Query         psy3838
Match_columns 74
No_of_seqs    33 out of 35
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:42:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3838.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3838hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12129 Phtf-FEM1B_bdg:  Male  100.0 5.7E-43 1.2E-47  250.2   4.5   67    8-74      1-67  (159)
  2 PF06799 DUF1230:  Protein of u  76.3    0.52 1.1E-05   33.7  -1.1   16   21-36    104-119 (144)
  3 PF14703 DUF4463:  Domain of un  57.6     7.6 0.00017   23.1   1.5   15    9-23     69-83  (85)
  4 PF01756 ACOX:  Acyl-CoA oxidas  34.7      28 0.00062   23.8   1.7   24   20-43    146-169 (187)
  5 smart00052 EAL Putative diguan  31.9      23 0.00049   23.4   0.8   19   55-73    222-240 (241)
  6 PHA02503 putative transcriptio  28.3      53  0.0012   20.6   2.0   23   11-33     16-38  (57)
  7 COG3083 Predicted hydrolase of  27.3      72  0.0016   27.8   3.2   54   17-71    217-281 (600)
  8 cd01948 EAL EAL domain. This d  25.6      35 0.00076   22.5   0.9   19   55-73    221-239 (240)
  9 cd01239 PH_PKD Protein kinase   25.5      41 0.00088   23.5   1.2   17   20-36    101-117 (117)
 10 PF12292 DUF3624:  Protein of u  24.7      36 0.00077   22.3   0.7   20   13-32      7-26  (77)
 11 cd08355 Glo_EDI_BRP_like_14 Th  23.0      38 0.00083   20.2   0.6   15    9-23      9-23  (122)
 12 PF02052 Gallidermin:  Gallider  22.7      28 0.00061   21.3   0.0   19   47-65      2-20  (52)

No 1  
>PF12129 Phtf-FEM1B_bdg:  Male germ-cell putative homeodomain transcription factor;  InterPro: IPR021980  This domain is found in bacteria and eukaryotes, and is typically between 101 and 140 amino acids in length. Phtf proteins do not display any sequence similarity to known or predicted proteins, but their conservation among species suggests an essential function. The 84 kDa Phtf1 protein is an integral membrane protein, anchored to a cell membrane by six to eight trans-membrane domains, that is associated with a domain of the endoplasmic reticulum (ER) juxtaposed to the Golgi apparatus. It is present during meiosis and spermiogenesis, and, by the end of spermiogenesis, is released from the mature spermatozoon within the residual bodies []. Phtf1 enhances the binding of FEM1B -feminisation homologue 1B - to cell membranes. Fem-1 was initially identified in the signaling pathway for sex determination, as well as being implicated in apoptosis, but its biochemical role is still unclear, and neither FEM1B nor PHTF1 is directly implicated in apoptosis in spermatogenesis. It is the ANK domain of FEM1B that is necessary for the interaction with the N-terminal region of Phtf1 []. 
Probab=100.00  E-value=5.7e-43  Score=250.17  Aligned_cols=67  Identities=51%  Similarity=0.671  Sum_probs=64.6

Q ss_pred             cccchhhhhhHHhhhchhHHHHHHHhhhhhccCCccccceecccCCceEEEeeeeeceecccCccCC
Q psy3838           8 MCSVTSVIGYQKKIGAYDKQQWETTVEQRILNGFTHVPKKTAKLKTELIDVDLVRVVFINDFKSIEH   74 (74)
Q Consensus         8 ~~~~~~i~wyqkKig~YD~q~WEKsvEq~~l~gl~~kpkk~~~iKpdLIDvDLVrGstF~KaKp~~~   74 (74)
                      |+.+|+|+|||+|||+||+|+|||||||++++||+|+|||++++|||||||||||||||+||||+.+
T Consensus         1 ~~~~d~i~wyQkKig~YD~q~WEksveq~~l~gl~~~~kk~~~lk~dLIDvDLVRGStF~KAKP~~~   67 (159)
T PF12129_consen    1 SKVDDAIAWYQKKIGAYDQQIWEKSVEQRELKGLTNKPKKTGHLKPDLIDVDLVRGSTFPKAKPESP   67 (159)
T ss_pred             CcHHHHHHHHHHHHhhhHHHHHHHHHHHHHhcccccCCcccCCCChhheeeeeeeeecccccCCcch
Confidence            4678999999999999999999999999999999999999999999999999999999999999864


