BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3711
         (141 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2XND|J Chain J, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|K Chain K, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|L Chain L, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|M Chain M, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|N Chain N, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|O Chain O, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|P Chain P, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
 pdb|2XND|Q Chain Q, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
           Synthase
          Length = 72

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 35/57 (61%)

Query: 68  IDSAAKFIXXXXXXXXXXXXXXXXXXXXXXLIIGYARNPSLKQQLFSYAILGFALSE 124
           ID+AAKFI                      LIIGYARNPSLKQQLFSYAILGFALSE
Sbjct: 1   IDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 57


>pdb|2WPD|J Chain J, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|K Chain K, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|L Chain L, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|M Chain M, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|N Chain N, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|O Chain O, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|P Chain P, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|Q Chain Q, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|R Chain R, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2WPD|S Chain S, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase
 pdb|2XOK|K Chain K, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|L Chain L, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|M Chain M, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|N Chain N, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|O Chain O, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|P Chain P, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|Q Chain Q, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|R Chain R, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|S Chain S, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|2XOK|T Chain T, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A
           Resolution
 pdb|3ZRY|J Chain J, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|K Chain K, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|L Chain L, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|M Chain M, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|N Chain N, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|O Chain O, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|P Chain P, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|Q Chain Q, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|R Chain R, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|3ZRY|S Chain S, Rotor Architecture In The F(1)-C(10)-Ring Complex Of The
           Yeast F-Atp Synthase
 pdb|4B2Q|J Chain J, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|K Chain K, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|L Chain L, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|M Chain M, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|N Chain N, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|O Chain O, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|P Chain P, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|Q Chain Q, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|R Chain R, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|S Chain S, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|JJ Chain j, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|KK Chain k, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|LL Chain l, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|MM Chain m, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|NN Chain n, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|OO Chain o, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|PP Chain p, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|QQ Chain q, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|RR Chain r, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
 pdb|4B2Q|SS Chain s, Model Of The Yeast F1fo-Atp Synthase Dimer Based On
           Subtomogram Average
          Length = 76

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 21/27 (77%)

Query: 98  LIIGYARNPSLKQQLFSYAILGFALSE 124
           LI G +RNPS+K  +F  AILGFALSE
Sbjct: 33  LINGVSRNPSIKDTVFPMAILGFALSE 59


>pdb|3U2F|K Chain K, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 8.3
 pdb|3U2F|L Chain L, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 8.3
 pdb|3U2F|M Chain M, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 8.3
 pdb|3U2F|N Chain N, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 8.3
 pdb|3U2F|O Chain O, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 8.3
 pdb|3U2Y|K Chain K, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 6.1
 pdb|3U2Y|L Chain L, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 6.1
 pdb|3U2Y|M Chain M, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 6.1
 pdb|3U2Y|N Chain N, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 6.1
 pdb|3U2Y|O Chain O, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 6.1
 pdb|3U32|K Chain K, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
 pdb|3U32|L Chain L, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
 pdb|3U32|M Chain M, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
 pdb|3U32|N Chain N, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
 pdb|3U32|O Chain O, Atp Synthase C10 Ring Reacted With Dccd At Ph 5.5
 pdb|3UD0|K Chain K, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 5.5
 pdb|3UD0|L Chain L, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 5.5
 pdb|3UD0|M Chain M, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 5.5
 pdb|3UD0|N Chain N, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 5.5
 pdb|3UD0|O Chain O, Atp Synthase C10 Ring In Proton-Unlocked Conformation At
           Ph 5.5
 pdb|4F4S|A Chain A, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|B Chain B, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|C Chain C, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|D Chain D, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|E Chain E, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|K Chain K, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|L Chain L, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|M Chain M, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|N Chain N, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
 pdb|4F4S|O Chain O, Structure Of The Yeast F1fo Atpase C10 Ring With Bound
           Oligomycin
          Length = 76

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 21/27 (77%)

Query: 98  LIIGYARNPSLKQQLFSYAILGFALSE 124
           LI G +RNPS+K  +F  AILGFALSE
Sbjct: 33  LINGVSRNPSIKDTVFPMAILGFALSE 59


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.137    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,174,435
Number of Sequences: 62578
Number of extensions: 14018
Number of successful extensions: 17
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 3
length of query: 141
length of database: 14,973,337
effective HSP length: 89
effective length of query: 52
effective length of database: 9,403,895
effective search space: 489002540
effective search space used: 489002540
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 46 (22.3 bits)