Query         psy3720
Match_columns 190
No_of_seqs    20 out of 22
Neff          2.0 
Searched_HMMs 46136
Date          Fri Aug 16 23:50:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3720.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3720hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05454 DAG1:  Dystroglycan (D  88.7    0.13 2.8E-06   45.7   0.0   31   23-53    148-178 (290)
  2 PF05454 DAG1:  Dystroglycan (D  88.0    0.15 3.3E-06   45.3   0.0   69   84-165   148-229 (290)
  3 PF01299 Lamp:  Lysosome-associ  81.6     1.1 2.4E-05   38.4   2.3   30   84-113   270-300 (306)
  4 PF12273 RCR:  Chitin synthesis  76.6    0.28   6E-06   37.4  -2.5   15   46-60     23-37  (130)
  5 PF04478 Mid2:  Mid2 like cell   59.6     7.4 0.00016   32.6   2.3   27   24-50     54-80  (154)
  6 PF15102 TMEM154:  TMEM154 prot  56.0      15 0.00032   30.5   3.4   22   85-106    61-82  (146)
  7 PF15102 TMEM154:  TMEM154 prot  54.6      12 0.00026   31.1   2.7   26   24-49     61-86  (146)
  8 PF04478 Mid2:  Mid2 like cell   52.3      14  0.0003   31.0   2.7   28   84-111    53-80  (154)
  9 PF12273 RCR:  Chitin synthesis  49.8     4.8 0.00011   30.7  -0.3    7  104-110    21-27  (130)
 10 PF06809 NPDC1:  Neural prolife  43.3      66  0.0014   30.2   5.8   68   46-113   151-229 (341)
 11 PF15012 DUF4519:  Domain of un  43.0      15 0.00032   26.5   1.4   17   84-100    32-48  (56)
 12 PHA03283 envelope glycoprotein  37.5      43 0.00093   33.0   3.9   39   71-111   390-428 (542)
 13 PF13908 Shisa:  Wnt and FGF in  34.3      98  0.0021   24.5   4.9   18   84-101    79-96  (179)
 14 PF07213 DAP10:  DAP10 membrane  33.7      40 0.00087   25.7   2.5   36   85-124    35-72  (79)
 15 PF02480 Herpes_gE:  Alphaherpe  32.6      15 0.00032   34.2   0.0   22  141-162   416-438 (439)
 16 PF13908 Shisa:  Wnt and FGF in  30.1      23  0.0005   28.0   0.7   20   21-40     77-96  (179)
 17 KOG4818|consensus               26.6      44 0.00096   31.4   2.0   31   81-111   323-354 (362)
 18 PF02480 Herpes_gE:  Alphaherpe  25.0      24 0.00052   32.9   0.0   24   30-53    362-385 (439)
 19 KOG1094|consensus               24.5      56  0.0012   33.5   2.4   24   87-110   394-417 (807)
 20 PF09764 Nt_Gln_amidase:  N-ter  24.3      33 0.00072   29.1   0.7   16  136-151   125-141 (184)
 21 PRK13686 hypothetical protein;  24.2      18 0.00039   24.9  -0.7   35   77-112     7-41  (43)
 22 PF15298 AJAP1_PANP_C:  AJAP1/P  23.4      34 0.00073   30.0   0.6   26   79-104    94-119 (205)
 23 PF07760 DUF1616:  Protein of u  23.2      42 0.00092   28.8   1.1   25   25-49     86-110 (287)
 24 PHA02902 putative IMV membrane  22.8      45 0.00097   25.1   1.0   18   89-106     7-24  (70)
 25 PF06365 CD34_antigen:  CD34/Po  22.3      91   0.002   26.9   2.9   33   94-126   112-145 (202)
 26 PF07004 SHIPPO-rpt:  Sperm-tai  21.0      45 0.00098   18.4   0.6    8  156-164     2-9   (37)
 27 PF11406 Tachystatin_A:  Antimi  20.9      33 0.00072   23.7   0.0   11  157-167    33-43  (44)
 28 PF08693 SKG6:  Transmembrane a  20.5      71  0.0015   21.5   1.5   12   84-95     16-27  (40)

No 1  
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=88.70  E-value=0.13  Score=45.74  Aligned_cols=31  Identities=16%  Similarity=0.307  Sum_probs=0.0

