-eEEeccCCceE
Confidence            457777 7766544322211   111  44 68888887543


No 131
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=54.61  E-value=7.1  Score=27.96  Aligned_cols=24  Identities=17%  Similarity=0.398  Sum_probs=19.0

Q ss_pred             CCceecCCCccccccchhHHhhcc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      ..-|.|+.|.+-|.....|..|+.
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHh
Confidence            456788888888888888888875


No 132
>KOG0320|consensus
Probab=53.91  E-value=12  Score=23.35  Aligned_cols=56  Identities=14%  Similarity=0.316  Sum_probs=31.3

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccchh
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMPV   95 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~~   95 (111)
                      ..+..|.|++|.-.|..+..              ....||..|...  ...-..      ...-+|+.|++....+..
T Consensus       127 ~~~~~~~CPiCl~~~sek~~--------------vsTkCGHvFC~~--Cik~al------k~~~~CP~C~kkIt~k~~  182 (187)
T KOG0320|consen  127 RKEGTYKCPICLDSVSEKVP--------------VSTKCGHVFCSQ--CIKDAL------KNTNKCPTCRKKITHKQF  182 (187)
T ss_pred             ccccccCCCceecchhhccc--------------cccccchhHHHH--HHHHHH------HhCCCCCCcccccchhhh
Confidence            33456999999777655432              334455555442  111111      123589999987666543


No 133
>KOG1842|consensus
Probab=53.42  E-value=5.1  Score=28.57  Aligned_cols=28  Identities=18%  Similarity=0.399  Sum_probs=14.9

Q ss_pred             ceecCCCccccccchhHHhhccccCccc
Q psy370           80 GFVCEICGHVVDEMPVATQSSKYPGQQN  107 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~  107 (111)
                      .|.|+.|+.-|.+...|..|.-.-|.++
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            3555555555555555555555444433


No 134
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=53.22  E-value=8.7  Score=21.47  Aligned_cols=22  Identities=23%  Similarity=0.401  Sum_probs=15.7

Q ss_pred             HHHhccCCCCCceecCCCccccccc
Q psy370           69 HVHSHLSMEERGFVCEICGHVVDEM   93 (111)
Q Consensus        69 h~~~h~~~~~~~~~C~~C~~~~~~~   93 (111)
                      ++..+.   .++..|..||..|.-.
T Consensus        71 W~~l~~---g~~~rC~eCG~~fkL~   92 (97)
T cd00924          71 WMWLEK---GKPKRCPECGHVFKLV   92 (97)
T ss_pred             EEEEeC---CCceeCCCCCcEEEEE
Confidence            444553   4799999999988643


No 135
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=53.08  E-value=8.8  Score=27.27  Aligned_cols=13  Identities=15%  Similarity=0.662  Sum_probs=6.7

Q ss_pred             CccccccCcccCC
Q psy370           50 DYSCEHCDMQFNC   62 (111)
Q Consensus        50 ~~~c~~c~~~f~~   62 (111)
                      -|.|..||..+..
T Consensus       367 g~rC~kCg~~~~~  379 (421)
T COG1571         367 GFRCKKCGTRARE  379 (421)
T ss_pred             CcccccccccCCc
Confidence            4555555554443


No 136
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=53.06  E-value=11  Score=22.40  Aligned_cols=23  Identities=30%  Similarity=0.551  Sum_probs=14.3

Q ss_pred             cccCCCcccccCCHHHHHHHHHHcCC
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETHDN   47 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h~~   47 (111)
                      ...|-+||+.|...   ..|.++|-|
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-
T ss_pred             eeEEccCCcccchH---HHHHHHccC
Confidence            45699999999876   688888744


No 137
>KOG2747|consensus
Probab=52.36  E-value=6.3  Score=27.71  Aligned_cols=33  Identities=15%  Similarity=0.410  Sum_probs=24.7

Q ss_pred             CCceecCCCccccccchhHHhhcc----ccCcccccc
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSK----YPGQQNQLF  110 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~----~~~~~~~~~  110 (111)
                      ..-|.|+.|.+-...+..|..|++    .|+.++.+|
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~kC~~rhPPG~EIY  192 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKKCKLRHPPGNEIY  192 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHhcCCCCCCcceee
Confidence            345789999999999988999986    455555543


No 138
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=52.11  E-value=8.7  Score=22.04  Aligned_cols=12  Identities=25%  Similarity=0.689  Sum_probs=7.6

Q ss_pred             ccccccCcccCC
Q psy370           51 YSCEHCDMQFNC   62 (111)
Q Consensus        51 ~~c~~c~~~f~~   62 (111)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            667777755544


No 139
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=51.61  E-value=26  Score=16.36  Aligned_cols=10  Identities=20%  Similarity=0.803  Sum_probs=7.2

Q ss_pred             CceecCCCcc
Q psy370           79 RGFVCEICGH   88 (111)
Q Consensus        79 ~~~~C~~C~~   88 (111)
                      ..|.|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            4578888775


No 140
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=51.38  E-value=7.8  Score=17.89  Aligned_cols=12  Identities=33%  Similarity=0.719  Sum_probs=9.2

Q ss_pred             CceecCCCcccc
Q psy370           79 RGFVCEICGHVV   90 (111)
Q Consensus        79 ~~~~C~~C~~~~   90 (111)
                      .+-.|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            456889998776


No 141
>KOG0978|consensus
Probab=51.37  E-value=6.1  Score=29.84  Aligned_cols=19  Identities=21%  Similarity=0.328  Sum_probs=14.1

Q ss_pred             CceecCCCccccccchhHH
Q psy370           79 RGFVCEICGHVVDEMPVAT   97 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~~~l~   97 (111)
                      +.-+||.|+..|+--+.+.
T Consensus       677 RqRKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHR  695 (698)
T ss_pred             hcCCCCCCCCCCCcccccc
Confidence            3458999999998776544


No 142
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=51.03  E-value=9  Score=21.92  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=7.3

Q ss_pred             ccccccCcccCC
Q psy370           51 YSCEHCDMQFNC   62 (111)
Q Consensus        51 ~~c~~c~~~f~~   62 (111)
                      +.|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            567777755443


No 143
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=50.08  E-value=9.8  Score=17.81  Aligned_cols=29  Identities=28%  Similarity=0.663  Sum_probs=17.8

Q ss_pred             CccccccCcccCCHHHHHHHHHhccCCCCC-ceecCCCccccc
Q psy370           50 DYSCEHCDMQFNCKSDMRKHVHSHLSMEER-GFVCEICGHVVD   91 (111)
Q Consensus        50 ~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~-~~~C~~C~~~~~   91 (111)
                      .|.|..||..|..           .  ... .+.|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~-----------~--~~~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVEL-----------D--EYGTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEE-----------C--CCCCceECCCCCCeEE
Confidence            4677777765443           0  234 578888886553


No 144
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=50.02  E-value=16  Score=16.07  Aligned_cols=20  Identities=20%  Similarity=0.267  Sum_probs=11.9

Q ss_pred             ceecCCCccccccchhHHhhc
Q psy370           80 GFVCEICGHVVDEMPVATQSS  100 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~  100 (111)
                      .+.|+.|++.+.... +..|.
T Consensus         4 ~~~C~nC~R~v~a~R-fA~HL   23 (33)
T PF08209_consen    4 YVECPNCGRPVAASR-FAPHL   23 (33)
T ss_dssp             EEE-TTTSSEEEGGG-HHHHH
T ss_pred             eEECCCCcCCcchhh-hHHHH
Confidence            467888888776554 44444


No 145
>KOG0717|consensus
Probab=49.42  E-value=10  Score=27.27  Aligned_cols=22  Identities=27%  Similarity=0.655  Sum_probs=19.5

Q ss_pred             ccCCCcccccCCHHHHHHHHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLET   44 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~   44 (111)
                      +.|.+|+++|.+..++..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999988653


No 146
>KOG3214|consensus
Probab=49.41  E-value=7.1  Score=21.93  Aligned_cols=43  Identities=16%  Similarity=0.298  Sum_probs=22.6

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHH
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKS   64 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~   64 (111)
                      ..+..|.|+.|+---.-.-.+.    ....-....|.+|+..|...-
T Consensus        19 ~ldt~FnClfcnHek~v~~~~D----k~~~iG~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   19 PLDTQFNCLFCNHEKSVSCTLD----KKHNIGKASCRICEESFQTTI   61 (109)
T ss_pred             chheeeccCccccccceeeeeh----hhcCcceeeeeehhhhhccch
Confidence            4455688888853221111111    111224467888888887653


No 147
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=48.49  E-value=16  Score=21.88  Aligned_cols=46  Identities=17%  Similarity=0.302  Sum_probs=24.7

Q ss_pred             ccCCCcccccCCHHHHHHHHH----H-cCCCCCccccccCcccCCHHHHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLE----T-HDNEMDYSCEHCDMQFNCKSDMRK   68 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~----~-h~~~~~~~c~~c~~~f~~~~~l~~   68 (111)
                      ..|..|+..+..-+.-..--.    + -....-+.|+.|++.|...+.+..
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            468888875543221111000    1 112345788888888877666553


