BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3792
         (224 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2E55|A Chain A, Structure Of Aq2163 Protein From Aquifex Aeolicus
 pdb|2E55|B Chain B, Structure Of Aq2163 Protein From Aquifex Aeolicus
 pdb|2E55|C Chain C, Structure Of Aq2163 Protein From Aquifex Aeolicus
 pdb|2E55|D Chain D, Structure Of Aq2163 Protein From Aquifex Aeolicus
          Length = 208

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 47  AVRVAPKKKVIRNPQPKLNAQRLTGPRGIQCIEQYFKDVK-FKGKGHE-LADLNTIMSNL 104
            + VA ++ +  +P    +   +  P G++ IE+ FK+V+ F G   E L D   I+  L
Sbjct: 136 TLEVALREILKHSPLKVKSVHAIAAPEGLKRIEEKFKEVEIFVGNVDERLNDKGYIIPGL 195

Query: 105 EHWANRLYPKSNF 117
               +RLY  S +
Sbjct: 196 GDIGDRLYAVSVY 208


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.133    0.379 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,037,378
Number of Sequences: 62578
Number of extensions: 214614
Number of successful extensions: 473
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 473
Number of HSP's gapped (non-prelim): 5
length of query: 224
length of database: 14,973,337
effective HSP length: 95
effective length of query: 129
effective length of database: 9,028,427
effective search space: 1164667083
effective search space used: 1164667083
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)