Q ss_pred             ceeeehhhhhHHHhheeeeeEEEeecccCCc
Q psy3720          23 NAVVPIGATVIVVFVGLLVVCFAVSRRKGDG   53 (190)
Q Consensus        23 N~vVPv~A~i~Viiv~ivViCv~~~rrkg~g   53 (190)
                      +++.+++.+++.+|+|||+.|..|.||||+-
T Consensus       148 T~IpaVVI~~iLLIA~iIa~icyrrkR~GK~  178 (290)
T PF05454_consen  148 TFIPAVVIAAILLIAGIIACICYRRKRKGKM  178 (290)
T ss_dssp             -------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhhhcccc
Confidence            3566666666667778888888888888764


No 2  
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=88.01  E-value=0.15  Score=45.30  Aligned_cols=69  Identities=20%  Similarity=0.384  Sum_probs=0.0

Q ss_pred             ceeehhhHHHHHHHHHHhheeeeeecccCCCcccccCceeEeeccCCCcccccccc----chhhcCccCCC-CCC-----
Q psy3720          84 NAVVPIGATVIVVFVGLLVVCFAVSRRKGDGQTRLRDDIVYNQSMVGGMNTVDKRH----INEELGYIAPP-NRK-----  153 (190)
Q Consensus        84 nlvVPv~AtilViiv~ivViCv~~~Rr~g~~~~~~~dDvVYnqs~~~g~~TlDKrr----lrDELGYIaPP-NRK-----  153 (190)
                      +++.+++.+++.+|+|+|+.|.++.||+|+...   +|         - +|.=+++    +-|||-=.-|+ --|     
T Consensus       148 T~IpaVVI~~iLLIA~iIa~icyrrkR~GK~~~---ee---------~-~~f~~KGiPvIF~dElee~kp~~~~~~P~Il  214 (290)
T PF05454_consen  148 TFIPAVVIAAILLIAGIIACICYRRKRKGKMSL---EE---------Q-KTFISKGIPVIFQDELEESKPEPGSKSPVIL  214 (290)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhhhcccccc---ch---------h-HHHHhcCCceeccccccccCCCCCCCCCeee
Confidence            466677777778888888888888888886521   11         1 1333334    67777664443 222     


Q ss_pred             ---CCCCCCCCCcch
Q psy3720         154 ---LPPVPGSNYNTC  165 (190)
Q Consensus       154 ---LPPVPGSnYNTC  165 (190)
                         =||.|.+.|+.-
T Consensus       215 keEkPPl~pp~y~~~  229 (290)
T PF05454_consen  215 KEEKPPLPPPEYPNS  229 (290)
T ss_dssp             ---------------
T ss_pred             cccCCCCCCCCCCCC
Confidence               367888888753


No 3  
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=81.63  E-value=1.1  Score=38.42  Aligned_cols=30  Identities=20%  Similarity=0.506  Sum_probs=19.2

Q ss_pred             ceeehh-hHHHHHHHHHHhheeeeeecccCC
Q psy3720          84 NAVVPI-GATVIVVFVGLLVVCFAVSRRKGD  113 (190)
Q Consensus        84 nlvVPv-~AtilViiv~ivViCv~~~Rr~g~  113 (190)
                      +.+||| +.++|+.++.|++|.++.+|||..
T Consensus       270 ~~~vPIaVG~~La~lvlivLiaYli~Rrr~~  300 (306)
T PF01299_consen  270 SDLVPIAVGAALAGLVLIVLIAYLIGRRRSR  300 (306)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhheeEecccc
Confidence            788999 444555566666666666666543


No 4  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=76.59  E-value=0.28  Score=37.40  Aligned_cols=15  Identities=33%  Similarity=0.503  Sum_probs=8.8

Q ss_pred             eecccCCcceeeeee
Q psy3720          46 VSRRKGDGQTRLRGT   60 (190)
Q Consensus        46 ~~rrkg~gLT~tGGT   60 (190)
                      .+||+.+++....||
T Consensus        23 ~rRR~r~G~~P~~gt   37 (130)
T PF12273_consen   23 NRRRRRRGLQPIYGT   37 (130)
T ss_pred             HHHHhhcCCCCcCCc
Confidence            334433477777777


No 5  
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=59.62  E-value=7.4  Score=32.58  Aligned_cols=27  Identities=15%  Similarity=0.411  Sum_probs=20.9

