BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3703
         (79 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HYM|B Chain B, Insights Into Anaphase Promoting Complex Tpr Subdomain
          Assembly From A Cdc26-Apc6 Structure
 pdb|3HYM|D Chain D, Insights Into Anaphase Promoting Complex Tpr Subdomain
          Assembly From A Cdc26-Apc6 Structure
 pdb|3HYM|F Chain F, Insights Into Anaphase Promoting Complex Tpr Subdomain
          Assembly From A Cdc26-Apc6 Structure
 pdb|3HYM|H Chain H, Insights Into Anaphase Promoting Complex Tpr Subdomain
          Assembly From A Cdc26-Apc6 Structure
 pdb|3HYM|J Chain J, Insights Into Anaphase Promoting Complex Tpr Subdomain
          Assembly From A Cdc26-Apc6 Structure
 pdb|3HYM|L Chain L, Insights Into Anaphase Promoting Complex Tpr Subdomain
          Assembly From A Cdc26-Apc6 Structure
          Length = 330

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 44/67 (65%), Gaps = 7/67 (10%)

Query: 5  YEVPSLSVLPD-------NLDMMVANAERLYYGCAYKKCFTITEQVLSRDPYHTACLPLH 57
          Y  PS +V+P+       NLD++V+ AER YY C +K C+ +T  V  +DP+H +CLP+H
Sbjct: 3  YNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKXCYKLTSVVXEKDPFHASCLPVH 62

Query: 58 IACLVEM 64
          I  LVE+
Sbjct: 63 IGTLVEL 69


>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1
 pdb|2XPI|D Chain D, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1
          Length = 597

 Score = 34.7 bits (78), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 7   VPSLSVLPDNLDMMVANAERLYYGCAYKKCFTITEQVLSRDPYHTACLPLHIACLVE 63
           + S++ L  + D+++  A+ L+    +     IT ++L  DPY+    PLH+A L E
Sbjct: 295 LSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHE 351


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.138    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,850,260
Number of Sequences: 62578
Number of extensions: 49504
Number of successful extensions: 131
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 128
Number of HSP's gapped (non-prelim): 3
length of query: 79
length of database: 14,973,337
effective HSP length: 48
effective length of query: 31
effective length of database: 11,969,593
effective search space: 371057383
effective search space used: 371057383
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)