Query         psy3842
Match_columns 139
No_of_seqs    173 out of 1603
Neff          7.9 
Searched_HMMs 46136
Date          Fri Aug 16 18:49:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3842.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3842hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1034 NuoG NADH dehydrogenas 100.0 7.4E-32 1.6E-36  229.1  10.2  134    1-134    67-265 (693)
  2 PRK09130 NADH dehydrogenase su 100.0 7.4E-31 1.6E-35  225.0   9.3  119    1-119    68-236 (687)
  3 TIGR01973 NuoG NADH-quinone ox 100.0 9.6E-30 2.1E-34  215.6   9.4  119    1-119    65-233 (603)
  4 PRK07860 NADH dehydrogenase su 100.0 2.4E-29 5.1E-34  218.7   9.5  119    1-119    70-241 (797)
  5 PRK09129 NADH dehydrogenase su 100.0 2.5E-29 5.4E-34  218.1   9.6  119    1-119    67-235 (776)
  6 PRK08166 NADH dehydrogenase su 100.0 1.5E-28 3.2E-33  215.0   9.1  119    1-119    72-241 (847)
  7 PRK08493 NADH dehydrogenase su 100.0   2E-28 4.3E-33  212.2   8.3  119    1-119    65-255 (819)
  8 PTZ00305 NADH:ubiquinone oxido  99.9 3.9E-25 8.4E-30  171.1   9.3   58    1-58    135-192 (297)
  9 COG3383 Uncharacterized anaero  99.9 6.1E-25 1.3E-29  185.6   7.2  122    1-122    69-284 (978)
 10 KOG2282|consensus               99.9 9.7E-25 2.1E-29  178.1   5.2  133    1-133    98-295 (708)
 11 PRK07569 bidirectional hydroge  99.8 3.2E-21   7E-26  146.9   7.3   58    1-58     69-126 (234)
 12 PF10588 NADH-G_4Fe-4S_3:  NADH  99.7 3.8E-18 8.2E-23   96.6   2.9   41   17-57      1-41  (41)
 13 PF10588 NADH-G_4Fe-4S_3:  NADH  99.1 2.1E-11 4.6E-16   68.9   0.1   40   92-131     2-41  (41)
 14 COG1034 NuoG NADH dehydrogenas  99.0 2.8E-11 6.1E-16  103.9  -0.1   89   39-134    32-126 (693)
 15 PTZ00305 NADH:ubiquinone oxido  99.0 6.1E-11 1.3E-15   92.4   0.5   89   39-134   100-194 (297)
 16 PRK09130 NADH dehydrogenase su  98.9 4.9E-10 1.1E-14   96.9   0.8   88   40-134    33-127 (687)
 17 TIGR01973 NuoG NADH-quinone ox  98.7 5.2E-09 1.1E-13   89.3   2.6  103   19-134    15-124 (603)
 18 PRK09129 NADH dehydrogenase su  98.7 7.1E-09 1.5E-13   90.8   2.2  103   19-134    18-126 (776)
 19 PRK08764 ferredoxin; Provision  98.6 6.9E-08 1.5E-12   67.9   5.6   71   22-94     32-104 (135)
 20 PRK07860 NADH dehydrogenase su  98.6 8.8E-09 1.9E-13   90.5   0.5   87   40-133    36-130 (797)
 21 KOG2282|consensus               98.5 2.6E-08 5.6E-13   82.7   1.0   58   72-133    99-156 (708)
 22 PRK07569 bidirectional hydroge  98.5 6.2E-08 1.3E-12   73.9   2.5  102   19-133    20-127 (234)
 23 PRK08493 NADH dehydrogenase su  98.5 6.2E-08 1.3E-12   85.2   2.1  102   19-133    18-123 (819)
 24 PRK08166 NADH dehydrogenase su  98.4 1.6E-07 3.4E-12   83.1   2.4   89   40-133    33-130 (847)
 25 COG3383 Uncharacterized anaero  98.3 2.9E-07 6.3E-12   79.5   1.5  101   18-134    21-129 (978)
 26 PRK12814 putative NADPH-depend  98.0 6.8E-06 1.5E-10   71.0   5.1   33    1-33     69-101 (652)
 27 PRK05113 electron transport co  97.9 8.1E-06 1.8E-10   60.6   2.7   27   31-57     69-95  (191)
 28 PRK12814 putative NADPH-depend  97.8 1.1E-05 2.5E-10   69.6   3.1   53   31-84    568-625 (652)
 29 TIGR01944 rnfB electron transp  97.7 3.4E-05 7.4E-10   55.9   3.5   66   27-94     64-132 (165)
 30 PRK06991 ferredoxin; Provision  97.5  0.0001 2.2E-09   57.5   3.6   68   25-94     35-104 (270)
 31 PF12798 Fer4_3:  4Fe-4S bindin  97.4 2.3E-05   5E-10   34.7  -0.4   15   77-91      1-15  (15)
 32 PF00037 Fer4:  4Fe-4S binding   96.7 0.00031 6.7E-09   34.8  -0.5   18   76-93      7-24  (24)
 33 PF12837 Fer4_6:  4Fe-4S bindin  96.6 0.00036 7.8E-09   34.7  -0.6   18   75-92      7-24  (24)
 34 COG1143 NuoI Formate hydrogenl  96.3   0.001 2.2E-08   48.7   0.2   22   73-94     93-114 (172)
 35 PF13187 Fer4_9:  4Fe-4S diclus  96.3 0.00081 1.8E-08   39.4  -0.4   20   73-92     36-55  (55)
 36 PF13746 Fer4_18:  4Fe-4S diclu  95.4  0.0048 1.1E-07   38.3   0.4   20   72-91     47-66  (69)
 37 PF13484 Fer4_16:  4Fe-4S doubl  95.3  0.0027 5.9E-08   38.7  -1.0   19   77-95      2-20  (67)
 38 PF12838 Fer4_7:  4Fe-4S diclus  95.0  0.0043 9.3E-08   36.0  -0.8   18   77-94      2-19  (52)
 39 PF14697 Fer4_21:  4Fe-4S diclu  94.8   0.011 2.5E-07   35.5   0.8   19   75-93     39-58  (59)
 40 PF12838 Fer4_7:  4Fe-4S diclus  94.7   0.007 1.5E-07   35.1  -0.5   19   73-91     34-52  (52)
 41 PF13237 Fer4_10:  4Fe-4S diclu  94.6   0.014   3E-07   33.8   0.7   36   75-110     7-45  (52)
 42 CHL00065 psaC photosystem I su  94.4   0.014   3E-07   37.1   0.4   24   75-98     46-69  (81)
 43 PRK08764 ferredoxin; Provision  94.2   0.043 9.3E-07   38.4   2.6   55   75-133    15-69  (135)
 44 PF12800 Fer4_4:  4Fe-4S bindin  94.0   0.024 5.3E-07   25.6   0.7   15   76-90      3-17  (17)
 45 PRK08222 hydrogenase 4 subunit  93.9   0.031 6.7E-07   41.1   1.5   39   75-113    73-124 (181)
 46 PLN00071 photosystem I subunit  93.7   0.022 4.8E-07   36.0   0.3   25   74-98     45-69  (81)
 47 PF13187 Fer4_9:  4Fe-4S diclus  93.4   0.016 3.5E-07   33.7  -0.6   19   77-95      2-20  (55)
 48 TIGR03048 PS_I_psaC photosyste  93.3   0.023   5E-07   36.0  -0.0   24   75-98     45-68  (80)
 49 KOG3256|consensus               93.3   0.038 8.3E-07   40.2   1.1   24   71-94    146-169 (212)
 50 TIGR02936 fdxN_nitrog ferredox  93.2   0.018 3.9E-07   37.1  -0.6   22   73-94     68-89  (91)
 51 COG1145 NapF Ferredoxin [Energ  93.1   0.028 6.1E-07   36.2   0.1   21   74-94     28-48  (99)
 52 COG1143 NuoI Formate hydrogenl  93.1   0.033 7.2E-07   40.7   0.5   22   74-95     54-75  (172)
 53 PRK02651 photosystem I subunit  93.1   0.036 7.9E-07   34.9   0.6   24   75-98     46-69  (81)
 54 TIGR01971 NuoI NADH-quinone ox  92.1   0.066 1.4E-06   36.4   0.9   24   73-96     80-103 (122)
 55 TIGR00403 ndhI NADH-plastoquin  92.0   0.052 1.1E-06   40.0   0.3   21   74-94    101-121 (183)
 56 PRK05888 NADH dehydrogenase su  91.9   0.062 1.3E-06   38.7   0.6   23   73-95     95-117 (164)
 57 COG2221 DsrA Dissimilatory sul  91.6   0.051 1.1E-06   43.3  -0.0   21   76-96    173-193 (317)
 58 PRK09626 oorD 2-oxoglutarate-a  91.6   0.084 1.8E-06   35.1   1.0   18   76-93     17-34  (103)
 59 PRK06273 ferredoxin; Provision  91.5   0.061 1.3E-06   39.1   0.2   19   76-94     50-68  (165)
 60 TIGR01971 NuoI NADH-quinone ox  91.3   0.083 1.8E-06   35.9   0.7   21   75-95     43-63  (122)
 61 TIGR00402 napF ferredoxin-type  91.2   0.078 1.7E-06   35.2   0.5   21   75-95     66-86  (101)
 62 PRK08348 NADH-plastoquinone ox  91.0   0.084 1.8E-06   36.0   0.5   20   75-94     42-61  (120)
 63 PRK08348 NADH-plastoquinone ox  91.0   0.063 1.4E-06   36.6  -0.1   22   75-96     73-94  (120)
 64 PRK09477 napH quinol dehydroge  90.6   0.071 1.5E-06   41.5  -0.2   20   75-94    242-261 (271)
 65 PRK08222 hydrogenase 4 subunit  90.5   0.097 2.1E-06   38.5   0.5   21   74-94     37-57  (181)
 66 PRK06273 ferredoxin; Provision  90.1     0.1 2.2E-06   37.9   0.3   21   73-93     89-109 (165)
 67 PF14697 Fer4_21:  4Fe-4S diclu  90.1    0.12 2.6E-06   31.0   0.6   21   76-96      7-27  (59)
 68 PRK09626 oorD 2-oxoglutarate-a  90.0     0.1 2.2E-06   34.7   0.2   20   75-94     53-72  (103)
 69 CHL00014 ndhI NADH dehydrogena  90.0     0.1 2.2E-06   37.8   0.2   20   75-94     99-118 (167)
 70 TIGR03048 PS_I_psaC photosyste  89.9    0.12 2.6E-06   32.6   0.5   20   76-95      9-28  (80)
 71 PRK10194 ferredoxin-type prote  89.8    0.11 2.3E-06   37.4   0.2   19   76-94    139-157 (163)
 72 PRK09898 hypothetical protein;  89.7    0.07 1.5E-06   39.9  -0.8   21   76-96    182-202 (208)
 73 PRK09624 porD pyuvate ferredox  89.6    0.11 2.4E-06   34.8   0.2   20   75-94     81-100 (105)
 74 TIGR02936 fdxN_nitrog ferredox  89.6    0.14   3E-06   32.9   0.6   22   74-95     20-41  (91)
 75 PRK02651 photosystem I subunit  89.6    0.15 3.3E-06   32.0   0.8   23   74-96      8-30  (81)
 76 PRK09625 porD pyruvate flavodo  89.4   0.094   2E-06   36.7  -0.3   19   75-93     89-107 (133)
 77 TIGR02163 napH_ ferredoxin-typ  89.3   0.099 2.1E-06   40.4  -0.2   19   75-93    234-252 (255)
 78 COG1146 Ferredoxin [Energy pro  89.3    0.11 2.3E-06   31.8  -0.1   25   71-95     37-61  (68)
 79 TIGR02179 PorD_KorD 2-oxoacid:  89.2    0.13 2.9E-06   32.0   0.3   20   75-94     55-74  (78)
 80 TIGR02912 sulfite_red_C sulfit  88.4    0.14   3E-06   40.7  -0.0   20   76-95    202-221 (314)
 81 COG1600 Uncharacterized Fe-S p  88.3    0.12 2.7E-06   41.6  -0.4   21   76-96    186-206 (337)
 82 PRK05888 NADH dehydrogenase su  88.2    0.26 5.7E-06   35.4   1.3   20   75-94     58-77  (164)
 83 PRK12387 formate hydrogenlyase  88.1    0.18 3.8E-06   36.9   0.4   39   75-113    73-124 (180)
 84 PRK12387 formate hydrogenlyase  87.9    0.18   4E-06   36.8   0.4   21   74-94     37-57  (180)
 85 TIGR00402 napF ferredoxin-type  87.9    0.22 4.7E-06   33.0   0.7   19   76-94     35-53  (101)
 86 PRK09623 vorD 2-ketoisovalerat  87.8    0.16 3.5E-06   33.9   0.1   20   75-94     81-100 (105)
 87 PRK14028 pyruvate ferredoxin o  87.8    0.17 3.7E-06   40.1   0.1   21   75-95    289-309 (312)
 88 COG1145 NapF Ferredoxin [Energ  87.7    0.18 3.9E-06   32.4   0.2   23   74-96     62-84  (99)
 89 TIGR00397 mauM_napG MauM/NapG   87.4    0.23   5E-06   37.4   0.7   22   75-96     53-74  (213)
 90 PRK06991 ferredoxin; Provision  87.4    0.16 3.5E-06   39.7  -0.2   23   75-97    115-137 (270)
 91 TIGR02486 RDH reductive dehalo  87.1    0.17 3.7E-06   40.4  -0.2   19   76-94    206-224 (314)
 92 TIGR00276 iron-sulfur cluster   87.1    0.14 3.1E-06   40.2  -0.7   19   76-94    160-178 (282)
 93 TIGR02494 PFLE_PFLC glycyl-rad  87.0    0.25 5.4E-06   38.5   0.6   17   76-92     49-65  (295)
 94 COG1144 Pyruvate:ferredoxin ox  86.8     0.2 4.3E-06   32.8  -0.0   18   76-93     67-84  (91)
 95 PLN00071 photosystem I subunit  86.2    0.18   4E-06   31.7  -0.4   20   76-95     10-29  (81)
 96 PF13183 Fer4_8:  4Fe-4S diclus  85.8    0.16 3.5E-06   29.6  -0.8   17   74-90     40-56  (57)
 97 PRK09476 napG quinol dehydroge  85.7    0.34 7.3E-06   37.5   0.8   19   76-94     60-78  (254)
 98 TIGR02700 flavo_MJ0208 archaeo  85.4     0.3 6.4E-06   37.2   0.4   19   76-94    149-167 (234)
 99 PRK07118 ferredoxin; Validated  85.4    0.24 5.2E-06   38.9  -0.2   21   76-96    214-234 (280)
100 TIGR02910 sulfite_red_A sulfit  85.3    0.35 7.5E-06   39.0   0.7   19   73-91    299-317 (334)
101 PRK10194 ferredoxin-type prote  85.1    0.26 5.7E-06   35.3  -0.1   20   75-94     66-85  (163)
102 PRK10330 formate dehydrogenase  85.0    0.29 6.3E-06   35.6   0.1   21   75-95    129-155 (181)
103 TIGR02060 aprB adenosine phosp  84.0    0.24 5.3E-06   34.6  -0.6   21   74-94     44-64  (132)
104 TIGR03290 CoB_CoM_SS_C CoB--Co  83.9    0.75 1.6E-05   32.3   1.8   16   76-91      3-18  (144)
105 TIGR00397 mauM_napG MauM/NapG   83.7    0.38 8.2E-06   36.3   0.3   20   76-95    176-197 (213)
106 TIGR03149 cyt_nit_nrfC cytochr  83.6     0.5 1.1E-05   35.8   0.9   18   76-93    126-143 (225)
107 TIGR02494 PFLE_PFLC glycyl-rad  83.5    0.28 6.1E-06   38.2  -0.5   21   74-94     81-101 (295)
108 TIGR03149 cyt_nit_nrfC cytochr  83.3    0.49 1.1E-05   35.9   0.7   23   74-96    151-183 (225)
109 PRK09624 porD pyuvate ferredox  82.6    0.47   1E-05   31.7   0.4   20   76-95     52-71  (105)
110 TIGR02176 pyruv_ox_red pyruvat  82.2    0.59 1.3E-05   43.5   1.0   20   75-94    683-702 (1165)
111 TIGR02512 Fe_only_hydrog hydro  82.2    0.44 9.4E-06   38.8   0.1   20   75-94     50-69  (374)
112 PF12797 Fer4_2:  4Fe-4S bindin  82.2    0.35 7.7E-06   23.4  -0.3   14   76-89      9-22  (22)
113 PRK09625 porD pyruvate flavodo  82.0     0.4 8.6E-06   33.5  -0.2   19   76-94     60-78  (133)
114 TIGR02512 Fe_only_hydrog hydro  82.0    0.56 1.2E-05   38.2   0.6   18   76-93      8-25  (374)
115 PRK15055 anaerobic sulfite red  81.9    0.57 1.2E-05   37.9   0.7   19   73-91    305-323 (344)
116 TIGR01660 narH nitrate reducta  80.4     0.6 1.3E-05   39.3   0.3   18   76-93    182-201 (492)
117 PRK13795 hypothetical protein;  80.4    0.49 1.1E-05   41.2  -0.2   20   76-95    582-601 (636)
118 PRK10330 formate dehydrogenase  80.2    0.84 1.8E-05   33.2   1.0   19   76-94     88-106 (181)
119 TIGR00403 ndhI NADH-plastoquin  80.2    0.71 1.5E-05   33.9   0.6   20   73-92     60-79  (183)
120 CHL00014 ndhI NADH dehydrogena  80.2    0.61 1.3E-05   33.7   0.3   19   74-92     58-76  (167)
121 PRK07118 ferredoxin; Validated  80.2    0.51 1.1E-05   37.1  -0.2   21   76-96    140-160 (280)
122 PF13247 Fer4_11:  4Fe-4S diclu  80.0    0.49 1.1E-05   31.4  -0.3   14   81-94     82-95  (98)
123 TIGR02700 flavo_MJ0208 archaeo  80.0    0.71 1.5E-05   35.1   0.6   25   76-100   178-203 (234)
124 TIGR03224 benzo_boxA benzoyl-C  79.9    0.66 1.4E-05   38.3   0.4   21   74-94     38-58  (411)
125 TIGR02066 dsrB sulfite reducta  79.2    0.65 1.4E-05   37.5   0.2   18   76-93    215-232 (341)
126 COG1142 HycB Fe-S-cluster-cont  78.8    0.73 1.6E-05   33.5   0.3   21   76-96     83-103 (165)
127 TIGR00384 dhsB succinate dehyd  78.8    0.92   2E-05   34.1   0.8   20   73-92    192-211 (220)
128 PRK12771 putative glutamate sy  78.6     0.6 1.3E-05   39.8  -0.2   18   76-93    542-559 (564)
129 TIGR02163 napH_ ferredoxin-typ  78.3    0.69 1.5E-05   35.7   0.1   19   74-92    200-218 (255)
130 TIGR03315 Se_ygfK putative sel  77.8    0.78 1.7E-05   42.2   0.2   20   76-95    922-941 (1012)
131 TIGR02912 sulfite_red_C sulfit  77.1    0.93   2E-05   35.9   0.5   16   76-91    170-185 (314)
132 PRK14993 tetrathionate reducta  76.9    0.85 1.8E-05   35.1   0.2   18   76-93    131-148 (244)
133 TIGR03478 DMSO_red_II_bet DMSO  76.8    0.75 1.6E-05   36.9  -0.1   17   77-93    164-180 (321)
134 PRK14993 tetrathionate reducta  76.7       1 2.2E-05   34.7   0.6   22   74-95    156-186 (244)
135 PRK09476 napG quinol dehydroge  76.4    0.72 1.6E-05   35.7  -0.3   19   76-94    185-205 (254)
136 PRK12769 putative oxidoreducta  75.9     1.4   3E-05   38.4   1.3   19   76-94     86-104 (654)
137 TIGR02176 pyruv_ox_red pyruvat  75.8     1.1 2.4E-05   41.8   0.7   21   74-94    738-760 (1165)