No 148
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=47.96  E-value=9.9  Score=18.58  Aligned_cols=25  Identities=8%  Similarity=0.010  Sum_probs=11.6

Q ss_pred             CceecCCCccccccchhHHhhcccc
Q psy370           79 RGFVCEICGHVVDEMPVATQSSKYP  103 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~~~l~~h~~~~  103 (111)
                      ..|.|+.|+..|=..-++--|..+|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CeEECCCCCCccccCcChhhhcccc
Confidence            3477777777776665555555554


No 149
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=47.12  E-value=12  Score=21.60  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=7.0

Q ss_pred             ccccccCcccCC
Q psy370           51 YSCEHCDMQFNC   62 (111)
Q Consensus        51 ~~c~~c~~~f~~   62 (111)
                      +.|..|+..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            567777654433


No 150
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=46.92  E-value=17  Score=22.66  Aligned_cols=10  Identities=40%  Similarity=1.109  Sum_probs=6.3

Q ss_pred             eecCCCcccc
Q psy370           81 FVCEICGHVV   90 (111)
Q Consensus        81 ~~C~~C~~~~   90 (111)
                      |.|+.||...
T Consensus       133 F~Cp~Cg~~L  142 (176)
T COG1675         133 FTCPKCGEDL  142 (176)
T ss_pred             CCCCCCCchh
Confidence            6777777543


No 151
>KOG2593|consensus
Probab=45.66  E-value=35  Score=24.41  Aligned_cols=40  Identities=25%  Similarity=0.579  Sum_probs=27.5

Q ss_pred             CCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccc
Q psy370           46 DNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVV   90 (111)
Q Consensus        46 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~   90 (111)
                      +....|.|+.|.+.|.....++-   ...  ..--|.|..|+--.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~~--~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LDN--ETGEFHCENCGGEL  163 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hcc--cCceEEEecCCCch
Confidence            34567999999998887766553   221  23459999998544


No 152
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=44.53  E-value=13  Score=21.23  Aligned_cols=12  Identities=17%  Similarity=0.636  Sum_probs=5.1

Q ss_pred             ccCCCcccccCC
Q psy370           23 SQCPVCKKIYTD   34 (111)
Q Consensus        23 ~~c~~C~~~f~~   34 (111)
                      ..|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            345555544433


No 153
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=43.53  E-value=9  Score=17.27  Aligned_cols=12  Identities=25%  Similarity=0.514  Sum_probs=6.6

Q ss_pred             CcccCCCccccc
Q psy370           21 VASQCPVCKKIY   32 (111)
Q Consensus        21 ~~~~c~~C~~~f   32 (111)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458899998765


No 154
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=43.34  E-value=10  Score=20.93  Aligned_cols=14  Identities=29%  Similarity=0.667  Sum_probs=11.5

Q ss_pred             CceecCCCcccccc
Q psy370           79 RGFVCEICGHVVDE   92 (111)
Q Consensus        79 ~~~~C~~C~~~~~~   92 (111)
                      .|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            46689999998876


No 155
>COG1773 Rubredoxin [Energy production and conversion]
Probab=43.08  E-value=13  Score=18.48  Aligned_cols=12  Identities=42%  Similarity=1.063  Sum_probs=7.6

Q ss_pred             ceecCCCccccc
Q psy370           80 GFVCEICGHVVD   91 (111)
Q Consensus        80 ~~~C~~C~~~~~   91 (111)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            466777776653


No 156
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=43.04  E-value=21  Score=17.23  Aligned_cols=14  Identities=21%  Similarity=0.524  Sum_probs=7.3

Q ss_pred             CCccccccCcccCC
Q psy370           49 MDYSCEHCDMQFNC   62 (111)
Q Consensus        49 ~~~~c~~c~~~f~~   62 (111)
                      +.+.|..||..|..
T Consensus        17 rk~~Cr~Cg~~~C~   30 (57)
T cd00065          17 RRHHCRNCGRIFCS   30 (57)
T ss_pred             cccccCcCcCCcCh
Confidence            34456666655443


No 157
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=43.01  E-value=9.3  Score=18.57  Aligned_cols=13  Identities=23%  Similarity=0.887  Sum_probs=7.0

Q ss_pred             cCCCcccccCCHH
Q psy370           24 QCPVCKKIYTDQQ   36 (111)
Q Consensus        24 ~c~~C~~~f~~~~   36 (111)
                      .|++|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            7999999987653


No 158
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=41.55  E-value=14  Score=21.75  Aligned_cols=18  Identities=17%  Similarity=0.530  Sum_probs=14.1

Q ss_pred             CCCceecCCCccccccch
Q psy370           77 EERGFVCEICGHVVDEMP   94 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~~   94 (111)
                      |...|.|..|+++|....
T Consensus        50 ~~qRyrC~~C~~tf~~~~   67 (129)
T COG3677          50 GHQRYKCKSCGSTFTVET   67 (129)
T ss_pred             cccccccCCcCcceeeec
Confidence            345689999999997663


No 159
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.46  E-value=12  Score=18.05  Aligned_cols=16  Identities=19%  Similarity=0.549  Sum_probs=11.0

Q ss_pred             cccccCcccCCHHHHH
Q psy370           52 SCEHCDMQFNCKSDMR   67 (111)
Q Consensus        52 ~c~~c~~~f~~~~~l~   67 (111)
                      .|++|++.|.+...+.
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            6788888877765444


No 160
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=41.21  E-value=46  Score=16.78  Aligned_cols=17  Identities=35%  Similarity=0.702  Sum_probs=11.7

Q ss_pred             CCCceecCCCccccccc
Q psy370           77 EERGFVCEICGHVVDEM   93 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~   93 (111)
                      ..+-|.|+.||..+...
T Consensus        43 ~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             ccceEEcCCCCCEECcH
Confidence            34568888888776544


No 161
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=40.60  E-value=16  Score=20.88  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=6.1

Q ss_pred             ccccccCccc
Q psy370           51 YSCEHCDMQF   60 (111)
Q Consensus        51 ~~c~~c~~~f   60 (111)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            5677777533


No 162
>PRK05978 hypothetical protein; Provisional
Probab=40.60  E-value=14  Score=22.37  Aligned_cols=8  Identities=38%  Similarity=1.360  Sum_probs=4.0

Q ss_pred             ccCCCccc
Q psy370           23 SQCPVCKK   30 (111)
Q Consensus        23 ~~c~~C~~   30 (111)
                      -+|+.||+
T Consensus        34 grCP~CG~   41 (148)
T PRK05978         34 GRCPACGE   41 (148)
T ss_pred             CcCCCCCC
Confidence            34555554


No 163
>KOG2907|consensus
Probab=40.13  E-value=21  Score=20.56  Aligned_cols=39  Identities=15%  Similarity=0.285  Sum_probs=22.0

Q ss_pred             ccccccCcccCCHHHHHHHHHhccCCCC-CceecCCCcccccc
Q psy370           51 YSCEHCDMQFNCKSDMRKHVHSHLSMEE-RGFVCEICGHVVDE   92 (111)
Q Consensus        51 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~-~~~~C~~C~~~~~~   92 (111)
                      ..|+.||..=..-..++  +|+-. .|. .=|-|..|++.|..
T Consensus        75 ~kCpkCghe~m~Y~T~Q--lRSAD-EGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQ--LRSAD-EGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhh--ccccc-CCceEEEEcCccceeeec
Confidence            56888885433322222  33332 133 44789999988864


No 164
>PRK04023 DNA polymerase II large subunit; Validated
Probab=40.04  E-value=26  Score=28.00  Aligned_cols=10  Identities=40%  Similarity=0.989  Sum_probs=7.6

Q ss_pred             cccCCCcccc
Q psy370           22 ASQCPVCKKI   31 (111)
Q Consensus        22 ~~~c~~C~~~   31 (111)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            4678888876


No 165
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=39.93  E-value=8  Score=22.20  Aligned_cols=40  Identities=23%  Similarity=0.305  Sum_probs=20.7

Q ss_pred             ccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccccc
Q psy370           51 YSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDE   92 (111)
Q Consensus        51 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~   92 (111)
                      ..|+.||..=.  ..++.+.|.-..+...=|.|..||.+|..
T Consensus        73 ~~CpkCg~~ea--~y~~~QtRsaDEp~T~Fy~C~~Cg~~wre  112 (113)
T COG1594          73 EKCPKCGNKEA--YYWQLQTRSADEPETRFYKCTRCGYRWRE  112 (113)
T ss_pred             ccCCCCCCcee--EEEeeehhccCCCceEEEEecccCCEeec
Confidence            45777774222  22223334332112233899999998863


No 166
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=39.27  E-value=22  Score=23.95  Aligned_cols=33  Identities=18%  Similarity=0.618  Sum_probs=22.2