No 2  
>PF06799 DUF1230:  Protein of unknown function (DUF1230);  InterPro: IPR009631 This family represents Ycf36, which is found in plants, encoded in the genomes of algal chloroplasts and in cyanobacteria. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=76.30  E-value=0.52  Score=33.72  Aligned_cols=16  Identities=38%  Similarity=0.509  Sum_probs=13.6

Q ss_pred             hhchhHHHHHHHhhhh
Q psy3838          21 IGAYDKQQWETTVEQR   36 (74)
Q Consensus        21 ig~YD~q~WEKsvEq~   36 (74)
                      =|=||+|+|+|+.|-.
T Consensus       104 SGWYDGQ~W~Kp~e~l  119 (144)
T PF06799_consen  104 SGWYDGQVWVKPPEVL  119 (144)
T ss_pred             cCccCCccccCCHHHH
Confidence            4889999999998853


No 3  
>PF14703 DUF4463:  Domain of unknown function (DUF4463)
Probab=57.62  E-value=7.6  Score=23.14  Aligned_cols=15  Identities=13%  Similarity=0.235  Sum_probs=12.8

Q ss_pred             ccchhhhhhHHhhhc
Q psy3838           9 CSVTSVIGYQKKIGA   23 (74)
Q Consensus         9 ~~~~~i~wyqkKig~   23 (74)
                      ...|||.||+++|..
T Consensus        69 ~kVDaIdyy~~el~~   83 (85)
T PF14703_consen   69 KKVDAIDYYREELKE   83 (85)
T ss_pred             CcchHHHHHHHHHHH
Confidence            568999999999864


No 4  
>PF01756 ACOX:  Acyl-CoA oxidase;  InterPro: IPR002655 Acyl-CoA oxidase (ACO) acts on CoA derivatives of fatty acids with chain lengths from 8 to 18. It catalyses the first and rate-determining step of the peroxisomal beta-oxidation of fatty acids []. Acyl-CoA oxidase is a homodimer and the polypeptide chain of the subunit is folded into the N-terminal alpha-domain, beta-domain, and C-terminal alpha-domain []. Functional differences between the peroxisomal acyl-CoA oxidases and the mitochondrial acyl-CoA dehydrogenases are attributed to structural differences in the FAD environments [].  Experimental data indicate that, in the pumpkin, the expression pattern of ACOX is very similar to that of the glyoxysomal enzyme 3-ketoacyl-CoA thiolase []. In humans, defects in ACOX1 are the cause of pseudoneonatal adrenoleukodystrophy, also known as peroxisomal acyl-CoA oxidase deficiency. Pseudo-NALD is a peroxisomal single-enzyme disorder. Clinical features include mental retardation, leukodystrophy, seizures, mild hepatomegaly and hearing deficit. Pseudo-NALD is characterised by increased plasma levels of very-long chain fatty acids due to a decrease in, or absence of, peroxisome acyl-CoA oxidase activity, despite the peroxisomes being intact and functioning. This entry represents the Acyl-CoA oxidase C-terminal.; GO: 0003997 acyl-CoA oxidase activity, 0006635 fatty acid beta-oxidation, 0055114 oxidation-reduction process, 0005777 peroxisome; PDB: 2FON_A 1IS2_B 2DDH_A 1W07_B.
Probab=34.73  E-value=28  Score=23.80  Aligned_cols=24  Identities=25%  Similarity=0.368  Sum_probs=16.3

Q ss_pred             hhhchhHHHHHHHhhhhhccCCcc
Q psy3838          20 KIGAYDKQQWETTVEQRILNGFTH   43 (74)
Q Consensus        20 Kig~YD~q~WEKsvEq~~l~gl~~   43 (74)
                      -||.||+.+-|.-.+......+.+
T Consensus       146 ~iG~~DG~vYe~l~~~a~~~~~n~  169 (187)
T PF01756_consen  146 PIGRYDGDVYEALFEWAKKSPLNQ  169 (187)
T ss_dssp             STT-TT--HHHHHHHHHHHSGGGC
T ss_pred             hhccccchHHHHHHHHHHHCCCCC
Confidence            499999999999988866655554