138 PRK05035 electron transport co  75.6       1 2.3E-05   39.7   0.4   17   76-92    371-387 (695)
139 COG0437 HybA Fe-S-cluster-cont  75.5     1.3 2.8E-05   33.3   0.8   21   74-94    126-155 (203)
140 PRK10882 hydrogenase 2 protein  75.3     1.1 2.3E-05   36.1   0.4   45    3-47     69-130 (328)
141 PRK09477 napH quinol dehydroge  75.3     1.5 3.2E-05   34.2   1.1   20   74-93    207-226 (271)
142 TIGR02951 DMSO_dmsB DMSO reduc  75.0    0.94   2E-05   32.3   0.0   13   82-94    138-150 (161)
143 PRK14028 pyruvate ferredoxin o  75.0     1.8 3.9E-05   34.2   1.6   19   75-93    247-265 (312)
144 PRK09898 hypothetical protein;  74.4     1.5 3.4E-05   32.6   1.0   20   76-95    122-143 (208)
145 PRK10882 hydrogenase 2 protein  74.2     1.3 2.8E-05   35.6   0.6   16   77-92    145-160 (328)
146 TIGR03479 DMSO_red_II_alp DMSO  74.2     1.4 3.1E-05   39.9   0.9   38   82-119    25-76  (912)
147 COG2768 Uncharacterized Fe-S c  74.2     1.2 2.5E-05   35.7   0.3   20   76-95    194-213 (354)
148 PRK08318 dihydropyrimidine deh  74.0     1.1 2.3E-05   37.0   0.1   20   76-95    378-398 (420)
149 PRK12769 putative oxidoreducta  73.9     1.7 3.6E-05   37.9   1.2   22   74-95     53-76  (654)
150 TIGR02066 dsrB sulfite reducta  73.5       2 4.3E-05   34.7   1.5   18   77-94    183-200 (341)
151 TIGR01944 rnfB electron transp  73.4     3.1 6.7E-05   29.9   2.4   28  106-133    68-95  (165)
152 PRK09853 putative selenate red  72.6     1.8 3.8E-05   39.9   1.1   15   79-93    894-908 (1019)
153 PRK09326 F420H2 dehydrogenase   72.4    0.86 1.9E-05   36.6  -0.8   21   75-95     12-32  (341)
154 TIGR03478 DMSO_red_II_bet DMSO  72.4     1.6 3.5E-05   35.0   0.7   18   76-93    130-149 (321)
155 TIGR02951 DMSO_dmsB DMSO reduc  72.3     1.5 3.4E-05   31.2   0.6   18   76-93     63-82  (161)
156 PRK13984 putative oxidoreducta  71.8     1.7 3.7E-05   37.4   0.8   21   74-94     44-64  (604)
157 COG2878 Predicted NADH:ubiquin  71.6     1.8   4E-05   32.1   0.8   19   76-94    146-164 (198)
158 COG1149 MinD superfamily P-loo  71.5     1.8   4E-05   34.0   0.9   23   73-95     97-119 (284)
159 TIGR02745 ccoG_rdxA_fixG cytoc  71.1    0.85 1.8E-05   38.1  -1.1   18   74-91    230-247 (434)
160 TIGR01582 FDH-beta formate deh  71.0     1.5 3.3E-05   34.5   0.3   19   76-94    125-143 (283)
161 cd07030 RNAP_D D subunit of Ar  70.7     1.4   3E-05   34.0  -0.0   19   76-94    170-188 (259)
162 TIGR02060 aprB adenosine phosp  70.2     1.6 3.4E-05   30.5   0.2   19   76-94      9-32  (132)
163 PRK11168 glpC sn-glycerol-3-ph  70.0     2.1 4.6E-05   34.7   0.9   20   74-93      6-25  (396)
164 TIGR01660 narH nitrate reducta  69.8     1.1 2.4E-05   37.8  -0.8   33   76-110   215-247 (492)
165 COG0437 HybA Fe-S-cluster-cont  69.8       2 4.3E-05   32.3   0.7   18   76-93    101-118 (203)
166 TIGR03336 IOR_alpha indolepyru  69.5     1.2 2.7E-05   38.4  -0.5   17   76-92    579-595 (595)
167 TIGR03287 methan_mark_16 putat  69.1     1.3 2.8E-05   36.5  -0.4   20   75-94    330-349 (391)
168 PRK12809 putative oxidoreducta  69.0     2.1 4.6E-05   37.2   0.8   19   76-94     86-104 (639)
169 PF13534 Fer4_17:  4Fe-4S diclu  68.8     1.2 2.6E-05   26.2  -0.6   17   77-93      2-18  (61)
170 PF04879 Molybdop_Fe4S4:  Molyb  68.6     1.3 2.9E-05   25.7  -0.4   19  101-119     3-21  (55)
171 TIGR03294 FrhG coenzyme F420 h  68.0     1.2 2.5E-05   34.0  -0.9   19   76-94    175-193 (228)
172 TIGR01945 rnfC electron transp  67.0     2.8   6E-05   34.9   1.0   18   75-92    363-380 (435)
173 PRK05950 sdhB succinate dehydr  66.9     2.7 5.8E-05   31.9   0.9   20   73-92    196-215 (232)
174 PRK15449 ferredoxin-like prote  66.8     1.7 3.8E-05   28.7  -0.1   14   81-94     37-50  (95)
175 COG1149 MinD superfamily P-loo  66.8     3.3 7.1E-05   32.7   1.3   19   76-94     70-88  (284)
176 PRK05113 electron transport co  66.7     5.8 0.00013   29.3   2.7   26  107-132    71-96  (191)
177 TIGR03290 CoB_CoM_SS_C CoB--Co  66.4     2.5 5.5E-05   29.6   0.6   20   73-92     44-63  (144)
178 TIGR03287 methan_mark_16 putat  66.2     1.5 3.3E-05   36.1  -0.6   19   76-94    303-323 (391)
179 PF06902 Fer4_19:  Divergent 4F  65.5     2.3 5.1E-05   25.9   0.3   14   82-95     49-62  (64)
180 PRK07570 succinate dehydrogena  65.4       3 6.5E-05   32.2   0.9   20   73-92    210-229 (250)
181 PRK12809 putative oxidoreducta  65.2     2.6 5.7E-05   36.6   0.6   18   76-93     55-74  (639)
182 PRK00783 DNA-directed RNA poly  64.6     2.1 4.5E-05   33.1  -0.1   19   76-94    200-218 (263)
183 PRK12385 fumarate reductase ir  64.6     2.8   6E-05   32.2   0.6   20   73-92    201-220 (244)
184 COG1139 Uncharacterized conser  64.0     2.7 5.8E-05   35.1   0.4   20   74-93    307-326 (459)
185 PRK08640 sdhB succinate dehydr  63.9     2.9 6.4E-05   32.2   0.6   20   73-92    150-169 (249)
186 PRK13552 frdB fumarate reducta  62.8     3.4 7.3E-05   31.7   0.8   21   72-92    203-223 (239)
187 PRK12575 succinate dehydrogena  62.8     3.3 7.2E-05   31.7   0.7   20   73-92    199-218 (235)
188 TIGR00273 iron-sulfur cluster-  62.5     2.8   6E-05   35.0   0.3   20   73-92    341-360 (432)
189 PRK07570 succinate dehydrogena  60.7     3.9 8.4E-05   31.6   0.8   18   74-91    156-173 (250)
190 PRK08640 sdhB succinate dehydr  60.3       4 8.8E-05   31.5   0.8   20   73-92    207-226 (249)
191 cd07030 RNAP_D D subunit of Ar  59.9     2.8 6.2E-05   32.3  -0.1   19   76-94    200-218 (259)
192 TIGR00384 dhsB succinate dehyd  59.8     3.9 8.5E-05   30.7   0.7   18   74-91    137-154 (220)
193 TIGR01582 FDH-beta formate deh  59.8     2.6 5.6E-05   33.2  -0.4   21   74-94    150-179 (283)
194 TIGR00273 iron-sulfur cluster-  59.3     3.8 8.3E-05   34.2   0.6   19   74-92    292-310 (432)
195 PRK12576 succinate dehydrogena  59.1     4.1 8.9E-05   31.9   0.7   20   73-92    204-223 (279)
196 PRK12576 succinate dehydrogena  58.8     4.3 9.4E-05   31.8   0.8   19   74-92    151-169 (279)
197 PRK12771 putative glutamate sy  58.2     3.8 8.2E-05   35.0   0.3   19   76-94    511-529 (564)
198 COG1148 HdrA Heterodisulfide r  57.4     5.7 0.00012   34.1   1.3   19   76-95    562-580 (622)
199 PRK13795 hypothetical protein;  57.3     3.2   7E-05   36.2  -0.2   19   76-94    613-631 (636)
200 PRK12575 succinate dehydrogena  57.0     5.1 0.00011   30.7   0.8   20   73-92    142-161 (235)
201 PRK08318 dihydropyrimidine deh  56.4     5.2 0.00011   32.9   0.9   16   76-91    343-358 (420)
202 PRK12386 fumarate reductase ir  55.9     5.7 0.00012   30.8   1.0   21   72-92    197-217 (251)
203 PRK15055 anaerobic sulfite red  55.3     5.1 0.00011   32.5   0.6   16   74-89    225-240 (344)
204 PRK09853 putative selenate red  55.2     4.5 9.7E-05   37.4   0.3   20   75-94    926-945 (1019)
205 TIGR03315 Se_ygfK putative sel  53.5     6.7 0.00015   36.3   1.2   15   79-93    889-903 (1012)
206 TIGR02064 dsrA sulfite reducta  53.1     6.6 0.00014   32.5   1.0   15   81-95    248-262 (402)
207 COG1148 HdrA Heterodisulfide r  52.9     4.9 0.00011   34.4   0.2   22   74-95    586-607 (622)
208 TIGR02910 sulfite_red_A sulfit  52.2     6.1 0.00013   31.9   0.6   17   75-91    220-236 (334)
209 COG1245 Predicted ATPase, RNas  52.2     5.2 0.00011   34.1   0.2   20   76-95     51-70  (591)
210 COG3592 Uncharacterized conser  51.8     3.8 8.2E-05   25.5  -0.5   18   78-95     55-72  (74)
211 PLN00129 succinate dehydrogena  50.7     6.7 0.00014   30.9   0.6   20   73-92    242-261 (276)
212 PRK12386 fumarate reductase ir  50.7     6.7 0.00015   30.4   0.6   20   73-92    140-159 (251)
213 PRK12577 succinate dehydrogena  50.1     6.4 0.00014   31.6   0.4   20   73-92    207-226 (329)
214 TIGR02745 ccoG_rdxA_fixG cytoc  49.8     4.3 9.4E-05   33.9  -0.6   17   75-92    255-271 (434)
215 COG0479 FrdB Succinate dehydro  49.8       8 0.00017   29.7   0.9   20   73-92    196-215 (234)
216 PRK12577 succinate dehydrogena  49.3     7.3 0.00016   31.2   0.7   18   74-91    151-168 (329)
217 PRK13552 frdB fumarate reducta  49.2     6.2 0.00013   30.2   0.2   18   75-92    149-166 (239)
218 PLN00129 succinate dehydrogena  49.1     8.3 0.00018   30.3   0.9   17   75-91    187-203 (276)
219 PRK12385 fumarate reductase ir  48.9     7.5 0.00016   29.9   0.6   17   75-91    147-163 (244)
220 cd01916 ACS_1 Acetyl-CoA synth  48.8     5.3 0.00011   35.6  -0.2   19   74-92    402-420 (731)
221 COG1139 Uncharacterized conser  48.8     7.7 0.00017   32.5   0.7   20   72-91    355-374 (459)
222 PRK05950 sdhB succinate dehydr  48.6     7.6 0.00016   29.4   0.6   17   74-90    140-156 (232)
223 PRK13409 putative ATPase RIL;   48.2     7.8 0.00017   33.5   0.7   19   76-94     50-68  (590)
224 TIGR03379 glycerol3P_GlpC glyc  48.1     8.4 0.00018   31.3   0.9   19   74-92      4-22  (397)
225 COG1941 FrhG Coenzyme F420-red  48.1      22 0.00047   27.5   3.0   25   71-95    186-210 (247)
226 PRK11274 glcF glycolate oxidas  48.0     7.7 0.00017   31.6   0.6   21   72-92     70-90  (407)
227 PRK06259 succinate dehydrogena  46.7     9.2  0.0002   32.0   0.9   22   72-93    182-203 (486)
228 PRK13984 putative oxidoreducta  46.5     6.7 0.00015   33.7   0.1   20   75-94     86-105 (604)
229 COG0247 GlpC Fe-S oxidoreducta  44.7      11 0.00023   30.3   0.9   20   74-93      8-27  (388)
230 PRK11274 glcF glycolate oxidas  44.4      11 0.00023   30.7   1.0   20   73-92     21-40  (407)
231 PRK11168 glpC sn-glycerol-3-ph  43.9      11 0.00024   30.5   0.9   20   72-91     51-70  (396)
232 PF00220 Hormone_4:  Neurohypop  43.6      11 0.00025   14.1   0.5    6   85-90      4-9   (9)
233 PRK09326 F420H2 dehydrogenase   43.5     9.9 0.00021   30.5   0.6   18   75-92     53-70  (341)
234 PRK00941 acetyl-CoA decarbonyl  43.2     7.7 0.00017   34.8  -0.1   17   75-91    442-458 (781)
235 COG1150 HdrC Heterodisulfide r  42.5      12 0.00026   28.0   0.8   21   74-94     38-58  (195)
236 PRK06259 succinate dehydrogena  42.1      11 0.00025   31.5   0.8   19   73-91    131-149 (486)
237 KOG0421|consensus               41.8      36 0.00078   24.3   3.1   30    1-30     19-48  (175)
238 TIGR03379 glycerol3P_GlpC glyc  41.3      13 0.00027   30.3   0.9   21   72-92     49-69  (397)
239 TIGR01936 nqrA NADH:ubiquinone  41.2      10 0.00022   31.8   0.4   17   76-92    374-390 (447)
240 TIGR02064 dsrA sulfite reducta  39.9      12 0.00027   30.9   0.7   16   76-92    273-288 (402)
241 PF13223 DUF4031:  Protein of u  38.9      18 0.00039   23.3   1.1   20  114-133    23-42  (83)
242 COG1035 FrhB Coenzyme F420-red  36.8      11 0.00024   30.4  -0.1   19   75-94      5-23  (332)
243 TIGR00314 cdhA CO dehydrogenas  36.3      11 0.00024   33.9  -0.2   16   76-91    438-453 (784)
244 PRK05352 Na(+)-translocating N  35.9      14 0.00031   31.0   0.5   18   75-92    374-391 (448)
245 COG2768 Uncharacterized Fe-S c  35.1      14  0.0003   29.8   0.2   19   75-93    221-239 (354)
246 cd01916 ACS_1 Acetyl-CoA synth  34.0      18  0.0004   32.3   0.8   17   75-91    365-381 (731)
247 PF09237 GAGA:  GAGA factor;  I  33.9      10 0.00022   22.3  -0.5   14   24-37     19-32  (54)
248 TIGR01945 rnfC electron transp  33.4      19 0.00041   30.0   0.8   19   74-92    401-419 (435)
249 COG4231 Indolepyruvate ferredo  32.7      15 0.00033   32.2   0.1   20   74-93    607-626 (640)
250 TIGR03336 IOR_alpha indolepyru  31.9      16 0.00034   31.7   0.0   17   75-91    550-568 (595)
251 PRK05035 electron transport co  31.6      20 0.00044   31.8   0.7   18   75-92    409-426 (695)
252 PF13459 Fer4_15:  4Fe-4S singl  31.6      14 0.00031   22.0  -0.2   14   76-89      7-20  (65)
253 PF03091 CutA1:  CutA1 divalent  30.7      37 0.00081   22.5   1.7   26    4-33     54-79  (102)
254 COG4656 RnfC Predicted NADH:ub  30.4      15 0.00032   31.5  -0.3   17   76-92    366-382 (529)
255 TIGR00314 cdhA CO dehydrogenas  29.7      22 0.00047   32.1   0.6   17   75-91    399-415 (784)
256 cd00350 rubredoxin_like Rubred  29.5      63  0.0014   16.6   2.1   12  102-113    16-27  (33)
257 PF09824 ArsR:  ArsR transcript  27.5 1.3E+02  0.0028   21.8   4.0   42    4-57     97-138 (160)
258 PRK00941 acetyl-CoA decarbonyl  26.7      29 0.00063   31.3   0.8   17   75-91    404-420 (781)
259 COG1141 Fer Ferredoxin [Energy  26.6      24 0.00052   21.8   0.2   15   76-90      9-23  (68)
260 PF13370 Fer4_13:  4Fe-4S singl  25.7      16 0.00034   21.5  -0.7   15   76-90      5-19  (58)
261 KOG0917|consensus               25.6      51  0.0011   26.2   1.9   23    2-24     39-61  (338)
262 KOG0723|consensus               25.2   1E+02  0.0022   21.0   3.0   32    9-46     66-97  (112)
263 PF08279 HTH_11:  HTH domain;    25.0 1.2E+02  0.0025   16.9   3.0   28   17-54      2-29  (55)
264 PF07381 DUF1495:  Winged helix  24.9 1.3E+02  0.0028   19.6   3.4   32   15-55      9-40  (90)
265 PRK10645 divalent-cation toler  24.1   1E+02  0.0022   20.9   2.9   26    4-33     64-89  (112)
266 PF15174 PRNT:  Prion-related p  23.7 1.1E+02  0.0025   17.4   2.6   25   13-37     20-44  (51)
267 PRK00398 rpoP DNA-directed RNA  23.1      48   0.001   18.3   1.0    9  103-111    21-29  (46)
268 PF09538 FYDLN_acid:  Protein o  22.8      55  0.0012   22.0   1.4   19   98-116    21-39  (108)
269 PF07754 DUF1610:  Domain of un  22.7      77  0.0017   15.5   1.6    6  105-110    18-23  (24)
270 COG1140 NarY Nitrate reductase  22.4      36 0.00079   28.4   0.5   21   76-96    182-204 (513)
271 PF12404 DUF3663:  Peptidase ;   22.2 1.1E+02  0.0024   19.4   2.6   23    1-23     24-47  (77)
272 PRK15360 pathogenicity island   22.2 1.3E+02  0.0028   21.2   3.2   26    4-29     87-114 (137)
273 PF12801 Fer4_5:  4Fe-4S bindin  21.7      21 0.00046   19.8  -0.7   12   83-94     24-35  (48)
274 COG0348 NapH Polyferredoxin [E  21.4      28  0.0006   28.6  -0.3   17   76-92    246-262 (386)
275 COG3373 Uncharacterized protei  20.2 1.9E+02  0.0041   19.1   3.5   33   14-55     16-48  (108)
276 PF13186 SPASM:  Iron-sulfur cl  20.0 1.1E+02  0.0024   17.2   2.3   23    9-35     41-63  (64)