Q ss_pred             eeeehhhhhHHHhheeeeeEEEeeccc
Q psy3720          24 AVVPIGATVIVVFVGLLVVCFAVSRRK   50 (190)
Q Consensus        24 ~vVPv~A~i~Viiv~ivViCv~~~rrk   50 (190)
                      +||=|+.+++.+|++++.+|..|++|+
T Consensus        54 vVVGVGg~ill~il~lvf~~c~r~kkt   80 (154)
T PF04478_consen   54 VVVGVGGPILLGILALVFIFCIRRKKT   80 (154)
T ss_pred             EEecccHHHHHHHHHhheeEEEecccC
Confidence            677788888888888887777777653


No 6  
>PF15102 TMEM154:  TMEM154 protein family
Probab=56.02  E-value=15  Score=30.52  Aligned_cols=22  Identities=14%  Similarity=0.357  Sum_probs=10.0

Q ss_pred             eeehhhHHHHHHHHHHhheeee
Q psy3720          85 AVVPIGATVIVVFVGLLVVCFA  106 (190)
Q Consensus        85 lvVPv~AtilViiv~ivViCv~  106 (190)
                      +++|.++.+++++++|++|...
T Consensus        61 IlIP~VLLvlLLl~vV~lv~~~   82 (146)
T PF15102_consen   61 ILIPLVLLVLLLLSVVCLVIYY   82 (146)
T ss_pred             EeHHHHHHHHHHHHHHHheeEE
Confidence            4567544444444444433333


No 7  
>PF15102 TMEM154:  TMEM154 protein family
Probab=54.60  E-value=12  Score=31.05  Aligned_cols=26  Identities=15%  Similarity=0.373  Sum_probs=13.8

Q ss_pred             eeeehhhhhHHHhheeeeeEEEeecc
Q psy3720          24 AVVPIGATVIVVFVGLLVVCFAVSRR   49 (190)
Q Consensus        24 ~vVPv~A~i~Viiv~ivViCv~~~rr   49 (190)
                      .++|.++.+++++++|++|-..|++|
T Consensus        61 IlIP~VLLvlLLl~vV~lv~~~kRkr   86 (146)
T PF15102_consen   61 ILIPLVLLVLLLLSVVCLVIYYKRKR   86 (146)
T ss_pred             EeHHHHHHHHHHHHHHHheeEEeecc
Confidence            45675555555555555555554433


No 8  
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=52.34  E-value=14  Score=31.00  Aligned_cols=28  Identities=14%  Similarity=0.401  Sum_probs=20.0

Q ss_pred             ceeehhhHHHHHHHHHHhheeeeeeccc
Q psy3720          84 NAVVPIGATVIVVFVGLLVVCFAVSRRK  111 (190)
Q Consensus        84 nlvVPv~AtilViiv~ivViCv~~~Rr~  111 (190)
                      =+||=|+.+|+.+|++++.+|..++|++
T Consensus        53 GvVVGVGg~ill~il~lvf~~c~r~kkt   80 (154)
T PF04478_consen   53 GVVVGVGGPILLGILALVFIFCIRRKKT   80 (154)
T ss_pred             EEEecccHHHHHHHHHhheeEEEecccC
Confidence            4677888888877777777676666553


No 9  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=49.80  E-value=4.8  Score=30.66  Aligned_cols=7  Identities=43%  Similarity=0.871  Sum_probs=2.6

Q ss_pred             eeeeecc
Q psy3720         104 CFAVSRR  110 (190)
Q Consensus       104 Cv~~~Rr  110 (190)
                      |+.++|+
T Consensus        21 ~~~rRR~   27 (130)
T PF12273_consen   21 CHNRRRR   27 (130)
T ss_pred             HHHHHHh
Confidence            3333333


No 10 
>PF06809 NPDC1:  Neural proliferation differentiation control-1 protein (NPDC1);  InterPro: IPR009635 This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins. NPDC1 plays a role in the control of neural cell proliferation and differentiation. It has been suggested that NPDC1 may be involved in the development of several secretion glands. This family also contains the C-terminal region of the Caenorhabditis elegans protein CAB-1 (Q93249 from SWISSPROT) which is known to interact with AEX-3 [].; GO: 0016021 integral to membrane
Probab=43.33  E-value=66  Score=30.17  Aligned_cols=68  Identities=24%  Similarity=0.111  Sum_probs=38.6

