RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy3703
(79 letters)
>gnl|CDD|239760 cd04093, HBS1_C, HBS1_C: this family represents the C-terminal
domain of Hsp70 subfamily B suppressor 1 (HBS1) which
is homologous to the domain III of EF-1alpha. This
group contains proteins similar to yeast Hbs1, a G
protein known to be important for efficient growth and
protein synthesis under conditions of limiting
translation initiation and, to associate with Dom34.
It has been speculated that yeast Hbs1 and Dom34
proteins may function as part of a complex with a role
in gene expression.
Length = 107
Score = 29.5 bits (67), Expect = 0.079
Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
Query: 49 YHTACLPLHIACLVE-MNKSNSKLKKKKKK 77
H+ P I LV ++KS ++ KKK +
Sbjct: 29 RHSLKEPATITKLVSILDKSTGEVSKKKPR 58
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.319 0.132 0.391
Gapped
Lambda K H
0.267 0.0745 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,759,248
Number of extensions: 271849
Number of successful extensions: 306
Number of sequences better than 10.0: 1
Number of HSP's gapped: 302
Number of HSP's successfully gapped: 6
Length of query: 79
Length of database: 10,937,602
Length adjustment: 48
Effective length of query: 31
Effective length of database: 8,808,610
Effective search space: 273066910
Effective search space used: 273066910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.2 bits)