No 1  
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]
Probab=99.97  E-value=7.4e-32  Score=229.06  Aligned_cols=134  Identities=37%  Similarity=0.685  Sum_probs=112.8

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccc-------------cCCCcc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDID-------------FSGKRW   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~-------------~~~~r~   67 (139)
                      +|||+|.|+||+|+++|+.+|||||.|||+|||+|+++|+|+|||++..||+..+||.+..             ++-+||
T Consensus        67 ~dGM~I~T~s~~vk~~R~~vmE~LLiNHPlDCpiCD~gGeCeLQD~a~~~G~~~sr~~~~kr~~~~~~~gp~v~~dm~RC  146 (693)
T COG1034          67 TDGMVISTNSEEVKKAREGVMEFLLINHPLDCPVCDKGGECELQDLAVKYGVSHSRYRETKRTHRDKDLGPLVKYDMNRC  146 (693)
T ss_pred             CCCeEEecCCHHHHHHHHHHHHHHHhcCCCCCCccCCCCCchhHHHHHHhCCCcccccccccccccccccchhhcccccc
Confidence            5899999999999999999999999999999999999999999999999999999986531             122333


Q ss_pred             ------------------------------ccccccceeecccCceecccCCcccccc-------eeeeccccccCCCCC
Q psy3842          68 ------------------------------GYLREKLFLSELSGKRESTCAPAREGVM-------EFLLVNHPLDCPICD  110 (139)
Q Consensus        68 ------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~-------e~~l~~~~~~C~~C~  110 (139)
                                                    +|+.+++...+.||+|+++||||||+.+       .|.+...+++|.+|+
T Consensus       147 I~C~RCVR~c~eiaG~~~l~~~~rg~~~~i~t~~~~~l~se~cGncv~vCPvGALt~K~~~~~ar~wEl~k~~si~~~~a  226 (693)
T COG1034         147 ILCTRCVRFCKEIAGTHELGVIKRGENSEIGTYLDQPLESELCGNCVDVCPVGALTSKPFAFTARKWELKKTPSICVHCA  226 (693)
T ss_pred             eechhhHHhhhhhcCccccceeecCCCceeecccccccccccccceeeeccccccccChHHhhhccchhccCceeeccCc
Confidence                                          4555677788999999999999999865       577888999999999


Q ss_pred             CCCcchhHH---------------HHHHhCCCCCCCCCC
Q psy3842         111 QGGECDLQD---------------QSMAFGSDRSRFTDI  134 (139)
Q Consensus       111 ~g~~~eL~~---------------~~~~~gv~~~rf~~~  134 (139)
                      +||......               ...+|..+++||...
T Consensus       227 ~g~~i~~d~r~~ev~ri~~r~n~~vNe~~~~d~~RF~~d  265 (693)
T COG1034         227 VGCNIRVDERYGEVRRILPRYNEVVNEEWLCDKGRFAYD  265 (693)
T ss_pred             cccceeecccccchhhhcccchhHHHHHHhccccccccc
Confidence            999776533               345677888888654


No 2  
>PRK09130 NADH dehydrogenase subunit G; Validated
Probab=99.97  E-value=7.4e-31  Score=224.96  Aligned_cols=119  Identities=42%  Similarity=0.638  Sum_probs=101.6

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccc-------------cCCCcc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDID-------------FSGKRW   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~-------------~~~~r~   67 (139)
                      +|||+|+|+||+|+++||.+|||||++||+||++|+++|+|+||++++.||+...||.+..             ++.+||
T Consensus        68 ~~gm~v~T~s~~v~~~r~~~le~ll~~Hp~dC~~C~~~g~C~Lq~~~~~~g~~~~r~~~~~~~~~~~~~~p~i~~~~~rC  147 (687)
T PRK09130         68 GEGMVIFTNTPMVKKAREGVMEFLLINHPLDCPICDQGGECDLQDQAMAYGVDTSRYHENKRAVEDKYMGPLVKTVMTRC  147 (687)
T ss_pred             CCCCEEEeCCHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCHHHHHHHHhCCCCCCCCccccccCcCCCCCcEEEecccC
Confidence            5899999999999999999999999999999999999999999999999999988886421             122333


Q ss_pred             ------------------------------ccccccceeecccCceecccCCcccccc-------eeeeccccccCCCCC
Q psy3842          68 ------------------------------GYLREKLFLSELSGKRESTCAPAREGVM-------EFLLVNHPLDCPICD  110 (139)
Q Consensus        68 ------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~-------e~~l~~~~~~C~~C~  110 (139)
                                                    +++.+..+.++.||+|+++||||||+.+       .|.++.++++|++|+
T Consensus       148 I~C~rCvr~c~ev~g~~~l~~~~rg~~~~i~~~~~~~~~~~~~G~cv~~CPvgAl~~k~~~~~~r~w~l~~~~sic~~c~  227 (687)
T PRK09130        148 IHCTRCVRFATEVAGVPELGAIGRGEDMEITTYLEQALTSELSGNVIDLCPVGALTSKPYAFTARPWELKKTESIDVMDA  227 (687)
T ss_pred             CcccHHHHHHHhhcCCceEEeeecCCCCEEccCCCCCccccccccHHhhCCCccccccccccccCcceeeeccccCCCCC
Confidence                                          2334556678999999999999999865       477888899999999


Q ss_pred             CCCcchhHH
Q psy3842         111 QGGECDLQD  119 (139)
Q Consensus       111 ~g~~~eL~~  119 (139)
                      +||+.+++.
T Consensus       228 vGC~i~v~~  236 (687)
T PRK09130        228 VGSNIRVDT  236 (687)
T ss_pred             CCCCeEEEE
Confidence            999998853


No 3  
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G. This model represents the G subunit (one of 14: A-N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes related subunits from formate dehydrogenase complexes.
Probab=99.96  E-value=9.6e-30  Score=215.55  Aligned_cols=119  Identities=46%  Similarity=0.753  Sum_probs=100.1

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccc-------------cCCCcc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDID-------------FSGKRW   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~-------------~~~~r~   67 (139)
                      +|||+|.|+||+|+++||.+|||||++||+||++|+++|+|+||++++.||+...+|....             ++.+||
T Consensus        65 ~~gm~v~t~~~~~~~~r~~~~e~ll~~h~~dC~~C~~~g~C~Lq~~~~~~g~~~~~~~~~~~~~~~~~~~p~i~~d~~rC  144 (603)
T TIGR01973        65 TDGMKISTNSEKVKKAREGVMEFLLINHPLDCPICDQGGECDLQDQAVMYGSDRSRFREKKRTVENKYLGPLIKTEMTRC  144 (603)
T ss_pred             CCCCEEEeCCHHHHHHHHHHHHHHHhcCCCCCCcCCCCCCChHHHHHHHhCCCCCCCCcccccCCCCCCCCCeEecCCcC
Confidence            5899999999999999999999999999999999999999999999999999988885321             233333


Q ss_pred             ------------------------------ccccccceeecccCceecccCCcccccc-------eeeeccccccCCCCC
Q psy3842          68 ------------------------------GYLREKLFLSELSGKRESTCAPAREGVM-------EFLLVNHPLDCPICD  110 (139)
Q Consensus        68 ------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~-------e~~l~~~~~~C~~C~  110 (139)
                                                    +++.+.++.+++||+|+++||||||+.+       .|.++.+++.|++|+
T Consensus       145 I~C~rCvr~c~e~~g~~~l~~~~rg~~~~i~~~~~~~~~~~~cg~cv~vCP~GAl~~k~~~~~~r~w~~~~~~t~C~~C~  224 (603)
T TIGR01973       145 IHCTRCVRFANEVAGVEDLGVIGRGNNVEIGTYEGKTLESELSGNLIDICPVGALTSKPYAFKARPWELKSTPSICVHDS  224 (603)
T ss_pred             ccccHHHHHHHHhhCCceEEEeccCCCCEEecCCCCCCCCcccCChHhhCCcccccccccccccccccceeccccCCCcC
Confidence                                          1223445678999999999999999875       466778889999999


Q ss_pred             CCCcchhHH
Q psy3842         111 QGGECDLQD  119 (139)
Q Consensus       111 ~g~~~eL~~  119 (139)
                      .||...++.
T Consensus       225 ~gC~i~v~v  233 (603)
T TIGR01973       225 VGCNIRVDE  233 (603)
T ss_pred             CCCceeEEe
Confidence            999887754


No 4  
>PRK07860 NADH dehydrogenase subunit G; Validated
Probab=99.96  E-value=2.4e-29  Score=218.72  Aligned_cols=119  Identities=41%  Similarity=0.717  Sum_probs=99.9

Q ss_pred             CCCCEEEcC--CHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccccc------c--------cCC
Q psy3842           1 MKGWRVKTN--SEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI------D--------FSG   64 (139)
Q Consensus         1 ~~Gm~V~T~--s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~------~--------~~~   64 (139)
                      +|||+|+|+  ||+|+++||.+|||||+|||+||++|+++|+|+||++++.||+...+|...      +        ++.
T Consensus        70 ~~gm~V~t~~~s~~v~~~r~~~le~ll~~hp~dC~~C~~~g~C~Lq~~~~~~g~~~~~~~~~~~~~~~~~~~~~~i~~d~  149 (797)
T PRK07860         70 TDGMVVKTQLTSPVADKAQHGVMELLLINHPLDCPVCDKGGECPLQNQAMSNGRAESRFTDVKRTFPKPINISTQVLLDR  149 (797)
T ss_pred             CCCcEEEeCCCCHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCcHHHHHHHHhCCCCccCccccccCCCCCCCCcceeecc
Confidence            589999999  999999999999999999999999999999999999999999988887531      1        123


Q ss_pred             Ccc------------------------------ccccccceeecccCceecccCCcccccce-------eeeccccccCC
Q psy3842          65 KRW------------------------------GYLREKLFLSELSGKRESTCAPAREGVME-------FLLVNHPLDCP  107 (139)
Q Consensus        65 ~r~------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~e-------~~l~~~~~~C~  107 (139)
                      +||                              +++.+..+.+++||+|+++||||||+.+.       |.++.++++|+
T Consensus       150 ~rCI~C~rCvr~c~ev~g~~~l~~~~rg~~~~i~~~~~~~~~~~~cG~cv~vCP~GAl~~k~~~~~~r~w~l~~~~SvC~  229 (797)
T PRK07860        150 ERCVLCARCTRFSDQIAGDPFIDLQERGALQQVGIYEGEPFQSYFSGNTVQICPVGALTGAAYRFRARPFDLVSTPSVCE  229 (797)
T ss_pred             cccccCcHHHHHHHhhcCCcEEEeeecCCCCEEecCCCCCcCccccCCchhhCCcccccccccccccCcccceecceeCC
Confidence            333                              12223456788999999999999998654       66777889999


Q ss_pred             CCCCCCcchhHH
Q psy3842         108 ICDQGGECDLQD  119 (139)
Q Consensus       108 ~C~~g~~~eL~~  119 (139)
                      +|+.||+..++.
T Consensus       230 ~C~~GC~l~v~v  241 (797)
T PRK07860        230 HCASGCAQRTDH  241 (797)
T ss_pred             CCCCCCCeEEEE
Confidence            999999998854


No 5  
>PRK09129 NADH dehydrogenase subunit G; Validated
Probab=99.96  E-value=2.5e-29  Score=218.08  Aligned_cols=119  Identities=38%  Similarity=0.562  Sum_probs=100.3

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccc-------------cCCCcc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDID-------------FSGKRW   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~-------------~~~~r~   67 (139)
                      ++||+|.|+||+++++||.+|||||++||+||++|+++|+|+||+++++||+...+|.+..             ++.+||
T Consensus        67 ~~gm~v~t~~~~~~~~r~~~l~~ll~~h~~~C~~c~~~g~C~Lq~~a~~~g~~~~~~~~~~~~~~~~~~~p~i~~d~~rC  146 (776)
T PRK09129         67 TDGMKVFTRSEKALKAQKSVMEFLLINHPLDCPICDQGGECQLQDLAVGYGRSTSRYTEEKRVVFDKDLGPLISTEMTRC  146 (776)
T ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHhcCCCCcccCCCCCCCHHHHHHHHhCCCCCccccccccCCccCCCcceeeccccc
Confidence            5899999999999999999999999999999999999999999999999999988885421             123333


Q ss_pred             ------------------------------ccccccceeecccCceecccCCcccccce-------eeeccccccCCCCC
Q psy3842          68 ------------------------------GYLREKLFLSELSGKRESTCAPAREGVME-------FLLVNHPLDCPICD  110 (139)
Q Consensus        68 ------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~e-------~~l~~~~~~C~~C~  110 (139)
                                                    +++.+.++.++.||+|+++||||||+.+.       |.++.++++|++|+
T Consensus       147 i~C~rCvr~c~ev~g~~~l~~~~rg~~~~i~~~~~~~~~~~~cg~cv~~CP~GAl~~k~~~~~~r~w~~~~~~t~C~~C~  226 (776)
T PRK09129        147 IHCTRCVRFGQEIAGVMELGMMGRGEHSEITTYVGKTVDSELSGNMIDLCPVGALTSKPFRYSARTWELSRRKSVSPHDS  226 (776)
T ss_pred             ccCcHHHHHHHHhcCCceeeeeccCCCCEEcCCCCCCccCcccCCchhhCCccccccccccccCCCcccccCCccCCCCC
Confidence                                          12234456788999999999999998764       66777889999999


Q ss_pred             CCCcchhHH
Q psy3842         111 QGGECDLQD  119 (139)
Q Consensus       111 ~g~~~eL~~  119 (139)
                      .||...++.
T Consensus       227 ~gC~i~v~v  235 (776)
T PRK09129        227 LGSNLVVHV  235 (776)
T ss_pred             CCCCeEEEE
Confidence            999887754


No 6  
>PRK08166 NADH dehydrogenase subunit G; Validated
Probab=99.95  E-value=1.5e-28  Score=214.96  Aligned_cols=119  Identities=26%  Similarity=0.484  Sum_probs=99.4

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccccc-------------ccCCCcc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI-------------DFSGKRW   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~-------------~~~~~r~   67 (139)
                      ++||+|.|+||+++++||.+|||||+|||+||++|+++|+|+||+++++||+...+|...             .++.+||
T Consensus        72 ~~gm~v~t~~~~~~~~r~~~~e~ll~~hp~dc~~c~~~g~c~lq~~~~~~g~~~~~~~~~~~~~~~~~~~~~i~~d~~rC  151 (847)
T PRK08166         72 TDGTFISIDDPEAKAFRASVVEWLMTNHPHDCPVCEEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRC  151 (847)
T ss_pred             CCCCEEEeCCHHHHHHHHHHHHHHHhcCCCCCCccCCCCCchHHHHHHHhCCCCccCCCcCccccccCCCCceEecCCcC
Confidence            489999999999999999999999999999999999999999999999999988887431             0123333


Q ss_pred             ------------------------------ccccccceeecccCceecccCCcccccc--------eeeeccccccCCCC
Q psy3842          68 ------------------------------GYLREKLFLSELSGKRESTCAPAREGVM--------EFLLVNHPLDCPIC  109 (139)
Q Consensus        68 ------------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~--------e~~l~~~~~~C~~C  109 (139)
                                                    +++.+++..|++||+|+++||||||+.+        .|.++.++++|++|
T Consensus       152 i~C~rCVr~c~e~~g~~~l~~~~~~~~~~~~~~~~~~~~~~~~G~cv~vCP~GAl~~k~~~~~~~r~w~l~~~~s~C~~C  231 (847)
T PRK08166        152 IACYRCVRYYKDYAGGTDLGVYGAHDNVYFGRPEDGTLESEFSGNLVEVCPTGVFTDKTHSERYNRKWDMQFAPSICQHC  231 (847)
T ss_pred             ccccHHHHHHHhhcCcceEEEeecCceeEecCCCCCcccChhhCChHhhCCchhccccccccccCCCceeeEEEeeCCCC
Confidence                                          1223456688999999999999999754        46666788999999