No 5  
>smart00052 EAL Putative diguanylate phosphodiesterase. Putative diguanylate phosphodiesterase, present in a variety of bacteria.
Probab=31.86  E-value=23  Score=23.44  Aligned_cols=19  Identities=5%  Similarity=0.053  Sum_probs=16.3

Q ss_pred             eEEEeeeeeceecccCccC
Q psy3838          55 LIDVDLVRVVFINDFKSIE   73 (74)
Q Consensus        55 LIDvDLVrGstF~KaKp~~   73 (74)
                      -+.+|+++|.-|++..|.+
T Consensus       222 ~~Gi~~~QG~~~~~p~~~~  240 (241)
T smart00052      222 SLGCDYGQGYLFSRPLPLD  240 (241)
T ss_pred             HcCCCEEeeceeccCCCCC
Confidence            4678999999999998875


No 6  
>PHA02503 putative transcription regulator; Provisional
Probab=28.33  E-value=53  Score=20.57  Aligned_cols=23  Identities=26%  Similarity=0.403  Sum_probs=18.1

Q ss_pred             chhhhhhHHhhhchhHHHHHHHh
Q psy3838          11 VTSVIGYQKKIGAYDKQQWETTV   33 (74)
Q Consensus        11 ~~~i~wyqkKig~YD~q~WEKsv   33 (74)
                      ..++.||.+|+-.|+.|--..|+
T Consensus        16 q~sve~yke~l~~~s~~fl~~sl   38 (57)
T PHA02503         16 QESVEFYKEKLSVYSKDFLQNSL   38 (57)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Confidence            35789999999999988655543


No 7  
>COG3083 Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only]
Probab=27.34  E-value=72  Score=27.78  Aligned_cols=54  Identities=19%  Similarity=0.290  Sum_probs=40.7

Q ss_pred             hHHhhhchhHHHHHHHhhhhh---ccCCccccceecccCCc-------eEEEeeeeecee-cccCc
Q psy3838          17 YQKKIGAYDKQQWETTVEQRI---LNGFTHVPKKTAKLKTE-------LIDVDLVRVVFI-NDFKS   71 (74)
Q Consensus        17 yqkKig~YD~q~WEKsvEq~~---l~gl~~kpkk~~~iKpd-------LIDvDLVrGstF-~KaKp   71 (74)
                      |-+|.|.-|+|.-.+-++|..   ..++ +=|++.-++.|-       ||-||-+|++++ .+--|
T Consensus       217 FlekhGllD~qey~r~l~eqg~pda~~l-~YPl~pL~~~~~a~~~NillI~vdglR~d~l~~~~MP  281 (600)
T COG3083         217 FLEKHGLLDAQEYRRRLVEQGNPDASSL-NYPLRPLTISDPAHGPNILLITVDGLRYDALDEKQMP  281 (600)
T ss_pred             HHHHcCCCchHHHHHHHHHcCCCCcccc-cCCCCCceecCCCCCCCEEEEEeccccccccChhhCh
Confidence            568999999999998888763   2344 577777776644       999999999998 44333


No 8  
>cd01948 EAL EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2).  The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.
Probab=25.57  E-value=35  Score=22.50  Aligned_cols=19  Identities=16%  Similarity=0.111  Sum_probs=16.1

Q ss_pred             eEEEeeeeeceecccCccC
Q psy3838          55 LIDVDLVRVVFINDFKSIE   73 (74)
Q Consensus        55 LIDvDLVrGstF~KaKp~~   73 (74)
                      -+.+|+++|..|++..|.+
T Consensus       221 ~~gi~~~QG~~~~~p~~~~  239 (240)
T cd01948         221 ELGCDYVQGYLFSRPLPAE  239 (240)
T ss_pred             HcCCCeeeeceeccCCCCC
Confidence            5788999999999887765