Q ss_pred             ccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKS   64 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~   64 (111)
                      .+|+.|++....+. |..        ..++|+.|+.-|.-..
T Consensus        27 ~~c~~c~~~~~~~~-l~~--------~~~vc~~c~~h~rl~a   59 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LER--------NLEVCPKCDHHMRMDA   59 (285)
T ss_pred             eECCCCcchhhHHH-HHh--------hCCCCCCCCCcCcCCH
Confidence            45999998775553 332        3468999998776543


No 168
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.97  E-value=15  Score=18.74  Aligned_cols=42  Identities=10%  Similarity=0.212  Sum_probs=22.2

Q ss_pred             HHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCC-ceecCCCccccc
Q psy370           43 ETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEER-GFVCEICGHVVD   91 (111)
Q Consensus        43 ~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~-~~~C~~C~~~~~   91 (111)
                      ..+.+..++.|..-+-.+..+..+.     ..  |+. --.|++|+..|.
T Consensus        17 ~I~~~~~~l~C~g~~~p~~HPrV~L-----~m--g~~gev~CPYC~t~y~   59 (62)
T COG4391          17 TIEIGDLPLMCPGPEPPNDHPRVFL-----DM--GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEEeCCeeEEcCCCCCCCCCCEEEE-----Ec--CCCCcEecCccccEEE
Confidence            3445566777765444433322211     11  233 356999998875


No 169
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.87  E-value=15  Score=21.08  Aligned_cols=16  Identities=13%  Similarity=0.100  Sum_probs=12.3

Q ss_pred             CCceecCCCccccccc
Q psy370           78 ERGFVCEICGHVVDEM   93 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~   93 (111)
                      ..|..|++||++|+.+
T Consensus        24 rdPiVsPytG~s~P~s   39 (129)
T COG4530          24 RDPIVSPYTGKSYPRS   39 (129)
T ss_pred             CCccccCcccccchHH
Confidence            4578899999998544


No 170
>PHA02998 RNA polymerase subunit; Provisional
Probab=38.54  E-value=5.8  Score=24.73  Aligned_cols=41  Identities=10%  Similarity=0.151  Sum_probs=21.4

Q ss_pred             ccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccc
Q psy370           51 YSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEM   93 (111)
Q Consensus        51 ~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~   93 (111)
                      ..|+.|+..-....  ..+.|+-..+...=|.|..||+.|.=+
T Consensus       144 v~CPkCg~~~A~f~--qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPM--MIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEE--EEeeccCCCCceEEEEcCCCCCccCCc
Confidence            46777874322222  223333221112237899999988654


No 171
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=38.25  E-value=17  Score=21.55  Aligned_cols=15  Identities=27%  Similarity=0.840  Sum_probs=12.0

Q ss_pred             cccCCCcccccCCHH
Q psy370           22 ASQCPVCKKIYTDQQ   36 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~   36 (111)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578899999988664


No 172
>PRK05580 primosome assembly protein PriA; Validated
Probab=38.17  E-value=7.3  Score=29.38  Aligned_cols=9  Identities=33%  Similarity=0.792  Sum_probs=5.1

Q ss_pred             ceecCCCcc
Q psy370           80 GFVCEICGH   88 (111)
Q Consensus        80 ~~~C~~C~~   88 (111)
                      +..|+.||.
T Consensus       421 ~~~Cp~Cg~  429 (679)
T PRK05580        421 PKACPECGS  429 (679)
T ss_pred             CCCCCCCcC
Confidence            455666654


No 173
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.10  E-value=6.3  Score=20.98  Aligned_cols=11  Identities=18%  Similarity=0.742  Sum_probs=7.9

Q ss_pred             cccCCCccccc
Q psy370           22 ASQCPVCKKIY   32 (111)
Q Consensus        22 ~~~c~~C~~~f   32 (111)
                      .|.|..||..|
T Consensus        12 ~Y~c~~cg~~~   22 (82)
T COG2331          12 SYECTECGNRF   22 (82)
T ss_pred             EEeecccchHH
Confidence            47778887665


No 174
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=37.73  E-value=34  Score=19.32  Aligned_cols=39  Identities=18%  Similarity=0.364  Sum_probs=19.9

Q ss_pred             cccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccCccc
Q psy370           18 TIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQF   60 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f   60 (111)
                      -..+-|.|+.||.--...-.+..    ........|..||..|
T Consensus        18 ~L~k~FtCp~Cghe~vs~ctvkk----~~~~g~~~Cg~CGls~   56 (104)
T COG4888          18 VLPKTFTCPRCGHEKVSSCTVKK----TVNIGTAVCGNCGLSF   56 (104)
T ss_pred             cCCceEecCccCCeeeeEEEEEe----cCceeEEEcccCcceE
Confidence            46777888888764333211111    1122335666777544


No 175
>PF14353 CpXC:  CpXC protein
Probab=37.71  E-value=11  Score=21.87  Aligned_cols=17  Identities=29%  Similarity=0.548  Sum_probs=11.3

Q ss_pred             ceecCCCccccccchhH
Q psy370           80 GFVCEICGHVVDEMPVA   96 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l   96 (111)
                      .+.|+.||..|.-...+
T Consensus        38 ~~~CP~Cg~~~~~~~p~   54 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPL   54 (128)
T ss_pred             EEECCCCCCceecCCCE
Confidence            36788888877654433


No 176
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=37.06  E-value=21  Score=17.99  Aligned_cols=12  Identities=25%  Similarity=0.346  Sum_probs=8.9

Q ss_pred             CCCceecCCCcc
Q psy370           77 EERGFVCEICGH   88 (111)
Q Consensus        77 ~~~~~~C~~C~~   88 (111)
                      |++--.|+.|..
T Consensus        41 GE~VArCPSCSL   52 (67)
T COG5216          41 GEVVARCPSCSL   52 (67)
T ss_pred             CceEEEcCCceE
Confidence            677778888864


No 177
>KOG2482|consensus
Probab=36.66  E-value=27  Score=24.33  Aligned_cols=24  Identities=25%  Similarity=0.717  Sum_probs=21.4

Q ss_pred             cccCCCcccccCCHHHHHHHHHHc
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLETH   45 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~h   45 (111)
                      .+.|-.|.++|..+..|..||+.-
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhc
Confidence            478999999999999999999863


No 178
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=36.14  E-value=18  Score=16.40  Aligned_cols=10  Identities=50%  Similarity=1.122  Sum_probs=7.8

Q ss_pred             eecCCCcccc
Q psy370           81 FVCEICGHVV   90 (111)
Q Consensus        81 ~~C~~C~~~~   90 (111)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6788888776


No 179
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=35.62  E-value=21  Score=19.56  Aligned_cols=33  Identities=15%  Similarity=0.302  Sum_probs=21.8

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEM   93 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~   93 (111)
                      ..+.|+.|++.        ...|.    ..-=|.|..||..|.--
T Consensus        34 ~~~~Cp~C~~~--------~VkR~----a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRI----ATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCc--------ceeee----ccCeEEcCCCCCeeccc
Confidence            46789999864        12222    23358999999988644


No 180
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=35.49  E-value=16  Score=20.83  Aligned_cols=22  Identities=14%  Similarity=0.185  Sum_probs=16.5

Q ss_pred             ceecCCCccccccchhHHhhcc
Q psy370           80 GFVCEICGHVVDEMPVATQSSK  101 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~~  101 (111)
                      .+-|..|.+-|.+..+|+.|.+
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            4667778888877777877775


No 181
>PRK12496 hypothetical protein; Provisional
Probab=35.37  E-value=29  Score=21.26  Aligned_cols=11  Identities=18%  Similarity=0.742  Sum_probs=7.2

Q ss_pred             ccccccCcccC
Q psy370           51 YSCEHCDMQFN   61 (111)
Q Consensus        51 ~~c~~c~~~f~   61 (111)
                      +.|.-|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            56777776553


No 182
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=35.15  E-value=21  Score=23.28  Aligned_cols=17  Identities=18%  Similarity=0.356  Sum_probs=13.7

Q ss_pred             CCCceecCCCccccccc
Q psy370           77 EERGFVCEICGHVVDEM   93 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~   93 (111)
                      ..++..|..||..|.-.
T Consensus       178 EGkpqRCpECGqVFKLV  194 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCCccCCCCCcEEEEE
Confidence            45688999999988654


No 183
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=34.87  E-value=50  Score=21.04  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=7.4

Q ss_pred             CceecCCCcccc
Q psy370           79 RGFVCEICGHVV   90 (111)
Q Consensus        79 ~~~~C~~C~~~~   90 (111)
                      ....|..||..+
T Consensus        29 ~lvrC~eCG~V~   40 (201)
T COG1326          29 PLVRCEECGTVH   40 (201)
T ss_pred             eEEEccCCCcEe
Confidence            345677777665


No 184
>KOG1280|consensus
Probab=34.25  E-value=59  Score=22.73  Aligned_cols=38  Identities=21%  Similarity=0.472  Sum_probs=24.0

