Diaphorina citri psyllid: psy3809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MYSYSGADISIVVRDALMQPVRLVQSATHFVRTSGPSPVDPSKTVDDLLTPCSPSTPGAVEMNFMDVPSDKLLEPPVSMHHILKSLETSKPTVNDDDMVKLRKFMEDFGQEG
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccc
*YSYSGADISIVVRDALMQPVRLVQSATHFVRTSG******SKTVDDLLTPCSPS****************LLEPPVSMHHILKSLETSKPTVN*DDMVKLRKFMEDFGQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSYSGADISIVVRDALMQPVRLVQSATHFVRTSGPSPVDPSKTVDDLLTPCSPSTPGAVEMNFMDVPSDKLLEPPVSMHHILKSLETSKPTVNDDDMVKLRKFMEDFGQEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 4B Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis.confidentP46467
Vacuolar protein sorting-associated protein 4B Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (lentiviruses). Involved in cytokinesis.confidentQ0VD48
Vacuolar protein sorting-associated protein 4B Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses).confidentO75351

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044130 [BP]negative regulation of growth of symbiont in hostprobableGO:0045926, GO:0040008, GO:0050789, GO:0008150, GO:0043903, GO:0043900, GO:0043901, GO:0065007, GO:0048519, GO:0044126, GO:0044146, GO:0044144
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0032367 [BP]intracellular cholesterol transportprobableGO:0033036, GO:0006810, GO:0015918, GO:0046907, GO:0015850, GO:0032366, GO:0032365, GO:0030301, GO:0006869, GO:0044765, GO:0044763, GO:0044699, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0010876, GO:0051179, GO:0051649, GO:0051641
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007032 [BP]endosome organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0000815 [CC]ESCRT III complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005737, GO:0044446, GO:0044444, GO:0044440, GO:0043231, GO:0044424, GO:0044425, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0045197 [BP]establishment or maintenance of epithelial cell apical/basal polarityprobableGO:0035088, GO:0061245, GO:0009987, GO:0007163, GO:0044763, GO:0008150, GO:0044699
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032510 [BP]endosome to lysosome transport via multivesicular body sorting pathwayprobableGO:0016197, GO:0006810, GO:0016192, GO:0046907, GO:0032509, GO:0051179, GO:0044765, GO:0008150, GO:0051641, GO:0051649, GO:0044763, GO:0009987, GO:0051234, GO:0045022, GO:0044699, GO:0016482
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XWI, chain A
Confidence level:very confident
Coverage over the Query: 1-112
View the alignment between query and template
View the model in PyMOL