BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy3709
(119 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2XND|J Chain J, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|K Chain K, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|L Chain L, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|M Chain M, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|N Chain N, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|O Chain O, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|P Chain P, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
pdb|2XND|Q Chain Q, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
Length = 72
Score = 64.7 bits (156), Expect = 1e-11, Method: Compositional matrix adjust.
Identities = 34/57 (59%), Positives = 35/57 (61%)
Query: 46 IDSAAKFIXXXXXXXXXXXXXXXXXXXXXXLIIGYARNPSLKQQLFSYAILGFALSE 102
ID+AAKFI LIIGYARNPSLKQQLFSYAILGFALSE
Sbjct: 1 IDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 57
>pdb|2WPD|J Chain J, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|K Chain K, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|L Chain L, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|M Chain M, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|N Chain N, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|O Chain O, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|P Chain P, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|Q Chain Q, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|R Chain R, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2WPD|S Chain S, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
pdb|2XOK|K Chain K, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|L Chain L, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|M Chain M, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|N Chain N, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|O Chain O, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|P Chain P, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|Q Chain Q, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|R Chain R, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|S Chain S, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|2XOK|T Chain T, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
Resolution
pdb|3ZRY|J Chain J, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|K Chain K, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|L Chain L, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|M Chain M, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|N Chain N, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|O Chain O, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|P Chain P, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|Q Chain Q, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|R Chain R, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|3ZRY|S Chain S, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
Yeast F-Atp Synthase
pdb|4B2Q|J Chain J, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|K Chain K, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|L Chain L, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|M Chain M, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|N Chain N, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|O Chain O, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|P Chain P, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|Q Chain Q, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|R Chain R, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|S Chain S, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|JJ Chain j, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|KK Chain k, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|LL Chain l, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|MM Chain m, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|NN Chain n, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|OO Chain o, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|PP Chain p, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|QQ Chain q, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|RR Chain r, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
pdb|4B2Q|SS Chain s, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
Subtomogram Average
Length = 76
Score = 38.1 bits (87), Expect = 0.001, Method: Compositional matrix adjust.
Identities = 18/27 (66%), Positives = 21/27 (77%)
Query: 76 LIIGYARNPSLKQQLFSYAILGFALSE 102
LI G +RNPS+K +F AILGFALSE
Sbjct: 33 LINGVSRNPSIKDTVFPMAILGFALSE 59
>pdb|3U2F|K Chain K, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 8.3
pdb|3U2F|L Chain L, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 8.3
pdb|3U2F|M Chain M, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 8.3
pdb|3U2F|N Chain N, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 8.3
pdb|3U2F|O Chain O, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 8.3
pdb|3U2Y|K Chain K, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 6.1
pdb|3U2Y|L Chain L, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 6.1
pdb|3U2Y|M Chain M, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 6.1
pdb|3U2Y|N Chain N, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 6.1
pdb|3U2Y|O Chain O, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 6.1
pdb|3U32|K Chain K, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
pdb|3U32|L Chain L, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
pdb|3U32|M Chain M, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
pdb|3U32|N Chain N, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
pdb|3U32|O Chain O, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
pdb|3UD0|K Chain K, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 5.5
pdb|3UD0|L Chain L, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 5.5
pdb|3UD0|M Chain M, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 5.5
pdb|3UD0|N Chain N, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 5.5
pdb|3UD0|O Chain O, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
Ph 5.5
pdb|4F4S|A Chain A, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|B Chain B, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|C Chain C, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|D Chain D, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|E Chain E, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|K Chain K, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|L Chain L, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|M Chain M, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|N Chain N, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
pdb|4F4S|O Chain O, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
Oligomycin
Length = 76
Score = 37.7 bits (86), Expect = 0.001, Method: Compositional matrix adjust.
Identities = 18/27 (66%), Positives = 21/27 (77%)
Query: 76 LIIGYARNPSLKQQLFSYAILGFALSE 102
LI G +RNPS+K +F AILGFALSE
Sbjct: 33 LINGVSRNPSIKDTVFPMAILGFALSE 59
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.136 0.371
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,152,818
Number of Sequences: 62578
Number of extensions: 13838
Number of successful extensions: 17
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 3
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)