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHH-cCCC-CCccccccC
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLET-HDNE-MDYSCEHCD   57 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~-h~~~-~~~~c~~c~   57 (111)
                      ...|.|+.|++.-.+...|..|... |... -.-.|.+|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4468888888877777777777664 4322 223455554


No 185
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=33.89  E-value=31  Score=23.43  Aligned_cols=34  Identities=21%  Similarity=0.472  Sum_probs=22.3

Q ss_pred             ccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKSD   65 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~~   65 (111)
                      .+|+.|+.....+. |..        ..++|+.|+.-|.....
T Consensus        39 ~kc~~C~~~~~~~~-l~~--------~~~vcp~c~~h~rltAr   72 (296)
T CHL00174         39 VQCENCYGLNYKKF-LKS--------KMNICEQCGYHLKMSSS   72 (296)
T ss_pred             eECCCccchhhHHH-HHH--------cCCCCCCCCCCcCCCHH
Confidence            34999988765543 332        35689999987765433


No 186
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=33.82  E-value=26  Score=24.45  Aligned_cols=46  Identities=22%  Similarity=0.453  Sum_probs=24.0

Q ss_pred             CCCcccccCCHHHHHHHHHHcCCCCCccccccC----cccCCHHHHHHHHH
Q psy370           25 CPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCD----MQFNCKSDMRKHVH   71 (111)
Q Consensus        25 c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~----~~f~~~~~l~~h~~   71 (111)
                      |..|...|-+-.-|..|++... ++-+.|..-+    ..|..-..|..|.+
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhccceecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhh
Confidence            6777766666666766666422 2333443322    23444455555544


No 187
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=33.52  E-value=30  Score=15.04  Aligned_cols=10  Identities=40%  Similarity=1.085  Sum_probs=4.1

Q ss_pred             ecCCCccccc
Q psy370           82 VCEICGHVVD   91 (111)
Q Consensus        82 ~C~~C~~~~~   91 (111)
                      .|..||..+.
T Consensus         2 ~C~~Cg~~~~   11 (32)
T PF03604_consen    2 ICGECGAEVE   11 (32)
T ss_dssp             BESSSSSSE-
T ss_pred             CCCcCCCeeE
Confidence            4444444443


No 188
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=33.43  E-value=29  Score=23.48  Aligned_cols=33  Identities=15%  Similarity=0.576  Sum_probs=22.1

Q ss_pred             ccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCHH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCKS   64 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~~   64 (111)
                      .+|+.|+..+..+. |..        ..++|+.|+.-|.-..
T Consensus        28 ~~c~~c~~~~~~~~-l~~--------~~~vc~~c~~h~rl~a   60 (292)
T PRK05654         28 TKCPSCGQVLYRKE-LEA--------NLNVCPKCGHHMRISA   60 (292)
T ss_pred             eECCCccchhhHHH-HHh--------cCCCCCCCCCCeeCCH
Confidence            45999998765543 332        2469999998776543


No 189
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=33.27  E-value=18  Score=21.57  Aligned_cols=16  Identities=25%  Similarity=0.482  Sum_probs=13.0

Q ss_pred             CCceecCCCccccccc
Q psy370           78 ERGFVCEICGHVVDEM   93 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~   93 (111)
                      .++..|..||..|.-.
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            4689999999988654


No 190
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=32.96  E-value=25  Score=17.15  Aligned_cols=17  Identities=24%  Similarity=0.567  Sum_probs=10.6

Q ss_pred             CCCceecCCCccccccc
Q psy370           77 EERGFVCEICGHVVDEM   93 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~   93 (111)
                      +...++|.+|++.+...
T Consensus        32 ~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   32 EPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTCEEEETTT--EEEHH
T ss_pred             CCCEEEeeCCCCEeccc
Confidence            44568899998877654


No 191
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=32.68  E-value=37  Score=24.67  Aligned_cols=25  Identities=32%  Similarity=0.683  Sum_probs=21.2

Q ss_pred             ccCCCcccccCCHHHHHHHHHH-cCC
Q psy370           23 SQCPVCKKIYTDQQLFQNHLET-HDN   47 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~-h~~   47 (111)
                      +.|+.|.+.|.....+..|+.. |.+
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhh
Confidence            6699999999999999999874 654


No 192
>KOG1994|consensus
Probab=32.31  E-value=42  Score=21.98  Aligned_cols=21  Identities=14%  Similarity=0.328  Sum_probs=16.4

Q ss_pred             ceecCCCccccccchhHHhhc
Q psy370           80 GFVCEICGHVVDEMPVATQSS  100 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~~h~  100 (111)
                      -|-|-.||..|...-+|..|=
T Consensus       239 h~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  239 HYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ceEEEEeccccCCHHHHHHhC
Confidence            377888888888888887764


No 193
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=32.27  E-value=22  Score=25.69  Aligned_cols=25  Identities=16%  Similarity=0.344  Sum_probs=15.4

Q ss_pred             CCCccccccCcccCCHHHHHHHHHh
Q psy370           48 EMDYSCEHCDMQFNCKSDMRKHVHS   72 (111)
Q Consensus        48 ~~~~~c~~c~~~f~~~~~l~~h~~~   72 (111)
                      .+-+.|+.|.+.|.....+..|+..
T Consensus        55 WrFWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   55 WRFWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeEeeCCcccceeCCHHHHHHHHHH
Confidence            3445666666666666666666653


No 194
>KOG1842|consensus
Probab=32.03  E-value=34  Score=24.69  Aligned_cols=29  Identities=24%  Similarity=0.520  Sum_probs=24.0

Q ss_pred             cCcccCCCcccccCCHHHHHHHHHH-cCCC
Q psy370           20 FVASQCPVCKKIYTDQQLFQNHLET-HDNE   48 (111)
Q Consensus        20 ~~~~~c~~C~~~f~~~~~l~~h~~~-h~~~   48 (111)
                      .+.|-|+.|..-|.+.+.|..|... |.++
T Consensus        13 ~egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   13 LEGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hhcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            3469999999999999999999875 5543


No 195
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=31.78  E-value=27  Score=17.38  Aligned_cols=17  Identities=24%  Similarity=0.417  Sum_probs=12.7

Q ss_pred             CCCceecCCCccccccc
Q psy370           77 EERGFVCEICGHVVDEM   93 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~   93 (111)
                      +...|.|+.||-..-.+
T Consensus        11 ~~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen   11 AHVNFECPDCGIPTHCS   27 (55)
T ss_pred             cccCCcCCCCCCcCccC
Confidence            46689999999766444


No 196
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=31.72  E-value=22  Score=21.51  Aligned_cols=13  Identities=15%  Similarity=0.284  Sum_probs=10.4

Q ss_pred             eecCCCccccccc
Q psy370           81 FVCEICGHVVDEM   93 (111)
Q Consensus        81 ~~C~~C~~~~~~~   93 (111)
                      =+|..||+.|++-
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            4799999999764


No 197
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=31.52  E-value=50  Score=16.30  Aligned_cols=8  Identities=38%  Similarity=1.082  Sum_probs=3.9

Q ss_pred             ccCCCccc
Q psy370           23 SQCPVCKK   30 (111)
Q Consensus        23 ~~c~~C~~   30 (111)
                      ..|+.||+
T Consensus        27 ~~C~~cG~   34 (55)
T TIGR01031        27 VVCPNCGE   34 (55)
T ss_pred             eECCCCCC
Confidence            34555554


No 198
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=30.41  E-value=34  Score=26.86  Aligned_cols=32  Identities=16%  Similarity=0.497  Sum_probs=16.3

Q ss_pred             cCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCC
Q psy370           24 QCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNC   62 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~   62 (111)
                      .|..|++.|......       ...+.+.|..||..|..
T Consensus       462 tC~~C~kkFfSlsK~-------L~~RKHHCRkCGrVFC~  493 (1374)
T PTZ00303        462 SCPSCGRAFISLSRP-------LGTRAHHCRSCGIRLCV  493 (1374)
T ss_pred             cccCcCCcccccccc-------cccccccccCCccccCc
Confidence            477777777543110       01244566666665543


No 199
>PRK04351 hypothetical protein; Provisional
Probab=30.22  E-value=32  Score=20.80  Aligned_cols=14  Identities=14%  Similarity=0.548  Sum_probs=8.2

Q ss_pred             CCceecCCCccccc
Q psy370           78 ERGFVCEICGHVVD   91 (111)
Q Consensus        78 ~~~~~C~~C~~~~~   91 (111)
                      ...|.|..|+..+.
T Consensus       130 ~~~yrCg~C~g~L~  143 (149)
T PRK04351        130 TKRYRCGKCRGKLK  143 (149)
T ss_pred             CCcEEeCCCCcEee
Confidence            45566777765543


No 200
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=30.20  E-value=27  Score=16.66  Aligned_cols=12  Identities=42%  Similarity=1.112  Sum_probs=8.3