Q ss_pred             CCCCcchhHH
Q psy3842         110 DQGGECDLQD  119 (139)
Q Consensus       110 ~~g~~~eL~~  119 (139)
                      +.||+..++.
T Consensus       232 ~~gC~i~v~~  241 (847)
T PRK08166        232 SVGCNISPGE  241 (847)
T ss_pred             cCCCCeEEEe
Confidence            9999988754


No 7  
>PRK08493 NADH dehydrogenase subunit G; Validated
Probab=99.95  E-value=2e-28  Score=212.17  Aligned_cols=119  Identities=24%  Similarity=0.468  Sum_probs=98.5

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccccc------------ccCCCcc-
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI------------DFSGKRW-   67 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~------------~~~~~r~-   67 (139)
                      +|||+|.|+||++++.||.+||+|+++||++|++|+++|+|+||+++++||+.+++|...            .++..|| 
T Consensus        65 ~dGM~V~T~s~~v~~~Rk~vle~ll~~HpldC~~Cd~~geCeLQ~~a~~~gv~~~~~~~~~~~~~~~~~~~I~~D~~rCI  144 (819)
T PRK08493         65 KEGMNILTNTPNLMDERNAIMQTYDVNHPLECGVCDKSGECELQNFTHEMGVNHQPYAIKDTHKPHKHWGKINYDPSLCI  144 (819)
T ss_pred             CCCCEEEecCHHHHHHHHHHHHHHHhccCCCCCcCCCCCCcHHHHHHHHhCCCCCcCccccccccccCCCcEEechhhcc
Confidence            589999999999999999999999999999999999999999999999999998877421            1122222 


Q ss_pred             -----------------------c------cccc-----------------------cceeecccCceecccCCcccccc
Q psy3842          68 -----------------------G------YLRE-----------------------KLFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        68 -----------------------~------t~~~-----------------------~~~~~~~~g~~~~~CPtgal~~~   95 (139)
                                             |      ++++                       ....|++||+|+++||||||+.+
T Consensus       145 ~C~RCVr~C~ev~g~~al~~~~RG~~~~~~~~~~~~~~da~~~~~~~~~~~i~~~~~~~~~C~~CG~Cv~VCPvGAL~~k  224 (819)
T PRK08493        145 VCERCVTVCKDKIGESALKTVPRGLDAPDKSFKESMPKDAYAVWSKKQKSLIGPVGGETLDCSFCGECIAVCPVGALSSS  224 (819)
T ss_pred             cccHHHhhCcccccchhhhhccCCcccccccccccccccchhhhhhcccceecccCCCcccccccCcHHHhCCCCccccC
Confidence                                   1      0111                       13579999999999999999765


Q ss_pred             -------eeeeccccccCCCCCCCCcchhHH
Q psy3842          96 -------EFLLVNHPLDCPICDQGGECDLQD  119 (139)
Q Consensus        96 -------e~~l~~~~~~C~~C~~g~~~eL~~  119 (139)
                             .|.++..+++|++|++||+..++.
T Consensus       225 ~~~~~~~~wel~~v~TvCp~CsvGC~l~v~v  255 (819)
T PRK08493        225 DFQYTSNAWELKKIPATCPHCSDCCLIYYDV  255 (819)
T ss_pred             ccccccCccccccccCcCCCCccCCCeEEEc
Confidence                   466788999999999999998864


No 8  
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional
Probab=99.92  E-value=3.9e-25  Score=171.09  Aligned_cols=58  Identities=48%  Similarity=0.978  Sum_probs=55.8

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFT   58 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~   58 (139)
                      +|||+|+|+||+|+++||.+|||||++||+||++|+++|+|+||+++++||+...+|.
T Consensus       135 ~eGM~V~T~Se~v~~~Rk~vLElLLs~Hp~DC~~C~k~G~CeLQdla~~~Gv~~~Rf~  192 (297)
T PTZ00305        135 LPGMSIITDSRLVRDAREGNVELILINHPNDCPICEQATNCDLQNVSMNYGTDIPRYK  192 (297)
T ss_pred             CCCCEEEeCCHHHHHHHHHHHHHHHhcCCCcCCcccCcCCcHHHHHHHHhCCCCccCC
Confidence            5899999999999999999999999999999999999999999999999999888874


No 9  
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]
Probab=99.91  E-value=6.1e-25  Score=185.56  Aligned_cols=122  Identities=25%  Similarity=0.434  Sum_probs=97.6

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCC-CcchhHHHHHHhCCCCccccccc---------------cCC
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQG-GECDLQDQSMAFGSDRSRFTDID---------------FSG   64 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~-g~C~Lq~l~~~~g~~~~r~~~~~---------------~~~   64 (139)
                      ++||+|+|+|++++++|+.+|++||++|+++|++|+.+ |+|+||+++..+|+.+++|....               |+.
T Consensus        69 ~dGm~v~t~s~rvk~~r~~~md~~l~nH~LyC~vCd~nnGdCelh~~~~~~gl~~q~y~y~~k~~~~~~Des~Pfy~ydp  148 (978)
T COG3383          69 EDGMVVRTNSERVKEARREAMDRILSNHPLYCTVCDNNNGDCELHNMVMALGLTEQRYPYEEKNPPYPKDESNPFYIYDP  148 (978)
T ss_pred             cCCcEEecccHHHHHHHHHHHHHHHhcCCcCccccCCCCCCchHHHHHHHhCCCccccCccccCCCCCcccCCCeEEecc
Confidence            58999999999999999999999999999999999988 99999999999999988764211               233


Q ss_pred             Ccc--------------ccc-------------c---c---cceeecccCceecccCCcccccceee-------------
Q psy3842          65 KRW--------------GYL-------------R---E---KLFLSELSGKRESTCAPAREGVMEFL-------------   98 (139)
Q Consensus        65 ~r~--------------~t~-------------~---~---~~~~~~~~g~~~~~CPtgal~~~e~~-------------   98 (139)
                      .+|              ++.             +   +   .-..|++||.|+.|||++||+.+.++             
T Consensus       149 ~qCIlCgRCVeaCqevqv~eaL~i~w~~~~pRV~wd~~~~i~~SSCVsCG~CvtVCP~nALmek~m~g~ag~~t~~~~~~  228 (978)
T COG3383         149 NQCILCGRCVEACQEVQVNEALTIDWRGEDPRVIWDNDVPINESSCVSCGACVTVCPVNALMEKSMLGEAGYLTGINEDT  228 (978)
T ss_pred             hheeehhHHHHHHHhhhceeEEEeecccCCcceecCCCCccccccccccCccceecchhhhhhhhhhccccccccccchh
Confidence            322              111             1   1   12378999999999999999866543             


Q ss_pred             --------------------------------eccccccCCCCCCCCcchhHHHHH
Q psy3842          99 --------------------------------LVNHPLDCPICDQGGECDLQDQSM  122 (139)
Q Consensus        99 --------------------------------l~~~~~~C~~C~~g~~~eL~~~~~  122 (139)
                                                      ++...++|+||++||+.+++....
T Consensus       229 ~~~mid~~k~~eP~~~~~~ais~~e~~mr~~rikktkTvC~yCGvGCsf~vwtkgr  284 (978)
T COG3383         229 LEPMIDLVKKVEPEYGPIFAISEIEAAMRETRIKKTKTVCTYCGVGCSFEVWTKGR  284 (978)
T ss_pred             hhhhhhhhhccCCCcccchhhhhhhhhhhhhhhcccceeccccCCceeEEEEecCc
Confidence                                            234567999999999999977554


No 10 
>KOG2282|consensus
Probab=99.90  E-value=9.7e-25  Score=178.09  Aligned_cols=133  Identities=52%  Similarity=0.835  Sum_probs=104.1

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccccccc------------------
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDF------------------   62 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~------------------   62 (139)
                      ..||.|.|||+.++++|.++|||||.|||+|||.|++.|+|+|||.+..+|.++.||.+...                  
T Consensus        98 m~g~~iktns~~~kkaregvmefll~nhpldcpicdqggecdlqdq~m~fgsdr~rf~~~kravedknigplvktimtrc  177 (708)
T KOG2282|consen   98 MKGWKIKTNSDKSKKAREGVMEFLLMNHPLDCPICDQGGECDLQDQAMAFGSDRSRFTEGKRAVEDKNIGPLVKTIMTRC  177 (708)
T ss_pred             cCCceeecCchHHHHHHHHHHHHHHhCCCCCCCccCCCCcCcchHhHhhhcCchhhhhhhhhhhhcCccchHHHHHHHHH
Confidence            36999999999999999999999999999999999999999999999999999999965310                  


Q ss_pred             -CCCcc------------------------ccccccceeecccCceecccCCcccccceeeeccccc-------cCCCCC
Q psy3842          63 -SGKRW------------------------GYLREKLFLSELSGKRESTCAPAREGVMEFLLVNHPL-------DCPICD  110 (139)
Q Consensus        63 -~~~r~------------------------~t~~~~~~~~~~~g~~~~~CPtgal~~~e~~l~~~~~-------~C~~C~  110 (139)
                       ...||                        |||++.++.++.+|+.+++||+|||+++.+-+...|+       .=..-.
T Consensus       178 iqctrcvrfaseiagv~dlgttgrg~d~qigtyvek~f~selsgniidicpvgaltskpyaf~arpwe~rktesidv~da  257 (708)
T KOG2282|consen  178 IQCTRCVRFASEIAGVDDLGTTGRGNDMQIGTYVEKLFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDA  257 (708)
T ss_pred             HhHHHHHHHHHhhcCCcccccccCCCcchHHHHHHHHHHHhhcCCeeeeccccccccCcceeeccccccccccceehhhh
Confidence             00111                        7889999999999999999999999987765544443       223344


Q ss_pred             CCCcchh---------------HHHHHHhCCCCCCCCC
Q psy3842         111 QGGECDL---------------QDQSMAFGSDRSRFTD  133 (139)
Q Consensus       111 ~g~~~eL---------------~~~~~~~gv~~~rf~~  133 (139)
                      +|.+..+               .+...+|..+.+||.+
T Consensus       258 vgsnivvs~rt~ev~ri~pr~nedineewi~dksrfa~  295 (708)
T KOG2282|consen  258 VGSNIVVSTRTGEVLRILPRMNEDINEEWISDKSRFAY  295 (708)
T ss_pred             ccCcEEEecCCccceeeccccccccchhhhcccceeee
Confidence            5554443               2244567777778754


No 11 
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated
Probab=99.84  E-value=3.2e-21  Score=146.85  Aligned_cols=58  Identities=31%  Similarity=0.604  Sum_probs=54.9

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCcccc
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFT   58 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~   58 (139)
                      ++||+|.|+|++++++||.+|++|+++||++|++|+++|+|+||+++.+||+...+|.
T Consensus        69 ~~Gm~v~t~~~~~~~~rk~~l~~ll~~h~~~C~~C~~~g~C~Lq~~a~~~g~~~~~~~  126 (234)
T PRK07569         69 AEGMVVQTNTPRLQEYRRMIVELLFAEGNHVCAVCVANGNCELQDLAIEVGMDHVRFP  126 (234)
T ss_pred             CCCCEEEECCHHHHHHHHHHHHHHHHhccccCcccCCCCCcHHHHHHHHhCCCCcccC
Confidence            5899999999999999999999999999999999999999999999999999876653


No 12 
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=99.72  E-value=3.8e-18  Score=96.61  Aligned_cols=41  Identities=56%  Similarity=1.191  Sum_probs=27.7

Q ss_pred             HHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccc
Q psy3842          17 REGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRF   57 (139)
Q Consensus        17 r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~   57 (139)
                      ||.+|||||++||++|++|+++|+|+||++++++|+...+|
T Consensus         1 Rr~~lelll~~H~~dC~~C~~~G~CeLQ~~~~~~gv~~~~f   41 (41)
T PF10588_consen    1 RRTVLELLLANHPLDCPTCDKNGNCELQDLAYEYGVDEQRF   41 (41)
T ss_dssp             -HHHHHHHHTT----TTT-TTGGG-HHHHHHHHH-S-----
T ss_pred             CHHHHHHHHhCCCCcCcCCCCCCCCHHHHHHHHhCCCcCCC
Confidence            89999999999999999999999999999999999988775


No 13 
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=99.07  E-value=2.1e-11  Score=68.89  Aligned_cols=40  Identities=55%  Similarity=1.182  Sum_probs=26.2

Q ss_pred             cccceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCC
Q psy3842          92 EGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRF  131 (139)
Q Consensus        92 l~~~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf  131 (139)
                      +++++++|++||..|+.|+++++|+||+++.++|++..||
T Consensus         2 r~~lelll~~H~~dC~~C~~~G~CeLQ~~~~~~gv~~~~f   41 (41)
T PF10588_consen    2 RTVLELLLANHPLDCPTCDKNGNCELQDLAYEYGVDEQRF   41 (41)
T ss_dssp             HHHHHHHHTT----TTT-TTGGG-HHHHHHHHH-S-----
T ss_pred             HHHHHHHHhCCCCcCcCCCCCCCCHHHHHHHHhCCCcCCC
Confidence            4578899999999999999999999999999999998887


No 14 
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]
Probab=99.05  E-value=2.8e-11  Score=103.95  Aligned_cols=89  Identities=40%  Similarity=0.759  Sum_probs=77.3

Q ss_pred             CcchhHHHHHHhCCCCccccccccCCCc-----cccc-cccceeecccCceecccCCcccccceeeeccccccCCCCCCC
Q psy3842          39 GECDLQDQSMAFGSDRSRFTDIDFSGKR-----WGYL-REKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQG  112 (139)
Q Consensus        39 g~C~Lq~l~~~~g~~~~r~~~~~~~~~r-----~~t~-~~~~~~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~~g  112 (139)
                      -.|+|.++. .+|.|+.|++++  ++.+     |.|. .++|.+.+.+.+...    .+..++||+|.+||.+||.|..|
T Consensus        32 ~fCyh~~ls-~~GaCRmClVEv--eg~~k~~~SC~tpv~dGM~I~T~s~~vk~----~R~~vmE~LLiNHPlDCpiCD~g  104 (693)
T COG1034          32 TFCYHPRLS-IAGACRMCLVEV--EGAPKLVASCATPVTDGMVISTNSEEVKK----AREGVMEFLLINHPLDCPVCDKG  104 (693)
T ss_pred             cccccCCCC-cccceeEEEEEe--cCCCccccccccccCCCeEEecCCHHHHH----HHHHHHHHHHhcCCCCCCccCCC
Confidence            368999988 889999999988  4532     1333 479999999999998    88999999999999999999999


Q ss_pred             CcchhHHHHHHhCCCCCCCCCC
Q psy3842         113 GECDLQDQSMAFGSDRSRFTDI  134 (139)
Q Consensus       113 ~~~eL~~~~~~~gv~~~rf~~~  134 (139)
                      |+|+||++++.+|++.+||.+.
T Consensus       105 GeCeLQD~a~~~G~~~sr~~~~  126 (693)
T COG1034         105 GECELQDLAVKYGVSHSRYRET  126 (693)
T ss_pred             CCchhHHHHHHhCCCccccccc
Confidence            9999999999999999998654


No 15 
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional
Probab=99.01  E-value=6.1e-11  Score=92.38  Aligned_cols=89  Identities=34%  Similarity=0.564  Sum_probs=76.4

Q ss_pred             CcchhHHHHHHhCCCCccccccccCCCcc-----ccc-cccceeecccCceecccCCcccccceeeeccccccCCCCCCC
Q psy3842          39 GECDLQDQSMAFGSDRSRFTDIDFSGKRW-----GYL-REKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQG  112 (139)
Q Consensus        39 g~C~Lq~l~~~~g~~~~r~~~~~~~~~r~-----~t~-~~~~~~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~~g  112 (139)
                      ..|++.++. .+|.++.|++++  +|.+.     .|. .++|.+.|.+.+...    .++..++++|++||.+|+.|.++
T Consensus       100 tLCy~~~L~-p~G~CRlClVEV--eG~~~lv~AC~tpV~eGM~V~T~Se~v~~----~Rk~vLElLLs~Hp~DC~~C~k~  172 (297)
T PTZ00305        100 KFCYHPILS-VAGNCRMCLVQV--DGTQNLVVSCATVALPGMSIITDSRLVRD----AREGNVELILINHPNDCPICEQA  172 (297)
T ss_pred             ccccCCCCC-CCCccceeEEEE--CCCcCcccccCCcCCCCCEEEeCCHHHHH----HHHHHHHHHHhcCCCcCCcccCc
Confidence            467887776 689999999887  45532     333 579999999999999    88999999999999999999999


Q ss_pred             CcchhHHHHHHhCCCCCCCCCC
Q psy3842         113 GECDLQDQSMAFGSDRSRFTDI  134 (139)
Q Consensus       113 ~~~eL~~~~~~~gv~~~rf~~~  134 (139)
                      ++|+||+++.++|++..||+..
T Consensus       173 G~CeLQdla~~~Gv~~~Rf~~~  194 (297)
T PTZ00305        173 TNCDLQNVSMNYGTDIPRYKED  194 (297)
T ss_pred             CCcHHHHHHHHhCCCCccCCcc
Confidence            9999999999999999898653


No 16 
>PRK09130 NADH dehydrogenase subunit G; Validated
Probab=98.87  E-value=4.9e-10  Score=96.94  Aligned_cols=88  Identities=48%  Similarity=0.804  Sum_probs=75.8

Q ss_pred             cchhHHHHHHhCCCCccccccccCCC-c-----cccc-cccceeecccCceecccCCcccccceeeeccccccCCCCCCC
Q psy3842          40 ECDLQDQSMAFGSDRSRFTDIDFSGK-R-----WGYL-REKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQG  112 (139)
Q Consensus        40 ~C~Lq~l~~~~g~~~~r~~~~~~~~~-r-----~~t~-~~~~~~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~~g  112 (139)
                      .|++.+|. ..|.|+.|++++  ++. +     |.|. .++|.+.|.+.++..    .+..++|++|.+||.+|+.|..+
T Consensus        33 lCy~~~l~-~~g~Cr~ClVev--~~~~~~~~~sC~~~v~~gm~v~T~s~~v~~----~r~~~le~ll~~Hp~dC~~C~~~  105 (687)
T PRK09130         33 FCYHERLS-IAGNCRMCLVEV--KGGPPKPVASCAMPVGEGMVIFTNTPMVKK----AREGVMEFLLINHPLDCPICDQG  105 (687)
T ss_pred             ccCCCCCC-CCCCCCCCEEEE--CCCCCCcccccCCCCCCCCEEEeCCHHHHH----HHHHHHHHHHhcCCCCCCCCCCC
Confidence            67888876 679999999887  343 2     1333 579999999999999    88999999999999999999999


