RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3703
         (79 letters)



>gnl|CDD|239760 cd04093, HBS1_C, HBS1_C: this family represents the C-terminal
          domain of Hsp70 subfamily B suppressor 1 (HBS1) which
          is homologous to the domain III of EF-1alpha. This
          group contains proteins similar to yeast Hbs1, a G
          protein known to be important for efficient growth and
          protein synthesis under conditions of limiting
          translation initiation and, to associate with Dom34.
          It has been speculated that yeast Hbs1 and Dom34
          proteins may function as part of a complex with a role
          in gene expression.
          Length = 107

 Score = 29.5 bits (67), Expect = 0.079
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%)

Query: 49 YHTACLPLHIACLVE-MNKSNSKLKKKKKK 77
           H+   P  I  LV  ++KS  ++ KKK +
Sbjct: 29 RHSLKEPATITKLVSILDKSTGEVSKKKPR 58


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.319    0.132    0.391 

Gapped
Lambda     K      H
   0.267   0.0745    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,759,248
Number of extensions: 271849
Number of successful extensions: 306
Number of sequences better than 10.0: 1
Number of HSP's gapped: 302
Number of HSP's successfully gapped: 6
Length of query: 79
Length of database: 10,937,602
Length adjustment: 48
Effective length of query: 31
Effective length of database: 8,808,610
Effective search space: 273066910
Effective search space used: 273066910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.2 bits)