Q ss_pred             eecCCCcccccc
Q psy370           81 FVCEICGHVVDE   92 (111)
Q Consensus        81 ~~C~~C~~~~~~   92 (111)
                      |+|..||..+.-
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            678888876643


No 201
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=30.18  E-value=26  Score=15.56  Aligned_cols=14  Identities=21%  Similarity=0.434  Sum_probs=7.4

Q ss_pred             eecCCCccccccch
Q psy370           81 FVCEICGHVVDEMP   94 (111)
Q Consensus        81 ~~C~~C~~~~~~~~   94 (111)
                      -.|..|++.|..+-
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            36889999887763


No 202
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=29.89  E-value=13  Score=17.58  Aligned_cols=16  Identities=31%  Similarity=0.476  Sum_probs=10.6

Q ss_pred             CCceecCC--Cccccccc
Q psy370           78 ERGFVCEI--CGHVVDEM   93 (111)
Q Consensus        78 ~~~~~C~~--C~~~~~~~   93 (111)
                      +..+.|.-  ||.+|...
T Consensus        23 ~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen   23 ELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             EEEEEECCCcCCCEEEEE
Confidence            45567754  88888654


No 203
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=29.83  E-value=23  Score=19.52  Aligned_cols=32  Identities=19%  Similarity=0.450  Sum_probs=19.6

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCcccccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDE   92 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~   92 (111)
                      ..|.|++|+..-..        +.-.  |  =|.|..|++.|.-
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a~--G--IW~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVAT--G--IWKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEET--T--EEEETTTTEEEE-
T ss_pred             CCCcCCCCCCceeE--------Eeee--E--EeecCCCCCEEeC
Confidence            56899999864211        1111  2  3899999998854


No 204
>PTZ00448 hypothetical protein; Provisional
Probab=29.52  E-value=50  Score=23.21  Aligned_cols=23  Identities=22%  Similarity=0.504  Sum_probs=18.4

Q ss_pred             cccCCCcccccCCHHHHHHHHHH
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLET   44 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~~   44 (111)
                      .|.|..|+-.|.+......|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999877777778765


No 205
>KOG4477|consensus
Probab=29.27  E-value=54  Score=20.71  Aligned_cols=27  Identities=22%  Similarity=0.529  Sum_probs=17.4

Q ss_pred             ccccCcccCCCcccccCCHHHHHHHHHHcCCCCCccccccC
Q psy370           17 YTIFVASQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCD   57 (111)
Q Consensus        17 ~~~~~~~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~   57 (111)
                      ...++-|-|..|  +|.+..            ..|.|.+|+
T Consensus        19 ~~Deg~WdCsvC--TFrNsA------------eAfkC~vCd   45 (228)
T KOG4477|consen   19 NDDEGKWDCSVC--TFRNSA------------EAFKCFVCD   45 (228)
T ss_pred             ccccCceeeeee--eecchh------------hhhheeeec
Confidence            355677889988  354442            456777776


No 206
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=29.26  E-value=18  Score=23.26  Aligned_cols=25  Identities=12%  Similarity=0.292  Sum_probs=0.0

Q ss_pred             CceecCCCccccccchhHHhhccccC
Q psy370           79 RGFVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      .-..|+.||..++... +..|+++--
T Consensus       167 ~~~~cPitGe~IP~~e-~~eHmRi~L  191 (229)
T PF12230_consen  167 KMIICPITGEMIPADE-MDEHMRIEL  191 (229)
T ss_dssp             --------------------------
T ss_pred             cccccccccccccccc-ccccccccc
Confidence            4468999999888774 888887643


No 207
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=29.19  E-value=19  Score=16.08  Aligned_cols=10  Identities=50%  Similarity=1.334  Sum_probs=6.0

Q ss_pred             cCCCcccccC
Q psy370           24 QCPVCKKIYT   33 (111)
Q Consensus        24 ~c~~C~~~f~   33 (111)
                      .|+.||..|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            4666666664


No 208
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=29.03  E-value=18  Score=20.48  Aligned_cols=10  Identities=30%  Similarity=0.710  Sum_probs=5.1

Q ss_pred             cccCCCcccc
Q psy370           22 ASQCPVCKKI   31 (111)
Q Consensus        22 ~~~c~~C~~~   31 (111)
                      |-.|+.||..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            3445555543


No 209
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=28.88  E-value=42  Score=23.57  Aligned_cols=33  Identities=18%  Similarity=0.441  Sum_probs=20.0

Q ss_pred             ccCCCCccccCcccCCCcc-cccCCHHHHHHHHH
Q psy370           11 EIIPGSYTIFVASQCPVCK-KIYTDQQLFQNHLE   43 (111)
Q Consensus        11 ~~~~~~~~~~~~~~c~~C~-~~f~~~~~l~~h~~   43 (111)
                      -|.-+.|...+.|.|.+|| ..+.-...+..|..
T Consensus       363 ~WL~klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         363 RWLCKLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             hHHHHhcCCCcceeeeecccccccchHHHHhhhh
Confidence            4455566666777777777 45555555665543


No 210
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=28.51  E-value=28  Score=24.28  Aligned_cols=25  Identities=16%  Similarity=0.273  Sum_probs=20.5

Q ss_pred             CceecCCCccccccchhHHhhcccc
Q psy370           79 RGFVCEICGHVVDEMPVATQSSKYP  103 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~~~l~~h~~~~  103 (111)
                      .-|.|..|.+-+.....|..|++-+
T Consensus       157 ~vyICefClkY~~s~~~~~rH~~kC  181 (395)
T COG5027         157 IVYICEFCLKYYGSQTSLVRHRKKC  181 (395)
T ss_pred             eEEEhhhhHHHhcchhHHHHHHhcC
Confidence            4578999999999998999998743


No 211
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=28.23  E-value=32  Score=19.03  Aligned_cols=33  Identities=18%  Similarity=0.412  Sum_probs=21.3

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEM   93 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~   93 (111)
                      ..|.|++|++.-.         + ..  ..--|.|..|++.|.--
T Consensus        34 a~y~CpfCgk~~v---------k-R~--a~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        34 AKYVCPFCGKKTV---------K-RG--STGIWTCRKCGAKFAGG   66 (91)
T ss_pred             cCccCCCCCCCce---------E-EE--eeEEEEcCCCCCEEeCC
Confidence            4689999985311         1 11  22358999999988643


No 212
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=28.08  E-value=27  Score=16.44  Aligned_cols=14  Identities=36%  Similarity=0.617  Sum_probs=8.9

Q ss_pred             ceecCCCccccccc
Q psy370           80 GFVCEICGHVVDEM   93 (111)
Q Consensus        80 ~~~C~~C~~~~~~~   93 (111)
                      .+.|+.||..+...
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            46777777665443


No 213
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=27.97  E-value=27  Score=15.82  Aligned_cols=13  Identities=46%  Similarity=0.935  Sum_probs=9.6

Q ss_pred             cccCCCcccccCC
Q psy370           22 ASQCPVCKKIYTD   34 (111)
Q Consensus        22 ~~~c~~C~~~f~~   34 (111)
                      .+.|+.||+.+-+
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            4679999987643


No 214
>PRK00420 hypothetical protein; Validated
Probab=27.89  E-value=26  Score=20.18  Aligned_cols=8  Identities=13%  Similarity=0.181  Sum_probs=3.7

Q ss_pred             ccccccCc
Q psy370           51 YSCEHCDM   58 (111)
Q Consensus        51 ~~c~~c~~   58 (111)
                      ..|+.||.
T Consensus        41 ~~Cp~Cg~   48 (112)
T PRK00420         41 VVCPVHGK   48 (112)
T ss_pred             eECCCCCC
Confidence            34444444


No 215
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=27.64  E-value=28  Score=16.87  Aligned_cols=11  Identities=36%  Similarity=1.017  Sum_probs=6.7

Q ss_pred             ccCCCcccccC
Q psy370           23 SQCPVCKKIYT   33 (111)
Q Consensus        23 ~~c~~C~~~f~   33 (111)
                      |.|..||..|.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            55666666554


No 216
>COG4640 Predicted membrane protein [Function unknown]
Probab=27.59  E-value=40  Score=24.01  Aligned_cols=26  Identities=31%  Similarity=0.401  Sum_probs=19.0

Q ss_pred             CCccccCcccCCCcccccCCHHHHHH
Q psy370           15 GSYTIFVASQCPVCKKIYTDQQLFQN   40 (111)
Q Consensus        15 ~~~~~~~~~~c~~C~~~f~~~~~l~~   40 (111)
                      +++..|..++|+.||..|...+..-.
T Consensus         8 G~qk~Ed~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640           8 GSQKAEDDVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             ccccccccccccccCCcCCchhhhhh
Confidence            34556677789999999988765443


No 217
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=27.53  E-value=40  Score=19.30  Aligned_cols=11  Identities=18%  Similarity=0.682  Sum_probs=5.4