Q ss_pred             CcchhHHHHHHhCCCCCCCCCC
Q psy3842         113 GECDLQDQSMAFGSDRSRFTDI  134 (139)
Q Consensus       113 ~~~eL~~~~~~~gv~~~rf~~~  134 (139)
                      ++|+||++++.||++..||.+.
T Consensus       106 g~C~Lq~~~~~~g~~~~r~~~~  127 (687)
T PRK09130        106 GECDLQDQAMAYGVDTSRYHEN  127 (687)
T ss_pred             CCCHHHHHHHHhCCCCCCCCcc
Confidence            9999999999999999999754


No 17 
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G. This model represents the G subunit (one of 14: A-N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes related subunits from formate dehydrogenase complexes.
Probab=98.73  E-value=5.2e-09  Score=89.34  Aligned_cols=103  Identities=45%  Similarity=0.662  Sum_probs=82.2

Q ss_pred             HHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCCc--c----ccc-cccceeecccCceecccCCcc
Q psy3842          19 GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKR--W----GYL-REKLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        19 ~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~r--~----~t~-~~~~~~~~~~g~~~~~CPtga   91 (139)
                      .+|+.++...-.      -...|++.++. ..|.|+.|++++  +|.+  -    .|. .++|.+.|.+.+...    .+
T Consensus        15 ~il~a~~~~gi~------ip~~C~~~~l~-~~g~Cr~C~v~v--~g~~~~~~~aC~~~~~~gm~v~t~~~~~~~----~r   81 (603)
T TIGR01973        15 TVLQACLSAGIE------IPRFCYHEKLS-IAGNCRMCLVEV--EKFPDKPVASCATPVTDGMKISTNSEKVKK----AR   81 (603)
T ss_pred             HHHHHHHHcCCC------ccccCCCCCCC-CCCccccCEEEE--CCCCCCcccccCCCCCCCCEEEeCCHHHHH----HH
Confidence            466666664321      12367887776 589999999887  3431  1    333 479999999999988    88


Q ss_pred             cccceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCCCCC
Q psy3842          92 EGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI  134 (139)
Q Consensus        92 l~~~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf~~~  134 (139)
                      +.+++++|.+||.+|+.|..+++|+||+++..||++..||.+.
T Consensus        82 ~~~~e~ll~~h~~dC~~C~~~g~C~Lq~~~~~~g~~~~~~~~~  124 (603)
T TIGR01973        82 EGVMEFLLINHPLDCPICDQGGECDLQDQAVMYGSDRSRFREK  124 (603)
T ss_pred             HHHHHHHHhcCCCCCCcCCCCCCChHHHHHHHhCCCCCCCCcc
Confidence            9999999999999999999999999999999999999998753


No 18 
>PRK09129 NADH dehydrogenase subunit G; Validated
Probab=98.69  E-value=7.1e-09  Score=90.75  Aligned_cols=103  Identities=35%  Similarity=0.529  Sum_probs=81.0

Q ss_pred             HHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCCc-----ccc-ccccceeecccCceecccCCccc
Q psy3842          19 GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKR-----WGY-LREKLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        19 ~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~r-----~~t-~~~~~~~~~~~g~~~~~CPtgal   92 (139)
                      .+|+.+...+-.-      ...|+..++. ..|.|+.|.+++  +|.+     |.| ..++|.+.+.+.+..+    .++
T Consensus        18 ~il~a~~~~g~~i------p~~c~~~~~~-~~~~C~~C~v~v--~~~~~~~~aC~~~~~~gm~v~t~~~~~~~----~r~   84 (776)
T PRK09129         18 MVIEAADKAGIYI------PRFCYHKKLS-IAANCRMCLVEV--EKAPKPLPACATPVTDGMKVFTRSEKALK----AQK   84 (776)
T ss_pred             HHHHHHHHcCCCC------CcccCCCCCC-CCCCcceeEEEE--CCCCCcCcccCCCCCCCCEEEcCCHHHHH----HHH
Confidence            4666666654221      1356666654 678899999887  3432     123 3579999999999999    889


Q ss_pred             ccceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCCCCC
Q psy3842          93 GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI  134 (139)
Q Consensus        93 ~~~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf~~~  134 (139)
                      .+++++|++||.+|+.|..+++|+||+++.+||++..||.+.
T Consensus        85 ~~l~~ll~~h~~~C~~c~~~g~C~Lq~~a~~~g~~~~~~~~~  126 (776)
T PRK09129         85 SVMEFLLINHPLDCPICDQGGECQLQDLAVGYGRSTSRYTEE  126 (776)
T ss_pred             HHHHHHHhcCCCCcccCCCCCCCHHHHHHHHhCCCCCccccc
Confidence            999999999999999999999999999999999999998653


No 19 
>PRK08764 ferredoxin; Provisional
Probab=98.64  E-value=6.9e-08  Score=67.89  Aligned_cols=71  Identities=10%  Similarity=-0.017  Sum_probs=50.7

Q ss_pred             HHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCCcccccc--ccceeecccCceecccCCccccc
Q psy3842          22 EFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRWGYLR--EKLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        22 elll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~r~~t~~--~~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...+++|.++|..|+++|+|+||++++.+|+...+|...  .+.+....+  -.-..|+.|+.|+.+||++++..
T Consensus        32 a~~~v~g~~~~~~C~~~G~c~lq~~a~~~gv~~~~~~~~--~~~~~~~~~~~~~~~~Ci~C~~Cv~aCp~~ai~~  104 (135)
T PRK08764         32 AQAMARGEATIDRCPPGGDAGARALAQVLGVPARPYDRS--RGTHKLPQVAWIVEADCIGCTKCIQACPVDAIVG  104 (135)
T ss_pred             HHHHHcCCCCCCCCCCCCHHHHHHHHHHhCCCccccccc--cCCCCCCeeEEECcccCcCcchHHHhCChhhcCc
Confidence            345569999999999999999999999999987665432  111110100  01136789999999999998754


No 20 
>PRK07860 NADH dehydrogenase subunit G; Validated
Probab=98.61  E-value=8.8e-09  Score=90.53  Aligned_cols=87  Identities=43%  Similarity=0.786  Sum_probs=72.7

Q ss_pred             cchhHHHHHHhCCCCccccccccCCCc-----cccc-cccceeecc--cCceecccCCcccccceeeeccccccCCCCCC
Q psy3842          40 ECDLQDQSMAFGSDRSRFTDIDFSGKR-----WGYL-REKLFLSEL--SGKRESTCAPAREGVMEFLLVNHPLDCPICDQ  111 (139)
Q Consensus        40 ~C~Lq~l~~~~g~~~~r~~~~~~~~~r-----~~t~-~~~~~~~~~--~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~~  111 (139)
                      .|++.++. ..|.|+.|.+++  +|.+     |.|. .++|.+.+.  +.+..+    .++.+++++|.+||.+|+.|..
T Consensus        36 ~C~~~~l~-~~g~Cr~C~Vev--~g~~~~~~aC~t~v~~gm~V~t~~~s~~v~~----~r~~~le~ll~~hp~dC~~C~~  108 (797)
T PRK07860         36 FCDHPLLD-PVGACRQCLVEV--EGQRKPQASCTTTVTDGMVVKTQLTSPVADK----AQHGVMELLLINHPLDCPVCDK  108 (797)
T ss_pred             ecCCCCCC-CCcccCccEEEE--CCCcccccccCCCCCCCcEEEeCCCCHHHHH----HHHHHHHHHHhcCCCCCCCCCC
Confidence            57776665 689999999887  4432     1233 579999887  788888    8899999999999999999999


Q ss_pred             CCcchhHHHHHHhCCCCCCCCC
Q psy3842         112 GGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus       112 g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      +++|+||+++..+|+...||.+
T Consensus       109 ~g~C~Lq~~~~~~g~~~~~~~~  130 (797)
T PRK07860        109 GGECPLQNQAMSNGRAESRFTD  130 (797)
T ss_pred             CCCcHHHHHHHHhCCCCccCcc
Confidence            9999999999999999888864


No 21 
>KOG2282|consensus
Probab=98.52  E-value=2.6e-08  Score=82.66  Aligned_cols=58  Identities=74%  Similarity=1.234  Sum_probs=48.0

Q ss_pred             ccceeecccCceecccCCcccccceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCCCC
Q psy3842          72 EKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      .+|.+-|.+.....    .+..++||+|.+||.+||.|..|+.|.||++++.||.+++||.+
T Consensus        99 ~g~~iktns~~~kk----aregvmefll~nhpldcpicdqggecdlqdq~m~fgsdr~rf~~  156 (708)
T KOG2282|consen   99 KGWKIKTNSDKSKK----AREGVMEFLLMNHPLDCPICDQGGECDLQDQAMAFGSDRSRFTE  156 (708)
T ss_pred             CCceeecCchHHHH----HHHHHHHHHHhCCCCCCCccCCCCcCcchHhHhhhcCchhhhhh
Confidence            34555565554444    45578899999999999999999999999999999999999964


No 22 
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated
Probab=98.49  E-value=6.2e-08  Score=73.88  Aligned_cols=102  Identities=24%  Similarity=0.402  Sum_probs=75.2

Q ss_pred             HHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCCcc-----ccc-cccceeecccCceecccCCccc
Q psy3842          19 GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRW-----GYL-REKLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        19 ~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~r~-----~t~-~~~~~~~~~~g~~~~~CPtgal   92 (139)
                      .+|+.++... ..-|     ..|.+.++. ..|.+..+.+++  +|++.     .|. .++|.+.+...+...    -+.
T Consensus        20 til~a~~~~g-i~ip-----~~C~~~~~~-~~G~C~~C~V~v--~g~~~~~~aC~t~v~~Gm~v~t~~~~~~~----~rk   86 (234)
T PRK07569         20 TLLEAAREAG-IPIP-----TLCHLDGLS-DVGACRLCLVEI--EGSNKLLPACVTPVAEGMVVQTNTPRLQE----YRR   86 (234)
T ss_pred             HHHHHHHHcC-CCCC-----cCcCCCCCC-CCCccCCcEEEE--CCCCccccCcCCCCCCCCEEEECCHHHHH----HHH
Confidence            4666666543 1111     124444443 567788888776  45421     233 479999999888888    788


Q ss_pred             ccceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCCCC
Q psy3842          93 GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus        93 ~~~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      ..+++++++||.+|+.|+.+++|+||+++.++|+...+|.+
T Consensus        87 ~~l~~ll~~h~~~C~~C~~~g~C~Lq~~a~~~g~~~~~~~~  127 (234)
T PRK07569         87 MIVELLFAEGNHVCAVCVANGNCELQDLAIEVGMDHVRFPY  127 (234)
T ss_pred             HHHHHHHHhccccCcccCCCCCcHHHHHHHHhCCCCcccCc
Confidence            89999999999999999999999999999999998777753


No 23 
>PRK08493 NADH dehydrogenase subunit G; Validated
Probab=98.47  E-value=6.2e-08  Score=85.20  Aligned_cols=102  Identities=25%  Similarity=0.387  Sum_probs=79.3

Q ss_pred             HHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCCcc---ccc-cccceeecccCceecccCCccccc
Q psy3842          19 GVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKRW---GYL-REKLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        19 ~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~r~---~t~-~~~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      .+|+.+..+.-..      ...|++.++. ..|.|+.|.+++  +|++.   .|. .++|.+.+.+.+...    .++.+
T Consensus        18 til~aa~~~gi~i------P~lC~~~~~~-~~G~Cr~C~VeV--~G~~~~AC~t~v~dGM~V~T~s~~v~~----~Rk~v   84 (819)
T PRK08493         18 YILNVARRNGIFI------PAICYLSGCS-PTLACRLCMVEA--DGKRVYSCNTKAKEGMNILTNTPNLMD----ERNAI   84 (819)
T ss_pred             HHHHHHHHcCCcc------ccccccCCCC-CCccccceEEEE--CCEEeccccCCCCCCCEEEecCHHHHH----HHHHH
Confidence            4666665543221      1346555554 578899999887  56532   333 579999999999988    78999


Q ss_pred             ceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCCCC
Q psy3842          95 MEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus        95 ~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      +++++.+||..|++|..+++|+||+++.++|++..||..
T Consensus        85 le~ll~~HpldC~~Cd~~geCeLQ~~a~~~gv~~~~~~~  123 (819)
T PRK08493         85 MQTYDVNHPLECGVCDKSGECELQNFTHEMGVNHQPYAI  123 (819)
T ss_pred             HHHHHhccCCCCCcCCCCCCcHHHHHHHHhCCCCCcCcc
Confidence            999999999999999999999999999999999988864


No 24 
>PRK08166 NADH dehydrogenase subunit G; Validated
Probab=98.38  E-value=1.6e-07  Score=83.14  Aligned_cols=89  Identities=27%  Similarity=0.461  Sum_probs=68.3

Q ss_pred             cchhHHHHHHhCCCCccccccc---cCCCc-----ccc-ccccceeecccCceecccCCcccccceeeeccccccCCCCC
Q psy3842          40 ECDLQDQSMAFGSDRSRFTDID---FSGKR-----WGY-LREKLFLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICD  110 (139)
Q Consensus        40 ~C~Lq~l~~~~g~~~~r~~~~~---~~~~r-----~~t-~~~~~~~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~  110 (139)
                      .|+..++. ..|.|+.|.+++.   .++..     |.+ ..++|.+.+.+.+...    .+..++||+|.+||.+|+.|.
T Consensus        33 ~C~~~~~~-~~G~C~~C~v~v~~g~~~~~~~~~~aC~~~v~~gm~v~t~~~~~~~----~r~~~~e~ll~~hp~dc~~c~  107 (847)
T PRK08166         33 FCWHPALG-SVGACRQCAVKQYQNPEDTRGRLVMSCMTPATDGTFISIDDPEAKA----FRASVVEWLMTNHPHDCPVCE  107 (847)
T ss_pred             cccCCCCC-CCCccCCCeEEEeecCccCCCCcccCcCCCCCCCCEEEeCCHHHHH----HHHHHHHHHHhcCCCCCCccC
Confidence            35555554 5788888877651   11111     122 2468988888887777    778899999999999999999


Q ss_pred             CCCcchhHHHHHHhCCCCCCCCC
Q psy3842         111 QGGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus       111 ~g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      .+++|+||+++.++|+...||.+
T Consensus       108 ~~g~c~lq~~~~~~g~~~~~~~~  130 (847)
T PRK08166        108 EGGNCHLQDMTVMTGHSFRRYRF  130 (847)
T ss_pred             CCCCchHHHHHHHhCCCCccCCC
Confidence            99999999999999999888864


No 25 
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]
Probab=98.27  E-value=2.9e-07  Score=79.46  Aligned_cols=101  Identities=28%  Similarity=0.512  Sum_probs=81.1

Q ss_pred             HHHHHHHHHh---CCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCC--c-cccc-cccceeecccCceecccCCc
Q psy3842          18 EGVMEFLLVN---HPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGK--R-WGYL-REKLFLSELSGKRESTCAPA   90 (139)
Q Consensus        18 ~~~lelll~~---h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~--r-~~t~-~~~~~~~~~~g~~~~~CPtg   90 (139)
                      ..||+.++.+   +|+         .|+-..+- .++.|+.|++++  +|+  | |.|. .++|.+.+.+.+..+    .
T Consensus        21 ~tiL~a~~~~gI~iP~---------iCy~~~l~-pi~sCd~ClVEi--dG~l~rsCsT~v~dGm~v~t~s~rvk~----~   84 (978)
T COG3383          21 TTILRAANRNGIEIPH---------ICYHESLG-PIGSCDTCLVEI--DGKLVRSCSTPVEDGMVVRTNSERVKE----A   84 (978)
T ss_pred             hHHHHHHHhcCCcccc---------eeccCCCC-cccccceEEEEe--cCceeccccccccCCcEEecccHHHHH----H
Confidence            4577777775   554         35554444 778888999887  564  2 2444 469999999999988    8


Q ss_pred             ccccceeeeccccccCCCCCCC-CcchhHHHHHHhCCCCCCCCCC
Q psy3842          91 REGVMEFLLVNHPLDCPICDQG-GECDLQDQSMAFGSDRSRFTDI  134 (139)
Q Consensus        91 al~~~e~~l~~~~~~C~~C~~g-~~~eL~~~~~~~gv~~~rf~~~  134 (139)
                      ++.+++++|++|+..|+.|..+ |+|+||+++..+|+...||++.
T Consensus        85 r~~~md~~l~nH~LyC~vCd~nnGdCelh~~~~~~gl~~q~y~y~  129 (978)
T COG3383          85 RREAMDRILSNHPLYCTVCDNNNGDCELHNMVMALGLTEQRYPYE  129 (978)
T ss_pred             HHHHHHHHHhcCCcCccccCCCCCCchHHHHHHHhCCCccccCcc
Confidence            8899999999999999999998 9999999999999999887654


No 26 
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional
Probab=98.03  E-value=6.8e-06  Score=71.01  Aligned_cols=33  Identities=24%  Similarity=0.328  Sum_probs=32.0

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCC
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCP   33 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~~C~   33 (139)
                      +|||+|.|+||++.++|+.+||+||++|+.+|.
T Consensus        69 ~~Gm~v~t~~~~~~~~r~~~le~l~~~~c~~C~  101 (652)
T PRK12814         69 SEGMVIETENAELHAMRRQSLERLIEQHCGDCL  101 (652)
T ss_pred             CCCCEEEeCcHHHHHHHHHHHHHHHhhcccccC
Confidence            589999999999999999999999999999997


No 27 
>PRK05113 electron transport complex protein RnfB; Provisional
Probab=97.89  E-value=8.1e-06  Score=60.60  Aligned_cols=27  Identities=19%  Similarity=0.409  Sum_probs=23.0