Q ss_pred             eecccCCcceeeeeeecCCCCCCCCC---------CCCCcccCcCccceeehhhHHHHHHHHHHh--heeeeeecccCC
Q psy3720          46 VSRRKGDGQTRLRGTIMPPFKTSDFS---------PYLPWVPGWIDWNAVVPIGATVIVVFVGLL--VVCFAVSRRKGD  113 (190)
Q Consensus        46 ~~rrkg~gLT~tGGTIaP~~~~~~~~---------~~~~~~~~~ld~nlvVPv~AtilViiv~iv--ViCv~~~Rr~g~  113 (190)
                      ++.+...++-.+.||-+|...++-.+         -.+....++=|-=++|-|++..++.++|++  .+|+.+.++...
T Consensus       151 ~~q~~~~~~p~~~~~~~P~p~ts~~s~~~s~pv~~spl~p~~~~~d~l~lv~Iv~~cvaG~aAliva~~cW~Rlqr~~r  229 (341)
T PF06809_consen  151 RGQRLEPGLPSTRGTPAPTPHTSTGSPVSSGPVHMSPLEPRGSHGDGLTLVLIVVCCVAGAAALIVAGYCWYRLQREIR  229 (341)
T ss_pred             cCcccCCCCCCCCCCCCCCCCCCCCCCCcCCCccccCCCCCCCCCCCeeeehhHHHHHHHHHHHHHhhheEEEeccccc
Confidence            55556778888999999987774221         122233333222255555555555555544  467777655443


No 11 
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=42.97  E-value=15  Score=26.47  Aligned_cols=17  Identities=29%  Similarity=0.409  Sum_probs=12.1

Q ss_pred             ceeehhhHHHHHHHHHH
Q psy3720          84 NAVVPIGATVIVVFVGL  100 (190)
Q Consensus        84 nlvVPv~AtilViiv~i  100 (190)
                      -+|+|+++++.++||.+
T Consensus        32 tVVlP~l~~~~~~Ivv~   48 (56)
T PF15012_consen   32 TVVLPTLAAVFLFIVVF   48 (56)
T ss_pred             eEehhHHHHHHHHHhhe
Confidence            47889988877666543


No 12 
>PHA03283 envelope glycoprotein E; Provisional
Probab=37.49  E-value=43  Score=32.99  Aligned_cols=39  Identities=21%  Similarity=0.329  Sum_probs=27.4

Q ss_pred             CCCCCcccCcCccceeehhhHHHHHHHHHHhheeeeeeccc
Q psy3720          71 SPYLPWVPGWIDWNAVVPIGATVIVVFVGLLVVCFAVSRRK  111 (190)
Q Consensus        71 ~~~~~~~~~~ld~nlvVPv~AtilViiv~ivViCv~~~Rr~  111 (190)
                      +....|-..||  -++.=++++..++++|++|-|.++-|+.
T Consensus       390 ~~~~~~~~~~l--~~~~~~~~~~~~~~~~l~vw~c~~~r~~  428 (542)
T PHA03283        390 NELGAWTRHYL--AFLLAIICTCAALLVALVVWGCILYRRS  428 (542)
T ss_pred             CCCCccccccc--hhHHHHHHHHHHHHHHHhhhheeeehhh
Confidence            34447788888  6667777777777888888777765543


No 13 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=34.30  E-value=98  Score=24.50  Aligned_cols=18  Identities=22%  Similarity=0.313  Sum_probs=8.4

Q ss_pred             ceeehhhHHHHHHHHHHh
Q psy3720          84 NAVVPIGATVIVVFVGLL  101 (190)
Q Consensus        84 nlvVPv~AtilViiv~iv  101 (190)
                      +++|=|+..|++|+++|+
T Consensus        79 ~iivgvi~~Vi~Iv~~Iv   96 (179)
T PF13908_consen   79 GIIVGVICGVIAIVVLIV   96 (179)
T ss_pred             eeeeehhhHHHHHHHhHh
Confidence            345555444444444443


No 14 
>PF07213 DAP10:  DAP10 membrane protein;  InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [].
Probab=33.72  E-value=40  Score=25.65  Aligned_cols=36  Identities=33%  Similarity=0.451  Sum_probs=20.0