Q ss_pred             CccccccCccc
Q psy370           50 DYSCEHCDMQF   60 (111)
Q Consensus        50 ~~~c~~c~~~f   60 (111)
                      .|.|+.|+..+
T Consensus        19 ~~iCpeC~~EW   29 (109)
T TIGR00686        19 QLICPSCLYEW   29 (109)
T ss_pred             eeECccccccc
Confidence            35555555443


No 218
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.37  E-value=21  Score=20.75  Aligned_cols=11  Identities=18%  Similarity=0.519  Sum_probs=6.8

Q ss_pred             ccccccCcccCC
Q psy370           51 YSCEHCDMQFNC   62 (111)
Q Consensus        51 ~~c~~c~~~f~~   62 (111)
                      +.| .|+..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            567 77765544


No 219
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=27.17  E-value=35  Score=18.86  Aligned_cols=33  Identities=18%  Similarity=0.315  Sum_probs=21.5

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEM   93 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~   93 (111)
                      ..|.|++|++.-..          ..  ..--|.|..|++.|.--
T Consensus        35 a~y~CpfCgk~~vk----------R~--a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         35 AKYFCPFCGKHAVK----------RQ--AVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             CCccCCCCCCCcee----------ee--eeEEEEcCCCCCEEeCC
Confidence            56899999853111          11  23358999999988653


No 220
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=26.70  E-value=38  Score=15.26  Aligned_cols=14  Identities=21%  Similarity=0.473  Sum_probs=8.3

Q ss_pred             ecCCCccccccchh
Q psy370           82 VCEICGHVVDEMPV   95 (111)
Q Consensus        82 ~C~~C~~~~~~~~~   95 (111)
                      .|..|++.|-+-++
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            57788887766554


No 221
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=26.61  E-value=31  Score=17.05  Aligned_cols=13  Identities=31%  Similarity=0.736  Sum_probs=8.4

Q ss_pred             eecCCCccccccc
Q psy370           81 FVCEICGHVVDEM   93 (111)
Q Consensus        81 ~~C~~C~~~~~~~   93 (111)
                      |.|+.||..+.-.
T Consensus         3 ~~CP~CG~~iev~   15 (54)
T TIGR01206         3 FECPDCGAEIELE   15 (54)
T ss_pred             cCCCCCCCEEecC
Confidence            5777777766443


No 222
>KOG2071|consensus
Probab=26.58  E-value=35  Score=25.43  Aligned_cols=27  Identities=15%  Similarity=0.307  Sum_probs=20.6

Q ss_pred             CCceecCCCccccccchhHHhhccccC
Q psy370           78 ERGFVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      ..|-.|..||.+|........|+-.|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456789999999998877777765553


No 223
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=26.45  E-value=29  Score=21.15  Aligned_cols=13  Identities=23%  Similarity=0.488  Sum_probs=10.4

Q ss_pred             eecCCCccccccc
Q psy370           81 FVCEICGHVVDEM   93 (111)
Q Consensus        81 ~~C~~C~~~~~~~   93 (111)
                      -+|..|+..|++-
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            3799999999764


No 224
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=26.29  E-value=19  Score=21.72  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=7.7

Q ss_pred             CCccccccCcc
Q psy370           49 MDYSCEHCDMQ   59 (111)
Q Consensus        49 ~~~~c~~c~~~   59 (111)
                      ..+.|..||..
T Consensus       111 G~l~C~~Cg~~  121 (146)
T PF07295_consen  111 GTLVCENCGHE  121 (146)
T ss_pred             ceEecccCCCE
Confidence            44788888753


No 225
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=26.10  E-value=36  Score=16.87  Aligned_cols=12  Identities=17%  Similarity=0.454  Sum_probs=4.2

Q ss_pred             ccccccCcccCC
Q psy370           51 YSCEHCDMQFNC   62 (111)
Q Consensus        51 ~~c~~c~~~f~~   62 (111)
                      .....|+..|..
T Consensus        25 V~s~~C~H~fek   36 (57)
T PF11789_consen   25 VKSKKCGHTFEK   36 (57)
T ss_dssp             EEESSS--EEEH
T ss_pred             cCcCCCCCeecH
Confidence            333444444443


No 226
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=25.92  E-value=33  Score=19.15  Aligned_cols=13  Identities=23%  Similarity=0.738  Sum_probs=9.7

Q ss_pred             CCCceecCCCccc
Q psy370           77 EERGFVCEICGHV   89 (111)
Q Consensus        77 ~~~~~~C~~C~~~   89 (111)
                      |-+-|+|..||..
T Consensus         3 ~lkewkC~VCg~~   15 (103)
T COG4847           3 GLKEWKCYVCGGT   15 (103)
T ss_pred             ccceeeEeeeCCE
Confidence            5567889888854


No 227
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=25.90  E-value=23  Score=17.54  Aligned_cols=14  Identities=21%  Similarity=0.660  Sum_probs=8.4

Q ss_pred             eecCCCccccccch
Q psy370           81 FVCEICGHVVDEMP   94 (111)
Q Consensus        81 ~~C~~C~~~~~~~~   94 (111)
                      -.|..||+.|...+
T Consensus         6 ~~C~~Cg~~~~~~d   19 (54)
T PF14446_consen    6 CKCPVCGKKFKDGD   19 (54)
T ss_pred             ccChhhCCcccCCC
Confidence            35677777765443


No 228
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=25.86  E-value=38  Score=18.71  Aligned_cols=33  Identities=15%  Similarity=0.260  Sum_probs=21.1

Q ss_pred             CCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccc
Q psy370           49 MDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEM   93 (111)
Q Consensus        49 ~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~   93 (111)
                      ..|.|++|++.-..          ..  ..--|.|..|++.|.--
T Consensus        35 a~y~CpfCgk~~vk----------R~--a~GIW~C~~C~~~~AGG   67 (90)
T PRK03976         35 AKHVCPVCGRPKVK----------RV--GTGIWECRKCGAKFAGG   67 (90)
T ss_pred             cCccCCCCCCCceE----------EE--EEEEEEcCCCCCEEeCC
Confidence            46799999753111          11  22358999999988653


No 229
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=25.82  E-value=84  Score=15.50  Aligned_cols=17  Identities=24%  Similarity=0.341  Sum_probs=9.8

Q ss_pred             eecCCCccccccchhHH
Q psy370           81 FVCEICGHVVDEMPVAT   97 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~   97 (111)
                      +-|-.||-.+.+..+|.
T Consensus        28 ~YC~~Cg~~Y~d~~dL~   44 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLE   44 (55)
T ss_pred             ceeeeeCCccCCHHHHH
Confidence            45666666666555554


No 230
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=25.71  E-value=42  Score=14.46  Aligned_cols=12  Identities=42%  Similarity=1.298  Sum_probs=8.9

Q ss_pred             ceecCCCccccc
Q psy370           80 GFVCEICGHVVD   91 (111)
Q Consensus        80 ~~~C~~C~~~~~   91 (111)
                      =|+|..||..+.
T Consensus         7 ~ykC~~Cgniv~   18 (34)
T TIGR00319         7 VYKCEVCGNIVE   18 (34)
T ss_pred             EEEcCCCCcEEE
Confidence            478888887664


No 231
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=25.17  E-value=43  Score=14.44  Aligned_cols=12  Identities=50%  Similarity=1.323  Sum_probs=8.7

Q ss_pred             ceecCCCccccc
Q psy370           80 GFVCEICGHVVD   91 (111)
Q Consensus        80 ~~~C~~C~~~~~   91 (111)
                      -|+|..||..+.
T Consensus         4 ~ykC~~CGniv~   15 (34)
T cd00974           4 VYKCEICGNIVE   15 (34)
T ss_pred             EEEcCCCCcEEE
Confidence            478888887664


No 232
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=25.03  E-value=49  Score=22.05  Aligned_cols=15  Identities=47%  Similarity=0.793  Sum_probs=8.9

Q ss_pred             CceecCCCccccccc
Q psy370           79 RGFVCEICGHVVDEM   93 (111)
Q Consensus        79 ~~~~C~~C~~~~~~~   93 (111)
                      +.|.|+.||..+..+
T Consensus       321 r~~~C~~cg~~~~rD  335 (364)
T COG0675         321 RLFKCPRCGFVHDRD  335 (364)
T ss_pred             eeEECCCCCCeehhh
Confidence            346677777655444


No 233
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=24.61  E-value=74  Score=26.34  Aligned_cols=9  Identities=33%  Similarity=1.006  Sum_probs=5.9

Q ss_pred             ccCCCcccc
Q psy370           23 SQCPVCKKI   31 (111)
Q Consensus        23 ~~c~~C~~~   31 (111)
                      +.|+.||..
T Consensus       668 rkCPkCG~~  676 (1337)
T PRK14714        668 RRCPSCGTE  676 (1337)
T ss_pred             EECCCCCCc
Confidence            567777753


No 234
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=24.48  E-value=44  Score=19.84  Aligned_cols=9  Identities=33%  Similarity=0.988  Sum_probs=4.3