Q ss_pred             CCCCcCCCCcchhHHHHHHhCCCCccc
Q psy3842          31 DCPICDQGGECDLQDQSMAFGSDRSRF   57 (139)
Q Consensus        31 ~C~~C~~~g~C~Lq~l~~~~g~~~~r~   57 (139)
                      .-..|+++|+|+||++++.+|+...++
T Consensus        69 ~~~~C~~~G~c~lq~la~~~Gv~~~~~   95 (191)
T PRK05113         69 KINKCPPGGEATMLKLAELLGVEPQPL   95 (191)
T ss_pred             CcCcCCCCchHHHHHHHHHhCCCcccC
Confidence            455788999999999999999976665


No 28 
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional
Probab=97.84  E-value=1.1e-05  Score=69.63  Aligned_cols=53  Identities=17%  Similarity=0.093  Sum_probs=37.2

Q ss_pred             CCCCcC--CCCcchhHHHHHHhCCCCccccccccCC--Cccccc-cccceeecccCcee
Q psy3842          31 DCPICD--QGGECDLQDQSMAFGSDRSRFTDIDFSG--KRWGYL-REKLFLSELSGKRE   84 (139)
Q Consensus        31 ~C~~C~--~~g~C~Lq~l~~~~g~~~~r~~~~~~~~--~r~~t~-~~~~~~~~~~g~~~   84 (139)
                      +|+.|.  ++++|+||+++++||+...+|.......  .. ..+ .-.+..|..||+|+
T Consensus       568 ~~~~~~C~~~~~C~Lq~~a~~~~~~~~~~~~~~~~~~~~~-~~~i~~D~~kCI~CgrCv  625 (652)
T PRK12814        568 RCLRCRCNAVDDCRLRDLATRYLPDTPCKEEEHEGFSITR-NGDIRFEREKCVDCGICV  625 (652)
T ss_pred             HhhhhhcCCCCCChhHHHHHHhCCCcccccccccCccccC-CCCeEeccccccCchHHH
Confidence            466665  7899999999999999988885421000  00 122 23567899999999


No 29 
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the B subunit.
Probab=97.72  E-value=3.4e-05  Score=55.91  Aligned_cols=66  Identities=11%  Similarity=-0.116  Sum_probs=44.7

Q ss_pred             hCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccC---CCccccccccceeecccCceecccCCccccc
Q psy3842          27 NHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFS---GKRWGYLREKLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        27 ~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~---~~r~~t~~~~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      +|+. ...|.++|+|+||++++.+|+...++......   ..+ ....-....|..||.|+.+||++++..
T Consensus        64 ~~~~-i~~C~~~g~c~l~~~a~~~gv~~~~~~~~~~~~~~~~~-~~~~id~~~Ci~Cg~C~~aCp~~ai~~  132 (165)
T TIGR01944        64 EGEA-INKCPPGGEAVILALAELLGVEPIPQPLDADAGTIQPP-MVALIDEDNCIGCTKCIQACPVDAIVG  132 (165)
T ss_pred             cCCC-cCcCccccHHHHHHHHHHcCCCcccCCccccccccCCC-ceEEEECCcCCChhHHHHhCCccceEe
Confidence            5655 77899999999999999999987765321000   000 001112336788999999999998654


No 30 
>PRK06991 ferredoxin; Provisional
Probab=97.50  E-value=0.0001  Score=57.50  Aligned_cols=68  Identities=12%  Similarity=0.036  Sum_probs=45.8

Q ss_pred             HHhCCCCCCCcCCCCcchhHHHHHHhCCCCccccccccCCC-cc-ccccccceeecccCceecccCCccccc
Q psy3842          25 LVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGK-RW-GYLREKLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        25 l~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~~~~~~~~~-r~-~t~~~~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      +.++..+|..|..+|.|.++.++..+|.....+...  .+. +. +...-....|+.||.|+.+||++++..
T Consensus        35 Ia~Gea~~n~Cp~gG~~gi~~la~llG~~~~~~~p~--~~~~~~~~~~~id~~~CigCg~Cv~aCP~~AI~~  104 (270)
T PRK06991         35 IAAGEANYNRCPPGGAEGIARLAALLGKPVIPLDPA--NGVERPRAVAVIDEQLCIGCTLCMQACPVDAIVG  104 (270)
T ss_pred             HHcCCCCCCcCCCCcHHHHHHHHHHhCCCccccccc--cccccccceeEEccccCCCCcHHHHhCCHhheec
Confidence            446788899999999999999999999865444321  111 00 000112235788899999999888743


No 31 
>PF12798 Fer4_3:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=97.44  E-value=2.3e-05  Score=34.73  Aligned_cols=15  Identities=13%  Similarity=0.220  Sum_probs=13.5

Q ss_pred             ecccCceecccCCcc
Q psy3842          77 SELSGKRESTCAPAR   91 (139)
Q Consensus        77 ~~~~g~~~~~CPtga   91 (139)
                      |+.||.|+++||++|
T Consensus         1 C~~C~~C~~~Cp~~A   15 (15)
T PF12798_consen    1 CTGCGACVEVCPTGA   15 (15)
T ss_pred             CCCchHHHHHhcCCC
Confidence            568999999999997


No 32 
>PF00037 Fer4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1DUR_A 1H98_A 1BD6_A 1BQX_A 1BWE_A 1BC6_A 3BK7_A 1FCA_A 1FDN_A 2FDN_A ....
Probab=96.69  E-value=0.00031  Score=34.81  Aligned_cols=18  Identities=11%  Similarity=0.008  Sum_probs=15.1

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|+.||.|+.+||++|+.
T Consensus         7 ~C~~Cg~C~~~CP~~ai~   24 (24)
T PF00037_consen    7 KCIGCGRCVEACPFDAIT   24 (24)
T ss_dssp             TSSS-THHHHHSTTSSEE
T ss_pred             HCCCcchhhhhcccccCC
Confidence            588999999999999973


No 33 
>PF12837 Fer4_6:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=96.59  E-value=0.00036  Score=34.67  Aligned_cols=18  Identities=11%  Similarity=-0.038  Sum_probs=15.7

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||.|+.+||.+|+
T Consensus         7 ~~C~~Cg~C~~~Cp~~ai   24 (24)
T PF12837_consen    7 DKCIGCGDCVRVCPEGAI   24 (24)
T ss_pred             hhCcChhHHHHhcchhcC
Confidence            357899999999999885


No 34 
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]
Probab=96.35  E-value=0.001  Score=48.71  Aligned_cols=22  Identities=14%  Similarity=0.078  Sum_probs=19.4

Q ss_pred             cceeecccCceecccCCccccc
Q psy3842          73 KLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      .+.-|.+||.|+++|||+||..
T Consensus        93 n~grCIfCg~C~e~CPt~Al~~  114 (172)
T COG1143          93 NLGRCIFCGLCVEVCPTGALVL  114 (172)
T ss_pred             ccccccccCchhhhCchhhhcC
Confidence            5678999999999999999853


No 35 
>PF13187 Fer4_9:  4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J.
Probab=96.31  E-value=0.00081  Score=39.42  Aligned_cols=20  Identities=10%  Similarity=-0.021  Sum_probs=14.8

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      .+..|+.||.|+++||++|+
T Consensus        36 ~~~~C~~Cg~C~~~CP~~AI   55 (55)
T PF13187_consen   36 NAEKCIGCGACVKACPTGAI   55 (55)
T ss_dssp             TGGG--TTCHHHHHSTTT-E
T ss_pred             CCCccccHhHHHHHcchhhC
Confidence            45589999999999999985


No 36 
>PF13746 Fer4_18:  4Fe-4S dicluster domain
Probab=95.42  E-value=0.0048  Score=38.35  Aligned_cols=20  Identities=10%  Similarity=-0.109  Sum_probs=17.8

Q ss_pred             ccceeecccCceecccCCcc
Q psy3842          72 EKLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtga   91 (139)
                      .+...|+.||+|+.+||++.
T Consensus        47 ~~~~~CVgCgrCv~~CP~~I   66 (69)
T PF13746_consen   47 YGEGDCVGCGRCVRVCPAGI   66 (69)
T ss_pred             cCCccCCCcChHhhhcCCCC
Confidence            46779999999999999984


No 37 
>PF13484 Fer4_16:  4Fe-4S double cluster binding domain
Probab=95.33  E-value=0.0027  Score=38.71  Aligned_cols=19  Identities=16%  Similarity=0.156  Sum_probs=16.9

Q ss_pred             ecccCceecccCCcccccc
Q psy3842          77 SELSGKRESTCAPAREGVM   95 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal~~~   95 (139)
                      |..||+|+++||++||...
T Consensus         2 C~~C~~C~~~CP~~AI~~~   20 (67)
T PF13484_consen    2 CITCGKCAEACPTGAISGE   20 (67)
T ss_pred             CcchhHHHHhCcHhhccCC
Confidence            6789999999999998765


No 38 
>PF12838 Fer4_7:  4Fe-4S dicluster domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 3CF4_A 1K0T_A 2VKR_C 1JB0_C 3PCQ_C.
Probab=94.98  E-value=0.0043  Score=36.03  Aligned_cols=18  Identities=11%  Similarity=0.111  Sum_probs=9.3

Q ss_pred             ecccCceecccCCccccc
Q psy3842          77 SELSGKRESTCAPAREGV   94 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal~~   94 (139)
                      |+.||.|+.+||++++..
T Consensus         2 C~~C~~C~~~CP~~~i~~   19 (52)
T PF12838_consen    2 CIGCGACVEACPTGAIRL   19 (52)
T ss_dssp             -SS--HHHHH-TTHHCEE
T ss_pred             CCCcCchHHhcCccccCc
Confidence            556777777777776643


No 39 
>PF14697 Fer4_21:  4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B ....
Probab=94.84  E-value=0.011  Score=35.53  Aligned_cols=19  Identities=11%  Similarity=-0.132  Sum_probs=14.2

Q ss_pred             eeecccCceecccCC-cccc
Q psy3842          75 FLSELSGKRESTCAP-AREG   93 (139)
Q Consensus        75 ~~~~~~g~~~~~CPt-gal~   93 (139)
                      ..|+.||.|+.+||| +|+.
T Consensus        39 ~~C~GCg~C~~~CPv~~AI~   58 (59)
T PF14697_consen   39 DKCIGCGLCVKVCPVKDAIT   58 (59)
T ss_dssp             TT--S-SCCCCCSSSTTSEE
T ss_pred             ccCcCcCcccccCCCccCCC
Confidence            478999999999998 9875


No 40 
>PF12838 Fer4_7:  4Fe-4S dicluster domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 3CF4_A 1K0T_A 2VKR_C 1JB0_C 3PCQ_C.
Probab=94.67  E-value=0.007  Score=35.11  Aligned_cols=19  Identities=11%  Similarity=0.027  Sum_probs=12.1

Q ss_pred             cceeecccCceecccCCcc
Q psy3842          73 KLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtga   91 (139)
                      .+..|+.||+|+.+||++|
T Consensus        34 ~~~~C~~C~~C~~~CP~~A   52 (52)
T PF12838_consen   34 DPDKCTGCGACVEVCPTGA   52 (52)
T ss_dssp             TGGG----SHHHHHTTTS-
T ss_pred             echhCcCcChhhhhCcCcC
Confidence            3557999999999999997


No 41 
>PF13237 Fer4_10:  4Fe-4S dicluster domain; PDB: 2FGO_A.
Probab=94.62  E-value=0.014  Score=33.77  Aligned_cols=36  Identities=17%  Similarity=0.092  Sum_probs=13.8

Q ss_pred             eeecccCceecccCC---cccccceeeeccccccCCCCC
Q psy3842          75 FLSELSGKRESTCAP---AREGVMEFLLVNHPLDCPICD  110 (139)
Q Consensus        75 ~~~~~~g~~~~~CPt---gal~~~e~~l~~~~~~C~~C~  110 (139)
                      ..|+.||.|+.+||+   .+....+......+..|..|+
T Consensus         7 ~~C~~C~~C~~~CP~~~~~~~~~~~~~~~~~~~~C~~Cg   45 (52)
T PF13237_consen    7 DKCIGCGRCVKVCPADNAIAIDDGEKKVEIDPERCIGCG   45 (52)
T ss_dssp             T------TTGGG-TT-----EEE-SSSEEE-TTT--TTS
T ss_pred             ccCcCCcChHHHccchhHHHhhccCCCeEeCcccccccC
Confidence            358899999999999   222222222333556677765


No 42 
>CHL00065 psaC photosystem I subunit VII
Probab=94.36  E-value=0.014  Score=37.10  Aligned_cols=24  Identities=21%  Similarity=0.095  Sum_probs=20.6

Q ss_pred             eeecccCceecccCCcccccceee
Q psy3842          75 FLSELSGKRESTCAPAREGVMEFL   98 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e~~   98 (139)
                      ..|+.||.|+.+||++|+....+.
T Consensus        46 ~~C~~C~~C~~~CP~~Ai~~~~~~   69 (81)
T CHL00065         46 EDCVGCKRCESACPTDFLSVRVYL   69 (81)
T ss_pred             CcCCChhhhhhhcCccccEEEEEe
Confidence            468899999999999999876654


No 43 
>PRK08764 ferredoxin; Provisional
Probab=94.17  E-value=0.043  Score=38.39  Aligned_cols=55  Identities=9%  Similarity=0.146  Sum_probs=38.4

Q ss_pred             eeecccCceecccCCcccccceeeeccccccCCCCCCCCcchhHHHHHHhCCCCCCCCC
Q psy3842          75 FLSELSGKRESTCAPAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~~g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      +--.+||.|=..   |- ......+.++...|..|.++++++||+++..+|++..+|..
T Consensus        15 lp~~ncg~cg~~---~c-~~~a~~~v~g~~~~~~C~~~G~c~lq~~a~~~gv~~~~~~~   69 (135)
T PRK08764         15 LPQTQCGQCGFD---GC-RPYAQAMARGEATIDRCPPGGDAGARALAQVLGVPARPYDR   69 (135)
T ss_pred             CCCCCCccCCCc---CH-HHHHHHHHcCCCCCCCCCCCCHHHHHHHHHHhCCCcccccc
Confidence            334567777331   11 11222345788899999999999999999999998776643


No 44 
>PF12800 Fer4_4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1BD6_A 1BQX_A 1BWE_A 1BC6_A.
Probab=93.99  E-value=0.024  Score=25.63  Aligned_cols=15  Identities=13%  Similarity=0.129  Sum_probs=12.4

Q ss_pred             eecccCceecccCCc
Q psy3842          76 LSELSGKRESTCAPA   90 (139)
Q Consensus        76 ~~~~~g~~~~~CPtg   90 (139)
                      .|+.|+.|+.+||+.
T Consensus         3 ~C~~C~~C~~~Cp~~   17 (17)
T PF12800_consen    3 RCIGCGSCVDVCPTQ   17 (17)
T ss_dssp             CCTTSSSSTTTSTT-
T ss_pred             cCCCCchHHhhccCC
Confidence            477899999999974


No 45 
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=93.91  E-value=0.031  Score=41.09  Aligned_cols=39  Identities=18%  Similarity=0.260  Sum_probs=27.2

Q ss_pred             eeecccCceecccCCcccccce-ee------------eccccccCCCCCCCC
Q psy3842          75 FLSELSGKRESTCAPAREGVME-FL------------LVNHPLDCPICDQGG  113 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e-~~------------l~~~~~~C~~C~~g~  113 (139)
                      ..|+.||.|+.+||++|+.... +.            .......|..|+.-.
T Consensus        73 ~~C~~Cg~C~~~CPt~AI~~~~~~~~~~~~~~~l~~~~~~~~~~C~~Cg~~f  124 (181)
T PRK08222         73 GRCIYCGRCEEVCPTRAIQLTNNFELTVTNKADLYTRATFHLQRCSRCERPF  124 (181)
T ss_pred             CcCcCCCCcccccCcCeEEeccceeeeccchhhhheecccccCcCcccCCcc
Confidence            3688999999999999986432 11            112455688888754


No 46 
>PLN00071 photosystem I subunit VII; Provisional
Probab=93.69  E-value=0.022  Score=36.05  Aligned_cols=25  Identities=20%  Similarity=0.074  Sum_probs=20.6

Q ss_pred             ceeecccCceecccCCcccccceee
Q psy3842          74 LFLSELSGKRESTCAPAREGVMEFL   98 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~~e~~   98 (139)
                      ...|+.||.|+++||++|+....+.
T Consensus        45 ~~~C~~Cg~C~~~CP~~Ai~~~~~~   69 (81)
T PLN00071         45 TEDCVGCKRCESACPTDFLSVRVYL   69 (81)
T ss_pred             CCcCcChhhHHhhcCCccceEeeee
Confidence            3468899999999999999875543


No 47 
>PF13187 Fer4_9:  4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J.
Probab=93.37  E-value=0.016  Score=33.72  Aligned_cols=19  Identities=11%  Similarity=0.023  Sum_probs=14.1

Q ss_pred             ecccCceecccCCcccccc
Q psy3842          77 SELSGKRESTCAPAREGVM   95 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal~~~   95 (139)
                      |+.||.|+++||++++...
T Consensus         2 Ci~Cg~C~~~CP~~~~~~~   20 (55)
T PF13187_consen    2 CIGCGRCVEACPVGVIEFD   20 (55)
T ss_dssp             --TTTHHHHHSTTT-EEEE
T ss_pred             CCCcchHHHHCCccCeEcc
Confidence            6789999999999998643


No 48 
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC. Members of this family are PsaC, an essential component of photosystem I (PS-I) reaction center in Cyanobacteria and chloroplasts. This small protein, about 80 amino acids in length, contains two copies of the ferredoxin-like 4Fe-4S binding site (pfam00037) and therefore eight conserved Cys residues. This protein is also called photosystem I subunit VII.
Probab=93.34  E-value=0.023  Score=35.96  Aligned_cols=24  Identities=21%  Similarity=0.095  Sum_probs=19.9

Q ss_pred             eeecccCceecccCCcccccceee
Q psy3842          75 FLSELSGKRESTCAPAREGVMEFL   98 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e~~   98 (139)
                      ..|+.||.|+++||++|+....+.
T Consensus        45 ~~C~~Cg~C~~~CP~~ai~~~~~~   68 (80)
T TIGR03048        45 EDCVGCKRCESACPTDFLSVRVYL   68 (80)
T ss_pred             CcCcChhHHHHhcCcccCEEEEec
Confidence            468999999999999999765443