Q ss_pred             eeehhhHH--HHHHHHHHhheeeeeecccCCCcccccCceeE
Q psy3720          85 AVVPIGAT--VIVVFVGLLVVCFAVSRRKGDGQTRLRDDIVY  124 (190)
Q Consensus        85 lvVPv~At--ilViiv~ivViCv~~~Rr~g~~~~~~~dDvVY  124 (190)
                      +++=++++  ++-++++.+|.+.++-|++..+    .||-||
T Consensus        35 ~LaGiV~~D~vlTLLIv~~vy~car~r~r~~~----~~~kvY   72 (79)
T PF07213_consen   35 LLAGIVAADAVLTLLIVLVVYYCARPRRRPTQ----EDDKVY   72 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccccCCcc----cCCEEE
Confidence            44444443  3334444556666666665544    778888


No 15 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=32.64  E-value=15  Score=34.25  Aligned_cols=22  Identities=27%  Similarity=0.430  Sum_probs=0.0

Q ss_pred             hhhcCccCCCCC-CCCCCCCCCC
Q psy3720         141 NEELGYIAPPNR-KLPPVPGSNY  162 (190)
Q Consensus       141 rDELGYIaPPNR-KLPPVPGSnY  162 (190)
                      .||-+|-....+ +-+.-.||-|
T Consensus       416 dee~~~~~~~~~~~~~~~~gSgf  438 (439)
T PF02480_consen  416 DEEFDSDQDEERSDPPEKSGSGF  438 (439)
T ss_dssp             -----------------------
T ss_pred             ccchhhcccccccCCCCCCCCCC
Confidence            455556554443 2344455544


No 16 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=30.12  E-value=23  Score=28.02  Aligned_cols=20  Identities=20%  Similarity=0.160  Sum_probs=10.8

Q ss_pred             ccceeeehhhhhHHHhheee
Q psy3720          21 DWNAVVPIGATVIVVFVGLL   40 (190)
Q Consensus        21 ~lN~vVPv~A~i~Viiv~iv   40 (190)
                      ..+++|=|+..|++|+++|+
T Consensus        77 ~~~iivgvi~~Vi~Iv~~Iv   96 (179)
T PF13908_consen   77 ITGIIVGVICGVIAIVVLIV   96 (179)
T ss_pred             eeeeeeehhhHHHHHHHhHh
Confidence            44566666555555544444


No 17 
>KOG4818|consensus
Probab=26.63  E-value=44  Score=31.39  Aligned_cols=31  Identities=23%  Similarity=0.561  Sum_probs=20.1

Q ss_pred             Cccceeeh-hhHHHHHHHHHHhheeeeeeccc
Q psy3720          81 IDWNAVVP-IGATVIVVFVGLLVVCFAVSRRK  111 (190)
Q Consensus        81 ld~nlvVP-v~AtilViiv~ivViCv~~~Rr~  111 (190)
                      +|.|.++| ++-+++...+++++|-++-+||+
T Consensus       323 ~d~siv~PivVg~~l~gl~~~vliaylIgrr~  354 (362)
T KOG4818|consen  323 VDLNIVLPIAVGAILAGLVLVVLIAYLIGRRR  354 (362)
T ss_pred             cccceecchHHHHHHHHHHHHHHHHhheehee
Confidence            37799999 55566666666666555555443


No 18 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=24.97  E-value=24  Score=32.87  Aligned_cols=24  Identities=33%  Similarity=0.523  Sum_probs=0.0

Q ss_pred             hhhHHHhheeeeeEEEeecccCCc
Q psy3720          30 ATVIVVFVGLLVVCFAVSRRKGDG   53 (190)
Q Consensus        30 A~i~Viiv~ivViCv~~~rrkg~g   53 (190)
                      +++++++++++.+|+.++|||...
T Consensus       362 avlivVv~viv~vc~~~rrrR~~~  385 (439)
T PF02480_consen  362 AVLIVVVGVIVWVCLRCRRRRRQR  385 (439)
T ss_dssp             ------------------------
T ss_pred             HHHHHHHHHHhheeeeehhccccc
Confidence            344444444555555555554433


No 19 
>KOG1094|consensus
Probab=24.46  E-value=56  Score=33.48  Aligned_cols=24  Identities=13%  Similarity=0.195  Sum_probs=18.3

