Diaphorina citri psyllid: psy3828

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----

MVIRGELFCKRNDSSITQSRSFSIPGAVPIPQIYTMSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGASFSESLSSLTTAAGKSSGKAVKKAGKAQKNIAKSDKKKKHRRKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

ccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHccccccccccHHHHHccHHHHHHHHcccEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHEHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHcccccccccccccc

*******FCKR****I****SFSI*********************************LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFE*****************VGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTD*****SLDVVTEYFPVPLG**********************************************YAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV*K*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone H2A type 1-H	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q96KK5
Histone H2A.J	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q3ZBX9
Late histone H2A.L3	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	P16886

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0001741 [CC]	XY body	confident	GO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000003 [BP]	reproduction	confident	GO:0008150
GO:0006281 [BP]	DNA repair	confident	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0050830 [BP]	defense response to Gram-positive bacterium	confident	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0000794 [CC]	condensed nuclear chromosome	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0000781 [CC]	chromosome, telomeric region	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0050829 [BP]	defense response to Gram-negative bacterium	confident	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0005657 [CC]	replication fork	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0060465 [BP]	pharynx development	confident	GO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0002119 [BP]	nematode larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0001673 [CC]	male germ cell nucleus	confident	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0005811 [CC]	lipid particle	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019897 [CC]	extrinsic to plasma membrane	confident	GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0019899 [MF]	enzyme binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0009792 [BP]	embryo development ending in birth or egg hatching	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040011 [BP]	locomotion	confident	GO:0008150
GO:0000077 [BP]	DNA damage checkpoint	confident	GO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0071229 [BP]	cellular response to acid	confident	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0001101, GO:0070887, GO:0042221, GO:0044699
GO:0003684 [MF]	damaged DNA binding	confident	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0040007 [BP]	growth	confident	GO:0008150
GO:0006915 [BP]	apoptotic process	confident	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0040010 [BP]	positive regulation of growth rate	confident	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005576 [CC]	extracellular region	confident	GO:0005575
GO:0000790 [CC]	nuclear chromatin	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0035267 [CC]	NuA4 histone acetyltransferase complex	probable	GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0043189, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0051298 [BP]	centrosome duplication	probable	GO:0006996, GO:0031023, GO:0007010, GO:0051297, GO:0009987, GO:0007098, GO:0016043, GO:0008150, GO:0000226, GO:0007017, GO:0044763, GO:0044699, GO:0071840, GO:0022402, GO:0007049
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018991 [BP]	oviposition	probable	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0006334 [BP]	nucleosome assembly	probable	GO:0034728, GO:0071103, GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0031497, GO:0034622, GO:0044699, GO:0071824, GO:0006139, GO:0044260, GO:0006325, GO:1901360, GO:0006323, GO:0065003, GO:0071704, GO:0071840, GO:0065004, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0006333, GO:0044237, GO:0043170, GO:0044085, GO:0006259, GO:0008150
GO:0071674 [BP]	mononuclear cell migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0050900, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0006954 [BP]	inflammatory response	probable	GO:0006952, GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0000724 [BP]	double-strand break repair via homologous recombination	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0006997 [BP]	nucleus organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0051099 [BP]	positive regulation of binding	probable	GO:0008150, GO:0065009, GO:0051098, GO:0065007, GO:0044093
GO:0042393 [MF]	histone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0000786 [CC]	nucleosome	probable	GO:0005575, GO:0032991, GO:0043232, GO:0032993, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0031639 [BP]	plasminogen activation	probable	GO:0044238, GO:0051604, GO:0019538, GO:0031638, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152, GO:0016485
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0045739 [BP]	positive regulation of DNA repair	probable	GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0006282, GO:0051052, GO:0060255, GO:0048583, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:2001020, GO:2001022, GO:0080134, GO:0080135, GO:0048522
GO:0010212 [BP]	response to ionizing radiation	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NQB, chain C
Confidence level:very confident
Coverage over the Query: 51-151
View the alignment between query and template
View the model in PyMOL

Template: 2NQB, chain D
Confidence level:very confident
Coverage over the Query: 275-365
View the alignment between query and template
View the model in PyMOL

Template: 2JSS, chain A
Confidence level:very confident
Coverage over the Query: 12-146
View the alignment between query and template
View the model in PyMOL

Template: 2L5A, chain A
Confidence level:confident
Coverage over the Query: 59-159,177-233,274-341
View the alignment between query and template
View the model in PyMOL