No 49 
>KOG3256|consensus
Probab=93.32  E-value=0.038  Score=40.24  Aligned_cols=24  Identities=8%  Similarity=-0.021  Sum_probs=21.1

Q ss_pred             cccceeecccCceecccCCccccc
Q psy3842          71 REKLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        71 ~~~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      .-.|-.|.+||.|..+|||.|+..
T Consensus       146 dIDmtkCIyCG~CqEaCPvdaive  169 (212)
T KOG3256|consen  146 DIDMTKCIYCGFCQEACPVDAIVE  169 (212)
T ss_pred             cccceeeeeecchhhhCCccceec
Confidence            347889999999999999999864


No 50 
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific. Members of this family are homodimeric ferredoxins from nitrogen fixation regions of many nitrogen-fixing bacteria. As characterized in Rhodobacter capsulatus, these proteins are homodimeric, with two 4Fe-4S clusters bound per monomer. Although nif-specific, this protein family is not usiveral, as other nitrogenase systems may substitute flavodoxins, or different types of ferredoxin.
Probab=93.23  E-value=0.018  Score=37.11  Aligned_cols=22  Identities=9%  Similarity=-0.082  Sum_probs=18.5

Q ss_pred             cceeecccCceecccCCccccc
Q psy3842          73 KLFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ....|..||.|+.+||++|+..
T Consensus        68 ~~~~C~~Cg~C~~~CP~~AI~~   89 (91)
T TIGR02936        68 NPGNCIGCGACARVCPKKCQTH   89 (91)
T ss_pred             CCccCcChhhhhhhCCHhHEec
Confidence            3457899999999999999853


No 51 
>COG1145 NapF Ferredoxin [Energy production and conversion]
Probab=93.07  E-value=0.028  Score=36.22  Aligned_cols=21  Identities=10%  Similarity=-0.053  Sum_probs=18.1

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|..||.|+.+||++|+..
T Consensus        28 ~~~Ci~Cg~C~~~CP~~ai~~   48 (99)
T COG1145          28 AEKCIGCGLCVKVCPTGAIEL   48 (99)
T ss_pred             ccccCCCCCchhhCCHHHhhc
Confidence            345899999999999999875


No 52 
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]
Probab=93.06  E-value=0.033  Score=40.74  Aligned_cols=22  Identities=9%  Similarity=-0.090  Sum_probs=18.7

Q ss_pred             ceeecccCceecccCCcccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ...|..|+.|+.+||++|+...
T Consensus        54 ~~~CIgC~lCa~iCP~~aI~m~   75 (172)
T COG1143          54 RDKCIGCGLCANICPANAITME   75 (172)
T ss_pred             ccCCcchhHHHhhCCcCceEEE
Confidence            3459999999999999998654


No 53 
>PRK02651 photosystem I subunit VII; Provisional
Probab=93.05  E-value=0.036  Score=34.95  Aligned_cols=24  Identities=13%  Similarity=0.081  Sum_probs=20.2

Q ss_pred             eeecccCceecccCCcccccceee
Q psy3842          75 FLSELSGKRESTCAPAREGVMEFL   98 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e~~   98 (139)
                      ..|+.||.|+.+||++|+....++
T Consensus        46 ~~C~~Cg~C~~~CP~~ai~~~~~~   69 (81)
T PRK02651         46 EDCVGCKRCETACPTDFLSIRVYL   69 (81)
T ss_pred             CcCCChhhhhhhcCCCceEEEEEe
Confidence            468899999999999998876554


No 54 
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I. This model represents the I subunit (one of 14: A-N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes "I" subunits from the closely related F420H2 dehydrogenase and formate hydrogenlyase complexes.
Probab=92.07  E-value=0.066  Score=36.38  Aligned_cols=24  Identities=13%  Similarity=0.103  Sum_probs=18.9

Q ss_pred             cceeecccCceecccCCcccccce
Q psy3842          73 KLFLSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal~~~e   96 (139)
                      ....|+.||.|+++||++|+....
T Consensus        80 ~~~~C~~Cg~Cv~~CP~~al~~~~  103 (122)
T TIGR01971        80 NFGRCIFCGLCEEACPTDAIVLTP  103 (122)
T ss_pred             CcccCCCCCchhhhCCCccccccc
Confidence            345688999999999999986543


No 55 
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein.
Probab=92.03  E-value=0.052  Score=40.00  Aligned_cols=21  Identities=10%  Similarity=0.134  Sum_probs=18.1

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|..||.|+++||++|+..
T Consensus       101 ~~~Ci~Cg~Cv~aCP~~AI~~  121 (183)
T TIGR00403       101 FGVCIFCGNCVEYCPTNCLSM  121 (183)
T ss_pred             cccccCcCchhhhcCCCCeec
Confidence            346899999999999999864


No 56 
>PRK05888 NADH dehydrogenase subunit I; Provisional
Probab=91.91  E-value=0.062  Score=38.70  Aligned_cols=23  Identities=13%  Similarity=0.044  Sum_probs=19.3

Q ss_pred             cceeecccCceecccCCcccccc
Q psy3842          73 KLFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ....|+.||.|+.+||++|+...
T Consensus        95 ~~~~C~~Cg~Cv~~CP~~Ai~~~  117 (164)
T PRK05888         95 NFGRCIFCGFCEEACPTDAIVET  117 (164)
T ss_pred             CCCcCcccCcchhhcCcCcceec
Confidence            44578999999999999998643


No 57 
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]
Probab=91.65  E-value=0.051  Score=43.25  Aligned_cols=21  Identities=19%  Similarity=0.123  Sum_probs=18.2

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|..||+|+++|||+|+....
T Consensus       173 ~c~gc~~cv~~C~~gAI~~~~  193 (317)
T COG2221         173 LCRGCGKCVKVCPTGAITWDG  193 (317)
T ss_pred             HhchhHhHHHhCCCCceeecc
Confidence            567999999999999987664


No 58 
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed
Probab=91.57  E-value=0.084  Score=35.06  Aligned_cols=18  Identities=11%  Similarity=0.047  Sum_probs=11.1

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|+.||.|+.+||++++.
T Consensus        17 ~Ci~C~~Cv~aCP~~ai~   34 (103)
T PRK09626         17 RCKACDICVSVCPAGVLA   34 (103)
T ss_pred             cccCCcchhhhcChhhhc
Confidence            355666666666666643


No 59 
>PRK06273 ferredoxin; Provisional
Probab=91.50  E-value=0.061  Score=39.08  Aligned_cols=19  Identities=16%  Similarity=0.183  Sum_probs=16.9

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..||.|+.+||++|+..
T Consensus        50 ~CigCg~C~~aCP~~AI~~   68 (165)
T PRK06273         50 LCIGCGGCANVCPTKAIEM   68 (165)
T ss_pred             hCcChhHHHHhcCccceee
Confidence            6889999999999999754


No 60 
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I. This model represents the I subunit (one of 14: A-N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes "I" subunits from the closely related F420H2 dehydrogenase and formate hydrogenlyase complexes.
Probab=91.32  E-value=0.083  Score=35.89  Aligned_cols=21  Identities=10%  Similarity=-0.072  Sum_probs=17.9

Q ss_pred             eeecccCceecccCCcccccc
Q psy3842          75 FLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ..|+.||.|+.+||++++...
T Consensus        43 ~~Ci~C~~C~~~CP~~ai~~~   63 (122)
T TIGR01971        43 EKCIGCTLCAAVCPADAIRVV   63 (122)
T ss_pred             CcCcCcchhhhhcCHhHeeee
Confidence            568999999999999987644


No 61 
>TIGR00402 napF ferredoxin-type protein NapF. The gene codes for a ferredoxin-type cytosolic protein, NapF, of the periplasmic nitrate reductase system, as in Escherichia coli. NapF interacts with the catalytic subunit, NapA, and may be an accessory protein for NapA maturation.
Probab=91.23  E-value=0.078  Score=35.17  Aligned_cols=21  Identities=14%  Similarity=0.167  Sum_probs=17.9

Q ss_pred             eeecccCceecccCCcccccc
Q psy3842          75 FLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ..|+.||.|+.+||++|+...
T Consensus        66 ~~C~~Cg~C~~~CP~~Ai~~~   86 (101)
T TIGR00402        66 AECDFCGKCAEACPTNAFHPR   86 (101)
T ss_pred             ccCcCccChhhHCCccccCcC
Confidence            368899999999999998653


No 62 
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional
Probab=90.99  E-value=0.084  Score=35.99  Aligned_cols=20  Identities=5%  Similarity=-0.253  Sum_probs=15.6

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|+.||.|+.+||++++..
T Consensus        42 ~~Ci~C~~C~~~CP~~ai~~   61 (120)
T PRK08348         42 DKCVGCRMCVTVCPAGVFVY   61 (120)
T ss_pred             ccCcCcccHHHHCCccceEc
Confidence            35778889999999888643


No 63 
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional
Probab=90.96  E-value=0.063  Score=36.62  Aligned_cols=22  Identities=9%  Similarity=0.128  Sum_probs=18.6

Q ss_pred             eeecccCceecccCCcccccce
Q psy3842          75 FLSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e   96 (139)
                      ..|+.||.|+++||++|+....
T Consensus        73 ~~C~~Cg~Cv~~CP~~Ai~~~~   94 (120)
T PRK08348         73 GRCVFCGQCVDVCPTGALQMSD   94 (120)
T ss_pred             CcCcChhhhHHhCCcCcEEecc
Confidence            3688999999999999987543


No 64 
>PRK09477 napH quinol dehydrogenase membrane component; Provisional
Probab=90.58  E-value=0.071  Score=41.51  Aligned_cols=20  Identities=10%  Similarity=-0.026  Sum_probs=17.7

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|+.||+|+++||++|+..
T Consensus       242 ~~C~~Cg~Cv~~CP~~Ai~~  261 (271)
T PRK09477        242 GDCITCGRCIDVCSEDVFNF  261 (271)
T ss_pred             ccCcChhHHHhhcCccceee
Confidence            46999999999999999864


No 65 
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=90.49  E-value=0.097  Score=38.47  Aligned_cols=21  Identities=10%  Similarity=0.075  Sum_probs=18.0

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|+.||.|+.+||++|+..
T Consensus        37 ~~~Ci~Cg~Cv~aCP~~Ai~~   57 (181)
T PRK08222         37 PSQCIACGACTCACPANALTI   57 (181)
T ss_pred             hhhCcchhHHHHhCCccceEc
Confidence            446899999999999999864


No 66 
>PRK06273 ferredoxin; Provisional
Probab=90.08  E-value=0.1  Score=37.92  Aligned_cols=21  Identities=5%  Similarity=-0.284  Sum_probs=18.0

Q ss_pred             cceeecccCceecccCCcccc
Q psy3842          73 KLFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal~   93 (139)
                      .+..|+.||.|+++||++|+.
T Consensus        89 d~~kCi~Cg~C~~aCP~~AI~  109 (165)
T PRK06273         89 DYEKCVYCLYCHDFCPVFALF  109 (165)
T ss_pred             ccccCcCCCCcchhCCHhhee
Confidence            345789999999999999983


No 67 
>PF14697 Fer4_21:  4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B ....
Probab=90.06  E-value=0.12  Score=30.98  Aligned_cols=21  Identities=19%  Similarity=0.188  Sum_probs=12.5

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|..||.|+.+||.+++...+
T Consensus         7 ~Ci~Cg~C~~~Cp~~~~~~i~   27 (59)
T PF14697_consen    7 KCIGCGKCVRACPDGAIDAIE   27 (59)
T ss_dssp             T----SCCCHHCCCCS-S-EC
T ss_pred             cccChhhHHhHcCccceeeEE
Confidence            478999999999998776544


No 68 
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed
Probab=89.98  E-value=0.1  Score=34.69  Aligned_cols=20  Identities=15%  Similarity=-0.144  Sum_probs=17.7

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|+.||.|+++||++|+..
T Consensus        53 ~~C~~C~~C~~~CP~~AI~~   72 (103)
T PRK09626         53 ESCIGCRECELHCPDFAIYV   72 (103)
T ss_pred             ccCCCcCcchhhCChhhEEE
Confidence            46889999999999999864


No 69 
>CHL00014 ndhI NADH dehydrogenase subunit I
Probab=89.96  E-value=0.1  Score=37.78  Aligned_cols=20  Identities=10%  Similarity=0.107  Sum_probs=17.6

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||.|+++||++|+..
T Consensus        99 ~~C~~Cg~C~~~CP~~AI~~  118 (167)
T CHL00014         99 GVCIFCGNCVEYCPTNCLSM  118 (167)
T ss_pred             CcCcCccchHhhcCcCceec
Confidence            46899999999999999864


No 70 
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC. Members of this family are PsaC, an essential component of photosystem I (PS-I) reaction center in Cyanobacteria and chloroplasts. This small protein, about 80 amino acids in length, contains two copies of the ferredoxin-like 4Fe-4S binding site (pfam00037) and therefore eight conserved Cys residues. This protein is also called photosystem I subunit VII.
Probab=89.94  E-value=0.12  Score=32.63  Aligned_cols=20  Identities=5%  Similarity=-0.036  Sum_probs=16.8

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|+.||.|+.+||++++...
T Consensus         9 ~Ci~C~~Cv~~CP~~~i~~~   28 (80)
T TIGR03048         9 TCIGCTQCVRACPTDVLEMV   28 (80)
T ss_pred             cCcCcchHHHHCCccceeee
Confidence            57889999999999987643


No 71 
>PRK10194 ferredoxin-type protein; Provisional
Probab=89.75  E-value=0.11  Score=37.37  Aligned_cols=19  Identities=16%  Similarity=0.249  Sum_probs=11.1

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|+.||.|+.+||++|+..
T Consensus       139 ~C~gCg~C~~~CP~~AI~~  157 (163)
T PRK10194        139 LCNGCGACAASCPVSAITA  157 (163)
T ss_pred             cCcCcchhhhhCCccceEe
Confidence            3456666666666666543


No 72 
>PRK09898 hypothetical protein; Provisional
Probab=89.72  E-value=0.07  Score=39.93  Aligned_cols=21  Identities=19%  Similarity=0.388  Sum_probs=12.2

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|+.||.|+++||++|+...+
T Consensus       182 kC~~Cg~Cv~~CP~~Ai~~~~  202 (208)
T PRK09898        182 KCVLCGECANACPTGALKIIE  202 (208)
T ss_pred             cCcChHHHHHhCCcccEEEec
Confidence            455666666666666655443


No 73 
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed
Probab=89.59  E-value=0.11  Score=34.79  Aligned_cols=20  Identities=10%  Similarity=0.079  Sum_probs=17.0

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|+.||.|+++||++|+..
T Consensus        81 ~~C~~Cg~Cv~~CP~~AI~~  100 (105)
T PRK09624         81 DYCKGCGICANECPTKAIEM  100 (105)
T ss_pred             hhCCCcCchhhhcCcCcEEE
Confidence            46889999999999999753


No 74 
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific. Members of this family are homodimeric ferredoxins from nitrogen fixation regions of many nitrogen-fixing bacteria. As characterized in Rhodobacter capsulatus, these proteins are homodimeric, with two 4Fe-4S clusters bound per monomer. Although nif-specific, this protein family is not usiveral, as other nitrogenase systems may substitute flavodoxins, or different types of ferredoxin.
Probab=89.58  E-value=0.14  Score=32.92  Aligned_cols=22  Identities=9%  Similarity=-0.068  Sum_probs=18.1

Q ss_pred             ceeecccCceecccCCcccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      +..|+.||.|+.+||++++...
T Consensus        20 ~~~Ci~C~~Cv~~CP~~~i~~~   41 (91)
T TIGR02936        20 QEKCIGCGRCYKVCGRDVLTLK   41 (91)
T ss_pred             HhHCCCcchHHHHcChhhceee
Confidence            3468899999999999987643


No 75 
>PRK02651 photosystem I subunit VII; Provisional
Probab=89.56  E-value=0.15  Score=32.03  Aligned_cols=23  Identities=4%  Similarity=-0.138  Sum_probs=18.3

Q ss_pred             ceeecccCceecccCCcccccce
Q psy3842          74 LFLSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~~e   96 (139)
                      ...|..||.|+++||++++...+
T Consensus         8 ~~~Ci~C~~C~~~CP~~~i~~~~   30 (81)
T PRK02651          8 YDTCIGCTQCVRACPLDVLEMVP   30 (81)
T ss_pred             cccCCCcchHHHHCCccceeccc
Confidence            34678999999999999876443


No 76 
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed
Probab=89.38  E-value=0.094  Score=36.65  Aligned_cols=19  Identities=11%  Similarity=0.100  Sum_probs=16.6

Q ss_pred             eeecccCceecccCCcccc
Q psy3842          75 FLSELSGKRESTCAPAREG   93 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~   93 (139)
                      ..|..||.|+++||++|+.
T Consensus        89 ~~C~~Cg~Cv~vCP~~a~~  107 (133)
T PRK09625         89 SHCKGCGVCVEVCPTNPKS  107 (133)
T ss_pred             CcCcChhHHHHHCCcCceE
Confidence            3588999999999999864


No 77 
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family. Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase. Some species with this reductase lack NapC but accomplish electron transfer to NapAB in some other manner, likely to involve NapH, NapG, and/or some other protein. A few members of this protein are designated MauN and are found in methylamine utilization operons in species that appear to lack a periplasmic nitrate reductase.
Probab=89.34  E-value=0.099  Score=40.37  Aligned_cols=19  Identities=21%  Similarity=0.204  Sum_probs=16.8

Q ss_pred             eeecccCceecccCCcccc
Q psy3842          75 FLSELSGKRESTCAPAREG   93 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~   93 (139)
                      ..|+.||+|+++||++|+.
T Consensus       234 ~~C~~Cg~Cv~~CP~~Ai~  252 (255)
T TIGR02163       234 GDCTLCGRCIDVCHEDVLG  252 (255)
T ss_pred             ccccchhHHHHhCCccccc
Confidence            4689999999999999875