Q ss_pred             ehhhHHHHHHHHHHhheeeeeecc
Q psy3720          87 VPIGATVIVVFVGLLVVCFAVSRR  110 (190)
Q Consensus        87 VPv~AtilViiv~ivViCv~~~Rr  110 (190)
                      .=+..+|..|.+.|+++|+.|.||
T Consensus       394 ~~~f~~if~iva~ii~~~L~R~rr  417 (807)
T KOG1094|consen  394 IIIFVAIFLIVALIIALMLWRWRR  417 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345667778888889999998666


No 20 
>PF09764 Nt_Gln_amidase:  N-terminal glutamine amidase;  InterPro: IPR019161 This entry represents the Protein N-terminal glutamine amidohydrolase (NtQ-amidase) family of proteins. They contain a region of approximately 200 residues carrying several distinctive motifs including a WDYHV motif and one of three cysteines. Protein N-terminal glutamine amidohydrolase is responsible for degradation of N-terminal glutamine [].; GO: 0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides; PDB: 3C9Q_A.
Probab=24.33  E-value=33  Score=29.09  Aligned_cols=16  Identities=44%  Similarity=0.908  Sum_probs=7.6

Q ss_pred             ccccchhh-cCccCCCC
Q psy3720         136 DKRHINEE-LGYIAPPN  151 (190)
Q Consensus       136 DKrrlrDE-LGYIaPPN  151 (190)
                      ||+|||++ =+||+||-
T Consensus       125 DRSHM~~~~G~w~~pPP  141 (184)
T PF09764_consen  125 DRSHMKDEDGNWIAPPP  141 (184)
T ss_dssp             --GGGB-SSS-BSS---
T ss_pred             cchhccCCCCCEeCCCC
Confidence            89999886 46999883


No 21 
>PRK13686 hypothetical protein; Provisional
Probab=24.15  E-value=18  Score=24.93  Aligned_cols=35  Identities=17%  Similarity=0.327  Sum_probs=27.6

Q ss_pred             ccCcCccceeehhhHHHHHHHHHHhheeeeeecccC
Q psy3720          77 VPGWIDWNAVVPIGATVIVVFVGLLVVCFAVSRRKG  112 (190)
Q Consensus        77 ~~~~ld~nlvVPv~AtilViiv~ivViCv~~~Rr~g  112 (190)
                      +.++++|+++.=..+..++++.|=+||.++-.| +|
T Consensus         7 ~~~~iN~Evi~QL~~l~lIv~aGP~VI~lLa~R-~G   41 (43)
T PRK13686          7 FLANINLEVIFQLTFVALIVIAGPVVIFLLAFR-GG   41 (43)
T ss_pred             HHHhccHHHHHHHHHHHHHHHcCCHheehhhhh-cC
Confidence            357888899999999899999998888776554 44


No 22 
>PF15298 AJAP1_PANP_C:  AJAP1/PANP C-terminus
Probab=23.44  E-value=34  Score=30.03  Aligned_cols=26  Identities=15%  Similarity=0.332  Sum_probs=21.5

Q ss_pred             CcCccceeehhhHHHHHHHHHHhhee
Q psy3720          79 GWIDWNAVVPIGATVIVVFVGLLVVC  104 (190)
Q Consensus        79 ~~ld~nlvVPv~AtilViiv~ivViC  104 (190)
                      +-||+-++|=|-.+++++|+|++.-.
T Consensus        94 ~Glavh~~iTITvSlImViaAliTtl  119 (205)
T PF15298_consen   94 SGLAVHQIITITVSLIMVIAALITTL  119 (205)
T ss_pred             CCCCceEEEEEeeehhHHHHHhhhhh
Confidence            47999999999999999999955443


No 23 
>PF07760 DUF1616:  Protein of unknown function (DUF1616);  InterPro: IPR011674 This is a group of sequences from hypothetical archaeal proteins. The region in question is approximately 330 amino acid residues long.
Probab=23.20  E-value=42  Score=28.80  Aligned_cols=25  Identities=20%  Similarity=0.433  Sum_probs=18.7

Q ss_pred             eeehhhhhHHHhheeeeeEEEeecc
Q psy3720          25 VVPIGATVIVVFVGLLVVCFAVSRR   49 (190)
Q Consensus        25 vVPv~A~i~Viiv~ivViCv~~~rr   49 (190)
                      ..|+..++.++.+..++++..|++|
T Consensus        86 ~~~i~~~l~~~t~~~~~~a~~rr~~  110 (287)
T PF07760_consen   86 LIPILISLSIFTLVLSIIAYIRRRR  110 (287)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHhccc
Confidence            3577777777777777888888766