No 9  
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain. Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain. PKD consists of 2 C1 domains, followed by a PH domain and a kinase domain. While the PKD PH domain has not been shown to bind phosphorylated inositol lipids and is not required for membrane translocation, it is required for nuclear export. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=25.53  E-value=41  Score=23.54  Aligned_cols=17  Identities=35%  Similarity=0.640  Sum_probs=14.8

Q ss_pred             hhhchhHHHHHHHhhhh
Q psy3838          20 KIGAYDKQQWETTVEQR   36 (74)
Q Consensus        20 Kig~YD~q~WEKsvEq~   36 (74)
                      -+|+...+.||++|.|.
T Consensus       101 g~g~~~a~~We~aI~qA  117 (117)
T cd01239         101 GRGSDNAQSWETAIRQA  117 (117)
T ss_pred             cchhHHHHHHHHHHhcC
Confidence            48999999999999873


No 10 
>PF12292 DUF3624:  Protein of unknown function (DUF3624);  InterPro: IPR022072  This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length. There is a conserved GRC sequence motif. 
Probab=24.70  E-value=36  Score=22.34  Aligned_cols=20  Identities=25%  Similarity=0.441  Sum_probs=14.7

Q ss_pred             hhhhhHHhhhchhHHHHHHH
Q psy3838          13 SVIGYQKKIGAYDKQQWETT   32 (74)
Q Consensus        13 ~i~wyqkKig~YD~q~WEKs   32 (74)
                      .-+||.+|||+=-.=.|.=+
T Consensus         7 ~~~~F~~KiGRC~rCM~QLt   26 (77)
T PF12292_consen    7 QESWFWQKIGRCQRCMWQLT   26 (77)
T ss_pred             HHHHHHHHhccHHHHHHHHH
Confidence            45799999999766655543


No 11 
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=22.97  E-value=38  Score=20.19  Aligned_cols=15  Identities=7%  Similarity=0.011  Sum_probs=12.6

Q ss_pred             ccchhhhhhHHhhhc
Q psy3838           9 CSVTSVIGYQKKIGA   23 (74)
Q Consensus         9 ~~~~~i~wyqkKig~   23 (74)
                      ....++.||++.+|.
T Consensus         9 d~~~a~~FY~~~lG~   23 (122)
T cd08355           9 DAAAAIDWLTDAFGF   23 (122)
T ss_pred             CHHHHHHHHHHhcCC
Confidence            457899999999984


No 12 
>PF02052 Gallidermin:  Gallidermin;  InterPro: IPR006079 Lantibiotics are heavily-modified bacteriocin-like peptides from Gram- positive bacteria. They contain alpha,beta-unsaturated amino acids (dehydroalanine and dehydrobutyrine) and lanthionine or 3-methyllanthionine rings (collectively known as thioether rings). There are 2 types of lantibiotic:  Type A (which include nisin, subtilin, epidermin, gallidermin and Pep5) are strongly cationic and bactericidal - nisin, subtilin and Pep5 inhibit the growth of Gram-positive bacteria, probably by voltage-dependent pore formation in the cytoplasmic membrane, resulting in cellular efflux of electrolytes, amino acids and ATP;  Type B lantibiotics possess at most one positive charge and are not bactericidal.   This family contains both type A and type B molecules. ; GO: 0050830 defense response to Gram-positive bacterium; PDB: 1WCO_N.
Probab=22.70  E-value=28  Score=21.27  Aligned_cols=19  Identities=21%  Similarity=0.422  Sum_probs=0.0

Q ss_pred             eecccCCceEEEeeeeece
Q psy3838          47 KTAKLKTELIDVDLVRVVF   65 (74)
Q Consensus        47 k~~~iKpdLIDvDLVrGst   65 (74)
                      ++..++.||.|+||+-.+.
T Consensus         2 ~~~~~~edlFdlDv~~~~~   20 (52)
T PF02052_consen    2 ETFDVQEDLFDLDVTVTAV   20 (52)
T ss_dssp             -------------------
T ss_pred             ccccccccceeeeeEEeEE
Confidence            4567888999999986653


Done!