Q ss_pred             eecCCCccc
Q psy370           81 FVCEICGHV   89 (111)
Q Consensus        81 ~~C~~C~~~   89 (111)
                      |.|..|+..
T Consensus       134 y~C~~C~g~  142 (146)
T smart00731      134 YRCGKCGGK  142 (146)
T ss_pred             EEcCCCCCE
Confidence            455555443


No 235
>KOG4727|consensus
Probab=24.27  E-value=46  Score=20.76  Aligned_cols=22  Identities=27%  Similarity=0.602  Sum_probs=18.9

Q ss_pred             cccCCCcccccCCHHHHHHHHH
Q psy370           22 ASQCPVCKKIYTDQQLFQNHLE   43 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~~h~~   43 (111)
                      -|.|.+|.-.+...-.+..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            5999999999998888887764


No 236
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=24.24  E-value=44  Score=14.58  Aligned_cols=11  Identities=36%  Similarity=0.776  Sum_probs=7.1

Q ss_pred             eecCCCccccc
Q psy370           81 FVCEICGHVVD   91 (111)
Q Consensus        81 ~~C~~C~~~~~   91 (111)
                      +.|..|+.+|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            46777776653


No 237
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=24.22  E-value=44  Score=24.23  Aligned_cols=17  Identities=35%  Similarity=0.636  Sum_probs=11.1

Q ss_pred             cccCcccCCCcccccCC
Q psy370           18 TIFVASQCPVCKKIYTD   34 (111)
Q Consensus        18 ~~~~~~~c~~C~~~f~~   34 (111)
                      .....|.|..||..|..
T Consensus       421 ~~~~~~~c~~c~~~yd~  437 (479)
T PRK05452        421 DLGPRMQCSVCQWIYDP  437 (479)
T ss_pred             CCCCeEEECCCCeEECC
Confidence            34556778888777654


No 238
>PLN02748 tRNA dimethylallyltransferase
Probab=24.13  E-value=65  Score=23.46  Aligned_cols=24  Identities=21%  Similarity=0.536  Sum_probs=17.6

Q ss_pred             CCccccccCc-ccCCHHHHHHHHHh
Q psy370           49 MDYSCEHCDM-QFNCKSDMRKHVHS   72 (111)
Q Consensus        49 ~~~~c~~c~~-~f~~~~~l~~h~~~   72 (111)
                      +.|.|.+|+. .+.....+..|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4567888886 67777777777664


No 239
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=23.49  E-value=33  Score=19.78  Aligned_cols=12  Identities=42%  Similarity=0.850  Sum_probs=7.6

Q ss_pred             CcccCCCccccc
Q psy370           21 VASQCPVCKKIY   32 (111)
Q Consensus        21 ~~~~c~~C~~~f   32 (111)
                      ....|+.|++..
T Consensus        68 v~V~CP~C~K~T   79 (114)
T PF11023_consen   68 VQVECPNCGKQT   79 (114)
T ss_pred             eeeECCCCCChH
Confidence            455677777653


No 240
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.11  E-value=43  Score=17.21  Aligned_cols=13  Identities=31%  Similarity=0.470  Sum_probs=10.5

Q ss_pred             eecCCCccccccc
Q psy370           81 FVCEICGHVVDEM   93 (111)
Q Consensus        81 ~~C~~C~~~~~~~   93 (111)
                      -+|+.||+.+.+.
T Consensus         8 v~CP~Cgkpv~w~   20 (65)
T COG3024           8 VPCPTCGKPVVWG   20 (65)
T ss_pred             ccCCCCCCccccc
Confidence            4799999988774


No 241
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=23.04  E-value=13  Score=20.71  Aligned_cols=14  Identities=21%  Similarity=0.368  Sum_probs=10.0

Q ss_pred             CcccCCCcccccCC
Q psy370           21 VASQCPVCKKIYTD   34 (111)
Q Consensus        21 ~~~~c~~C~~~f~~   34 (111)
                      ..+.|+.|+..+..
T Consensus        15 ~~~~C~~C~~~~~~   28 (104)
T TIGR01384        15 GVYVCPSCGYEKEK   28 (104)
T ss_pred             CeEECcCCCCcccc
Confidence            36789999876553


No 242
>KOG1701|consensus
Probab=22.92  E-value=17  Score=26.01  Aligned_cols=41  Identities=24%  Similarity=0.432  Sum_probs=21.6

Q ss_pred             cCCCcccccCCHHHHHHHH--HHcCCCCCccccccCcccCCHHHH
Q psy370           24 QCPVCKKIYTDQQLFQNHL--ETHDNEMDYSCEHCDMQFNCKSDM   66 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~--~~h~~~~~~~c~~c~~~f~~~~~l   66 (111)
                      .|..|++...-...-.+=|  ..|.  .-|.|..|.+.....+.+
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv--~CFtC~~C~r~L~Gq~FY  318 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHV--QCFTCRTCRRQLAGQSFY  318 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcc--cceehHhhhhhhcccccc
Confidence            6888888665443322212  2232  356777776654444333


No 243
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=22.90  E-value=28  Score=20.68  Aligned_cols=11  Identities=27%  Similarity=0.821  Sum_probs=6.6

Q ss_pred             ceecCCCcccc
Q psy370           80 GFVCEICGHVV   90 (111)
Q Consensus        80 ~~~C~~C~~~~   90 (111)
                      .|.|..|+..+
T Consensus       143 ~~~C~~C~~~l  153 (157)
T PF10263_consen  143 RYRCGRCGGPL  153 (157)
T ss_pred             hEECCCCCCEE
Confidence            36677776544


No 244
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=22.72  E-value=92  Score=22.16  Aligned_cols=10  Identities=20%  Similarity=0.644  Sum_probs=5.9

Q ss_pred             ccCCCccccc
Q psy370           23 SQCPVCKKIY   32 (111)
Q Consensus        23 ~~c~~C~~~f   32 (111)
                      -.|++|+..+
T Consensus        14 ~~C~~Cd~l~   23 (403)
T TIGR00155        14 ILCSQCDMLV   23 (403)
T ss_pred             eeCCCCCCcc
Confidence            3477776543


No 245
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=22.71  E-value=67  Score=17.70  Aligned_cols=18  Identities=22%  Similarity=0.545  Sum_probs=14.3

Q ss_pred             cccCCCcccccCCHHHHH
Q psy370           22 ASQCPVCKKIYTDQQLFQ   39 (111)
Q Consensus        22 ~~~c~~C~~~f~~~~~l~   39 (111)
                      ...|+.||..|-+.+.+.
T Consensus        35 a~~C~~CGe~y~~dev~~   52 (89)
T TIGR03829        35 SISCSHCGMEYQDDTTVK   52 (89)
T ss_pred             cccccCCCcEeecHHHHH
Confidence            366999999998887654


No 246
>KOG1940|consensus
Probab=22.63  E-value=83  Score=21.23  Aligned_cols=18  Identities=28%  Similarity=0.672  Sum_probs=10.1

Q ss_pred             ccCCCcccccCCHHHHHHH
Q psy370           23 SQCPVCKKIYTDQQLFQNH   41 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h   41 (111)
                      |.|+.|.+ ..+...+-.+
T Consensus       197 y~CP~C~~-~~d~~~~~~~  214 (276)
T KOG1940|consen  197 YTCPICSK-PGDMSHYFRK  214 (276)
T ss_pred             CCCCcccc-hHHHHHHHHH
Confidence            67777776 4444444433


No 247
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=22.63  E-value=41  Score=16.47  Aligned_cols=6  Identities=33%  Similarity=1.021  Sum_probs=2.7

Q ss_pred             ccccCc
Q psy370           53 CEHCDM   58 (111)
Q Consensus        53 c~~c~~   58 (111)
                      |+.||.
T Consensus         3 CPyCge    8 (52)
T PF14255_consen    3 CPYCGE    8 (52)
T ss_pred             CCCCCC
Confidence            444444


No 248
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=22.59  E-value=22  Score=16.21  Aligned_cols=11  Identities=27%  Similarity=0.821  Sum_probs=3.7

Q ss_pred             cCCCccccccc
Q psy370           83 CEICGHVVDEM   93 (111)
Q Consensus        83 C~~C~~~~~~~   93 (111)
                      |..|++.+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            56677766554


No 249
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=22.51  E-value=70  Score=14.38  Aligned_cols=14  Identities=14%  Similarity=0.610  Sum_probs=4.8

Q ss_pred             ceecCCCccccccc
Q psy370           80 GFVCEICGHVVDEM   93 (111)
Q Consensus        80 ~~~C~~C~~~~~~~   93 (111)
                      .|-|..|..-|...
T Consensus         3 ryyCdyC~~~~~~d   16 (38)
T PF06220_consen    3 RYYCDYCKKYLTHD   16 (38)
T ss_dssp             S-B-TTT--B-S--
T ss_pred             CeecccccceecCC
Confidence            46688888877433


No 250
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.44  E-value=28  Score=20.52  Aligned_cols=16  Identities=25%  Similarity=0.538  Sum_probs=8.2