No 24 
>PHA02902 putative IMV membrane protein; Provisional
Probab=22.78  E-value=45  Score=25.13  Aligned_cols=18  Identities=28%  Similarity=0.316  Sum_probs=12.7

Q ss_pred             hhHHHHHHHHHHhheeee
Q psy3720          89 IGATVIVVFVGLLVVCFA  106 (190)
Q Consensus        89 v~AtilViiv~ivViCv~  106 (190)
                      ++.++.|+|+..+++...
T Consensus         7 vi~~v~v~Ivclliya~Y   24 (70)
T PHA02902          7 VILAVIVIIFCLLIYAAY   24 (70)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456677888887777665


No 25 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=22.27  E-value=91  Score=26.90  Aligned_cols=33  Identities=15%  Similarity=0.140  Sum_probs=20.4

Q ss_pred             HHHHHHHhheeeeeecc-cCCCcccccCceeEee
Q psy3720          94 IVVFVGLLVVCFAVSRR-KGDGQTRLRDDIVYNQ  126 (190)
Q Consensus        94 lViiv~ivViCv~~~Rr-~g~~~~~~~dDvVYnq  126 (190)
                      ++++++++.+++...|| ....+.++..|.-|--
T Consensus       112 lLla~~~~~~Y~~~~Rrs~~~~~~rl~Ee~~~vE  145 (202)
T PF06365_consen  112 LLLAILLGAGYCCHQRRSWSKKGQRLGEELYTVE  145 (202)
T ss_pred             HHHHHHHHHHHHhhhhccCCcchhhhccCceecc
Confidence            66666666655555555 4556667777776633


No 26 
>PF07004 SHIPPO-rpt:  Sperm-tail PG-rich repeat;  InterPro: IPR010736 This represents a short conserved region (approximately 30 residues long) that is repeated in several eukaryotic proteins of unknown function. One member of this family is annotated as possibly being related to alpha collagen.
Probab=20.97  E-value=45  Score=18.42  Aligned_cols=8  Identities=75%  Similarity=1.348  Sum_probs=5.2

Q ss_pred             CCCCCCCcc
Q psy3720         156 PVPGSNYNT  164 (190)
Q Consensus       156 PVPGSnYNT  164 (190)
                      |-||+ ||.
T Consensus         2 PGPG~-Y~~    9 (37)
T PF07004_consen    2 PGPGS-YNP    9 (37)
T ss_pred             CCCCc-ccc
Confidence            66776 763


No 27 
>PF11406 Tachystatin_A:  Antimicrobial peptide tachystatin A;  InterPro: IPR022717  Tachystatin A contains a cysteine-stabilised triple-stranded beta-sheet and shows features common to membrane-interactive peptides. Tachystatin A is thought to have an antimicrobial activity similar to defensins.Tachystatin A is also a chitin-binding peptide []. ; PDB: 1CIX_A.
Probab=20.86  E-value=33  Score=23.65  Aligned_cols=11  Identities=55%  Similarity=1.274  Sum_probs=6.9

Q ss_pred             CCCCCCcchhh
Q psy3720         157 VPGSNYNTCDR  167 (190)
Q Consensus       157 VPGSnYNTCDR  167 (190)
                      .|||.|..|.|
T Consensus        33 fpgstygrcqr   43 (44)
T PF11406_consen   33 FPGSTYGRCQR   43 (44)
T ss_dssp             STT-S-EEEE-
T ss_pred             cCCcccceeec
Confidence            58999999987


No 28 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=20.49  E-value=71  Score=21.54  Aligned_cols=12  Identities=50%  Similarity=0.960  Sum_probs=7.0

Q ss_pred             ceeehhhHHHHH
Q psy3720          84 NAVVPIGATVIV   95 (190)
Q Consensus        84 nlvVPv~AtilV   95 (190)
                      -+++|+++-+++
T Consensus        16 ~VvVPV~vI~~v   27 (40)
T PF08693_consen   16 GVVVPVGVIIIV   27 (40)
T ss_pred             EEEechHHHHHH
Confidence            467887654433


Done!