Q ss_pred             CCCccccccCcccCCH
Q psy370           48 EMDYSCEHCDMQFNCK   63 (111)
Q Consensus        48 ~~~~~c~~c~~~f~~~   63 (111)
                      +.|-.|..||..|.+.
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            3444555555555443


No 251
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=22.24  E-value=67  Score=14.46  Aligned_cols=18  Identities=22%  Similarity=0.252  Sum_probs=11.7

Q ss_pred             ceecCCCccccccchhHH
Q psy370           80 GFVCEICGHVVDEMPVAT   97 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~l~   97 (111)
                      -..|..|+-.|-....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            356777777776665554


No 252
>PRK10220 hypothetical protein; Provisional
Probab=21.91  E-value=36  Score=19.49  Aligned_cols=29  Identities=31%  Similarity=0.754  Sum_probs=16.0

Q ss_pred             cCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCH
Q psy370           24 QCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCK   63 (111)
Q Consensus        24 ~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   63 (111)
                      .|+.|+..|....           ...|.|+.|+..+...
T Consensus         5 ~CP~C~seytY~d-----------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED-----------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC-----------CCeEECCcccCcCCcc
Confidence            4666665554332           2346777777655443


No 253
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=21.73  E-value=51  Score=16.16  Aligned_cols=6  Identities=50%  Similarity=1.381  Sum_probs=2.9

Q ss_pred             cCCCcc
Q psy370           83 CEICGH   88 (111)
Q Consensus        83 C~~C~~   88 (111)
                      |..||.
T Consensus        32 C~~Cga   37 (61)
T PF14354_consen   32 CTDCGA   37 (61)
T ss_pred             cCCCCC
Confidence            455543


No 254
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=21.54  E-value=40  Score=16.16  Aligned_cols=9  Identities=44%  Similarity=1.313  Sum_probs=3.5

Q ss_pred             cccCCCccc
Q psy370           22 ASQCPVCKK   30 (111)
Q Consensus        22 ~~~c~~C~~   30 (111)
                      .|.|++|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            488888875


No 255
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=21.52  E-value=58  Score=15.73  Aligned_cols=16  Identities=25%  Similarity=0.449  Sum_probs=12.1

Q ss_pred             ceecCCCccccccchh
Q psy370           80 GFVCEICGHVVDEMPV   95 (111)
Q Consensus        80 ~~~C~~C~~~~~~~~~   95 (111)
                      -++|..||..|..+-.
T Consensus        28 ~W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   28 WWKCPKCGHEWKASVN   43 (55)
T ss_pred             EEECCCCCCeeEccHh
Confidence            4789999988876643


No 256
>KOG4118|consensus
Probab=20.90  E-value=37  Score=17.56  Aligned_cols=24  Identities=13%  Similarity=0.184  Sum_probs=10.5

Q ss_pred             eecCCCccccccchhHHhhccccC
Q psy370           81 FVCEICGHVVDEMPVATQSSKYPG  104 (111)
Q Consensus        81 ~~C~~C~~~~~~~~~l~~h~~~~~  104 (111)
                      +.|..|.-.-.....+.+|.-.-|
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kH   62 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKH   62 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcC
Confidence            344444444444444444443333


No 257
>KOG0782|consensus
Probab=20.82  E-value=9.2  Score=28.48  Aligned_cols=51  Identities=22%  Similarity=0.314  Sum_probs=28.4

Q ss_pred             HHHHHHHHcCCCCCccccccCcccCCHHHHHHHHHhccCCCCCceecCCCccccccch
Q psy370           37 LFQNHLETHDNEMDYSCEHCDMQFNCKSDMRKHVHSHLSMEERGFVCEICGHVVDEMP   94 (111)
Q Consensus        37 ~l~~h~~~h~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~~~~~~~~C~~C~~~~~~~~   94 (111)
                      .|..|-=+|.....-.|..|++.|..+-.+      |.. ......|..|...|-.+.
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsK-EivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSK-EIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheee------ccc-cEEEEEehHHHHHhhcch
Confidence            455555555544455777787777654333      221 223456777777665553


No 258
>KOG1088|consensus
Probab=20.79  E-value=68  Score=18.69  Aligned_cols=19  Identities=26%  Similarity=0.251  Sum_probs=14.6

Q ss_pred             CCCceecCCCccccccchh
Q psy370           77 EERGFVCEICGHVVDEMPV   95 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~~~   95 (111)
                      .|-...|+.||+.|.-++.
T Consensus        95 ~EG~l~CpetG~vfpI~~G  113 (124)
T KOG1088|consen   95 IEGELVCPETGRVFPISDG  113 (124)
T ss_pred             ccceEecCCCCcEeecccC
Confidence            4456789999999987754


No 259
>PRK01343 zinc-binding protein; Provisional
Probab=20.68  E-value=48  Score=16.62  Aligned_cols=12  Identities=42%  Similarity=0.805  Sum_probs=9.5

Q ss_pred             cccCCCcccccC
Q psy370           22 ASQCPVCKKIYT   33 (111)
Q Consensus        22 ~~~c~~C~~~f~   33 (111)
                      ...|++|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            357999999874


No 260
>PRK06260 threonine synthase; Validated
Probab=20.67  E-value=72  Score=22.42  Aligned_cols=29  Identities=28%  Similarity=0.654  Sum_probs=18.0

Q ss_pred             ccCCCcccccCCHHHHHHHHHHcCCCCCccccccCcccCCH
Q psy370           23 SQCPVCKKIYTDQQLFQNHLETHDNEMDYSCEHCDMQFNCK   63 (111)
Q Consensus        23 ~~c~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~c~~~f~~~   63 (111)
                      +.|..||+.|.            .....+.|+.|+..+...
T Consensus         4 ~~C~~cg~~~~------------~~~~~~~Cp~cg~~l~~~   32 (397)
T PRK06260          4 LKCIECGKEYD------------PDEIIYTCPECGGLLEVI   32 (397)
T ss_pred             EEECCCCCCCC------------CCCccccCCCCCCeEEEE
Confidence            56778887652            223457788887654444


No 261
>KOG3014|consensus
Probab=20.53  E-value=41  Score=22.31  Aligned_cols=23  Identities=17%  Similarity=0.348  Sum_probs=12.7

Q ss_pred             ecCCCccccccch--hHHhhccccC
Q psy370           82 VCEICGHVVDEMP--VATQSSKYPG  104 (111)
Q Consensus        82 ~C~~C~~~~~~~~--~l~~h~~~~~  104 (111)
                      .|..||..++..+  +-..|.++|.
T Consensus        39 ~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   39 KCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             ehhhcCceecCCCHHHHHHHHHHHH
Confidence            5666666554333  3555666654


No 262
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.51  E-value=37  Score=22.32  Aligned_cols=24  Identities=13%  Similarity=0.379  Sum_probs=14.6

Q ss_pred             CCCccccccCcccCCHHHHHHHHH
Q psy370           48 EMDYSCEHCDMQFNCKSDMRKHVH   71 (111)
Q Consensus        48 ~~~~~c~~c~~~f~~~~~l~~h~~   71 (111)
                      .+.+.|++|+..|.....+..-.|
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiR   40 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIR   40 (267)
T ss_pred             hceeccCcccchhhhhheecccee
Confidence            355677777777766555444444


No 263
>KOG3352|consensus
Probab=20.48  E-value=49  Score=20.14  Aligned_cols=16  Identities=25%  Similarity=0.513  Sum_probs=12.0

Q ss_pred             CCceecCCCccccccc
Q psy370           78 ERGFVCEICGHVVDEM   93 (111)
Q Consensus        78 ~~~~~C~~C~~~~~~~   93 (111)
                      .+.++|..||..|.-.
T Consensus       131 ge~~rc~eCG~~fkL~  146 (153)
T KOG3352|consen  131 GETQRCPECGHYFKLV  146 (153)
T ss_pred             CCcccCCcccceEEee
Confidence            4567899999988643


No 264
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=20.45  E-value=70  Score=21.17  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=6.7

Q ss_pred             CCccccccCcccC
Q psy370           49 MDYSCEHCDMQFN   61 (111)
Q Consensus        49 ~~~~c~~c~~~f~   61 (111)
                      ..+.|..|+..+.
T Consensus       121 ~~~~C~~C~~~~~  133 (250)
T COG0846         121 KRVRCSKCGNQYY  133 (250)
T ss_pred             eeeEeCCCcCccc
Confidence            3455566655444


No 265
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.43  E-value=36  Score=20.82  Aligned_cols=18  Identities=22%  Similarity=0.254  Sum_probs=15.0

Q ss_pred             CCCceecCCCccccccch
Q psy370           77 EERGFVCEICGHVVDEMP   94 (111)
Q Consensus        77 ~~~~~~C~~C~~~~~~~~   94 (111)
                      -+.|.-|..||+.|+|--
T Consensus        65 ~~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCCChhHHhCCCCCchHH
Confidence            457888999999998874


Done!