No 78 
>COG1146 Ferredoxin [Energy production and conversion]
Probab=89.27  E-value=0.11  Score=31.84  Aligned_cols=25  Identities=16%  Similarity=-0.049  Sum_probs=20.0

Q ss_pred             cccceeecccCceecccCCcccccc
Q psy3842          71 REKLFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        71 ~~~~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      +-....|..||.|+.+||++|+...
T Consensus        37 ~~~~e~C~~C~~C~~~CP~~aI~~~   61 (68)
T COG1146          37 VARPEECIDCGLCELACPVGAIKVD   61 (68)
T ss_pred             EeccccCccchhhhhhCCcceEEEe
Confidence            3345678999999999999987654


No 79 
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family. A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor. Several related four-subunit enzymes may exist in the same species. This model describes a subfamily of delta subunits, representing mostly pyruvate, 2-ketoisovalerate, and 2-oxoglutarate specific enzymes. The delta subunit is the smallest and resembles ferredoxins.
Probab=89.16  E-value=0.13  Score=32.00  Aligned_cols=20  Identities=10%  Similarity=0.049  Sum_probs=16.8

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..|+.|+.+||++|+..
T Consensus        55 ~~C~~C~~C~~~CP~~Ai~~   74 (78)
T TIGR02179        55 DYCKGCGICANVCPVKAIEM   74 (78)
T ss_pred             ccCcCccchhhhCCccccEe
Confidence            35788999999999998753


No 80 
>TIGR02912 sulfite_red_C sulfite reductase, subunit C. Members of this protein family include the C subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite.
Probab=88.42  E-value=0.14  Score=40.66  Aligned_cols=20  Identities=10%  Similarity=-0.069  Sum_probs=17.4

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|+.||.|+.+||++|+...
T Consensus       202 ~C~~Cg~Cv~~CP~~Al~~~  221 (314)
T TIGR02912       202 KCIGCGECVLKCPTGAWTRS  221 (314)
T ss_pred             cCcCcchhhhhCCHhhcccC
Confidence            68899999999999998654


No 81 
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]
Probab=88.32  E-value=0.12  Score=41.61  Aligned_cols=21  Identities=5%  Similarity=-0.096  Sum_probs=17.1

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|..|.+|+++|||+|+....
T Consensus       186 ~Cg~C~~CldaCPt~Al~~~~  206 (337)
T COG1600         186 HCGSCTRCLDACPTGALVAPY  206 (337)
T ss_pred             cChhhHHHHhhCCcccccCCC
Confidence            467788999999999996543


No 82 
>PRK05888 NADH dehydrogenase subunit I; Provisional
Probab=88.17  E-value=0.26  Score=35.39  Aligned_cols=20  Identities=5%  Similarity=-0.067  Sum_probs=17.3

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||.|+.+||++++..
T Consensus        58 ~~Ci~C~~C~~~CP~~ai~~   77 (164)
T PRK05888         58 ERCIACKLCAAICPADAITI   77 (164)
T ss_pred             ccCCcccChHHHcCcccccc
Confidence            37999999999999998753


No 83 
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=88.10  E-value=0.18  Score=36.90  Aligned_cols=39  Identities=23%  Similarity=0.324  Sum_probs=26.8

Q ss_pred             eeecccCceecccCCcccccc-eeee------------ccccccCCCCCCCC
Q psy3842          75 FLSELSGKRESTCAPAREGVM-EFLL------------VNHPLDCPICDQGG  113 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~-e~~l------------~~~~~~C~~C~~g~  113 (139)
                      ..|+.||.|+++||++|+... ++.+            ......|..|+...
T Consensus        73 ~~C~~Cg~C~~vCP~~AI~~~~~~~~~~~~~~~l~~~~~~~~~~C~~CG~~f  124 (180)
T PRK12387         73 GRCIFCGRCEEVCPTAAIKLSQEFELAVWKKEDLLQQSEFALCNCRVCGRPF  124 (180)
T ss_pred             ccCcCccchhhhcCcCceEccCccchhhccHHHhhhhceeCcccchhhCCcc
Confidence            468899999999999998532 2111            11345788898754


No 84 
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=87.92  E-value=0.18  Score=36.80  Aligned_cols=21  Identities=10%  Similarity=-0.078  Sum_probs=17.7

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|+.||.|+.+||++|+..
T Consensus        37 ~~~C~~C~~Cv~~CP~~ai~~   57 (180)
T PRK12387         37 PQQCIGCAACVNACPSNALTV   57 (180)
T ss_pred             hhhCcChhHHHHhcCccCeEe
Confidence            346889999999999999754


No 85 
>TIGR00402 napF ferredoxin-type protein NapF. The gene codes for a ferredoxin-type cytosolic protein, NapF, of the periplasmic nitrate reductase system, as in Escherichia coli. NapF interacts with the catalytic subunit, NapA, and may be an accessory protein for NapA maturation.
Probab=87.89  E-value=0.22  Score=33.01  Aligned_cols=19  Identities=16%  Similarity=0.247  Sum_probs=16.5

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+++||++++..
T Consensus        35 ~C~~C~~C~~~CP~~~i~~   53 (101)
T TIGR00402        35 VCTRCGECASACENNILQL   53 (101)
T ss_pred             cCcChhHHHHHcCccccee
Confidence            5789999999999998764


No 86 
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed
Probab=87.84  E-value=0.16  Score=33.90  Aligned_cols=20  Identities=10%  Similarity=0.074  Sum_probs=17.0

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||.|+++||++|+..
T Consensus        81 ~~C~~Cg~Cv~~CP~~AI~~  100 (105)
T PRK09623         81 DYCKGCGICANECPTKAITM  100 (105)
T ss_pred             hhCcCcchhhhhcCcCcEEe
Confidence            45789999999999999754


No 87 
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional
Probab=87.77  E-value=0.17  Score=40.06  Aligned_cols=21  Identities=10%  Similarity=0.139  Sum_probs=17.9

Q ss_pred             eeecccCceecccCCcccccc
Q psy3842          75 FLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ..|+.||.|+++||++|+...
T Consensus       289 ~~C~gCg~C~~~CP~~AI~~~  309 (312)
T PRK14028        289 QYCKGCGVCAEVCPTGAIQMV  309 (312)
T ss_pred             ccCcCcCchhhhCCHhheEec
Confidence            458999999999999998643


No 88 
>COG1145 NapF Ferredoxin [Energy production and conversion]
Probab=87.66  E-value=0.18  Score=32.36  Aligned_cols=23  Identities=22%  Similarity=0.197  Sum_probs=18.8

Q ss_pred             ceeecccCceecccCCcccccce
Q psy3842          74 LFLSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~~e   96 (139)
                      ...|+.||.|+.+||++|+...+
T Consensus        62 ~~~C~~C~~C~~~Cp~~a~~~~~   84 (99)
T COG1145          62 PDLCVLCGACLKVCPVDALSIAE   84 (99)
T ss_pred             cccCccccchHhhCCcCCeehhh
Confidence            34689999999999999965543


No 89 
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein. MauM is involved in methylamine utilization. NapG is associated with nitrate reductase activity. The two proteins are highly similar.
Probab=87.42  E-value=0.23  Score=37.42  Aligned_cols=22  Identities=9%  Similarity=-0.017  Sum_probs=17.4

Q ss_pred             eeecccCceecccCCcccccce
Q psy3842          75 FLSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e   96 (139)
                      ..|+.||.|+.+||++++...+
T Consensus        53 ~~Ci~Cg~Cv~aCP~~ai~~~~   74 (213)
T TIGR00397        53 AACVRCGLCVEACPYDILSLAS   74 (213)
T ss_pred             ccccchhHHHHhCCcccccccc
Confidence            3688899999999999876543


No 90 
>PRK06991 ferredoxin; Provisional
Probab=87.38  E-value=0.16  Score=39.69  Aligned_cols=23  Identities=9%  Similarity=-0.037  Sum_probs=19.1

Q ss_pred             eeecccCceecccCCccccccee
Q psy3842          75 FLSELSGKRESTCAPAREGVMEF   97 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~e~   97 (139)
                      ..|+.||.|+.+||++++....+
T Consensus       115 ~~CigCg~Cv~vCP~~AI~~~~~  137 (270)
T PRK06991        115 DLCTGCDLCVPPCPVDCIDMVPV  137 (270)
T ss_pred             hhCCCchHHHhhCCcCCeEeecC
Confidence            47899999999999999865443


No 91 
>TIGR02486 RDH reductive dehalogenase. This model represents a family of corrin and 8-iron Fe-S cluster-containing reductive dehalogenases found primarily in halorespiring microorganisms such as dehalococcoides ethenogenes which contains as many as 17 enzymes of this type with varying substrate ranges. One example of a characterized species is the tetrachloroethene reductive dehalogenase (1.97.1.8) which also acts on trichloroethene converting it to dichloroethene.
Probab=87.13  E-value=0.17  Score=40.37  Aligned_cols=19  Identities=21%  Similarity=0.363  Sum_probs=16.9

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      -|..|+.|+++||++|+..
T Consensus       206 fC~~C~~C~~~CP~~Ai~~  224 (314)
T TIGR02486       206 FCETCGKCADECPSGAISK  224 (314)
T ss_pred             cCcchhHHHhhCCccccCC
Confidence            5888999999999999864


No 92 
>TIGR00276 iron-sulfur cluster binding protein, putative. This series of proteins contain the prosite signature for 4Fe-4S ferredoxins iron-sulfur binding proteins (C-x(2)-C-x(2)-C-x(3)-C-[PEG]) between residues 175-188 of the model.
Probab=87.12  E-value=0.14  Score=40.24  Aligned_cols=19  Identities=11%  Similarity=-0.022  Sum_probs=16.7

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+++|||+|+..
T Consensus       160 ~C~~C~~C~~aCPt~AI~~  178 (282)
T TIGR00276       160 YCGRCTKCIDACPTQALVE  178 (282)
T ss_pred             CCccHHHHHHhcCcccccC
Confidence            5788999999999999853


No 93 
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family. This subset of the radical-SAM family (pfam04055) includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centered radical. The closest relatives to this family are the pyruvate-formate lyase activating enzyme (PflA, 1.97.1.4, TIGR02493) and the anaerobic ribonucleotide reductase activating enzyme (TIGR02491). Included within this subfamily are activators of hydroxyphenyl acetate decarboxylase (HdpA, ), benzylsuccinate synthase (BssD, ), gycerol dehydratase (DhaB2, ) as well as enzymes annotated in E. coli as activators of different isozymes of pyruvate-formate lyase (PFLC and PFLE) however, these appear to lack characterization and may activate enzymes with distinctive functions. Most of the sequence-level variability between these forms is concentrated within an N-terminal domain which follows a conserved group of three cysteines and contains a variable pattern of 0 
Probab=86.95  E-value=0.25  Score=38.50  Aligned_cols=17  Identities=18%  Similarity=0.180  Sum_probs=9.2

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      .|..||.|+.+||++|+
T Consensus        49 ~C~~C~~C~~~Cp~~a~   65 (295)
T TIGR02494        49 RCLGCGKCVEVCPAGTA   65 (295)
T ss_pred             cCCCCchhhhhCccccc
Confidence            35555555555555554


No 94 
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]
Probab=86.76  E-value=0.2  Score=32.81  Aligned_cols=18  Identities=11%  Similarity=0.108  Sum_probs=15.6

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      -|..||-|+++||+.|+.
T Consensus        67 yCKGCGICa~vCP~kaI~   84 (91)
T COG1144          67 YCKGCGICANVCPVKAIE   84 (91)
T ss_pred             cccCceechhhCChhheE
Confidence            478999999999998864


No 95 
>PLN00071 photosystem I subunit VII; Provisional
Probab=86.24  E-value=0.18  Score=31.73  Aligned_cols=20  Identities=5%  Similarity=-0.021  Sum_probs=17.2

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|..||.|+.+||++++...
T Consensus        10 ~C~~C~~C~~~CP~~~i~~~   29 (81)
T PLN00071         10 TCIGCTQCVRACPTDVLEMI   29 (81)
T ss_pred             cCcChhHHHHHCCccceeee
Confidence            67899999999999987644


No 96 
>PF13183 Fer4_8:  4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N ....
Probab=85.80  E-value=0.16  Score=29.57  Aligned_cols=17  Identities=12%  Similarity=0.276  Sum_probs=8.9

Q ss_pred             ceeecccCceecccCCc
Q psy3842          74 LFLSELSGKRESTCAPA   90 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtg   90 (139)
                      ...|+.||+|..+||++
T Consensus        40 ~~~C~~C~~C~~~CP~~   56 (57)
T PF13183_consen   40 AWSCTTCGACSEVCPVG   56 (57)
T ss_dssp             HGG-----HHHHH-TT-
T ss_pred             ccCCcCcCCccCcCccc
Confidence            37899999999999987


No 97 
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional
Probab=85.73  E-value=0.34  Score=37.54  Aligned_cols=19  Identities=11%  Similarity=0.027  Sum_probs=14.4

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|+.||.|+.+||++++..
T Consensus        60 ~Ci~Cg~Cv~aCP~~aI~~   78 (254)
T PRK09476         60 ACIRCGLCVQACPYDTLKL   78 (254)
T ss_pred             hCcCchHHHHhCCccccCc
Confidence            5778888888888887653


No 98 
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. This model describes one of two paralogous families of archaealflavoprotein. The other, described by TIGR02699 and typified by the partially characterized AF1518 of Archaeoglobus fulgidus, is a homodimeric FMN-containing flavoprotein that accepts electrons from ferredoxin and can transfer them to various oxidoreductases. The function of this protein family is unknown.
Probab=85.45  E-value=0.3  Score=37.22  Aligned_cols=19  Identities=11%  Similarity=0.120  Sum_probs=16.1

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+.+||++++..
T Consensus       149 ~C~~C~~C~~~CP~~ai~~  167 (234)
T TIGR02700       149 RCKGCGICVDACPRSAIDM  167 (234)
T ss_pred             HCcCcchHHHhCCcccEEe
Confidence            4789999999999998753


No 99 
>PRK07118 ferredoxin; Validated
Probab=85.40  E-value=0.24  Score=38.92  Aligned_cols=21  Identities=14%  Similarity=0.063  Sum_probs=17.9

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|..|+.|+.+||++|+....
T Consensus       214 ~Ci~Cg~Cv~~CP~~AI~~~~  234 (280)
T PRK07118        214 GCIGCGKCVKACPAGAITMEN  234 (280)
T ss_pred             ccccchHHHhhCCcCcEEEeC
Confidence            578999999999999987644


No 100
>TIGR02910 sulfite_red_A sulfite reductase, subunit A. Members of this protein family include the A subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite.
Probab=85.29  E-value=0.35  Score=39.01  Aligned_cols=19  Identities=11%  Similarity=0.210  Sum_probs=17.4

Q ss_pred             cceeecccCceecccCCcc
Q psy3842          73 KLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtga   91 (139)
                      ++..|+.||+|+.+||++.
T Consensus       299 G~~~CvgCGrC~~~CP~~i  317 (334)
T TIGR02910       299 GYHMCVGCGRCDDICPEYI  317 (334)
T ss_pred             CccccCCcCchhhhCCCCC
Confidence            6779999999999999995


No 101
>PRK10194 ferredoxin-type protein; Provisional
Probab=85.05  E-value=0.26  Score=35.33  Aligned_cols=20  Identities=5%  Similarity=-0.071  Sum_probs=17.2

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|+.|+.|+++||++|+..
T Consensus        66 ~~C~~C~~C~~~CP~~ai~~   85 (163)
T PRK10194         66 NECSFCYACAQACPESLFSP   85 (163)
T ss_pred             CCCCCchhhHhhCcchheec
Confidence            35889999999999999754


No 102
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional
Probab=84.99  E-value=0.29  Score=35.64  Aligned_cols=21  Identities=10%  Similarity=0.066  Sum_probs=17.9

Q ss_pred             eeecccC------ceecccCCcccccc
Q psy3842          75 FLSELSG------KRESTCAPAREGVM   95 (139)
Q Consensus        75 ~~~~~~g------~~~~~CPtgal~~~   95 (139)
                      ..|..|+      .|+.+||++||...
T Consensus       129 ~kC~~C~~~~~~paCv~~CP~~Al~~~  155 (181)
T PRK10330        129 NKCDLCNHREDGPACMAACPTHALICV  155 (181)
T ss_pred             eeCcCCCCCCCCccchhhCchhhEEEe
Confidence            4688998      89999999999754


No 103
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit. During dissimilatory sulfate reduction and sulfur oxidation, adenylylsulfate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulfite and AMP. Found in several bacterial lineages and in Archaeoglobales, APS reductase is a heterodimer composed of an alpha subunit containing a noncovalently bound FAD, and a beta subunit containing two [4Fe-4S] clusters. Described by this model is the beta subunit of APS reductase, sharing common evolutionary origin with other iron-sulfur cluster-binding proteins.
Probab=83.98  E-value=0.24  Score=34.64  Aligned_cols=21  Identities=10%  Similarity=-0.091  Sum_probs=18.0

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|+.||.|+.+||++|+..
T Consensus        44 ~~~C~~Cg~Cv~~CP~~AI~~   64 (132)
T TIGR02060        44 PDMCWECYSCVKACPQGAIDV   64 (132)
T ss_pred             chhCccHHHHHHhCCcCceEE
Confidence            356889999999999999854


No 104
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C. The last step in methanogenesis leaves two coenzymes of methanogenesis, CoM and CoB, linked by a disulfide bond. Members of this protein family are the C subunit of the enzyme that reduces the heterodisulfide to CoB-SH and CoM-SH. Similar enzyme complex subunits are found in various other species, but likely act on a different substrate.
Probab=83.86  E-value=0.75  Score=32.29  Aligned_cols=16  Identities=19%  Similarity=0.385  Sum_probs=14.1

Q ss_pred             eecccCceecccCCcc
Q psy3842          76 LSELSGKRESTCAPAR   91 (139)
Q Consensus        76 ~~~~~g~~~~~CPtga   91 (139)
                      .|..||.|.++||+..
T Consensus         3 ~Ci~CG~C~~~CP~~~   18 (144)
T TIGR03290         3 ACYQCGTCTGSCPSGR   18 (144)
T ss_pred             cccCCCCCcCcCCCcc
Confidence            5889999999999864


No 105
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein. MauM is involved in methylamine utilization. NapG is associated with nitrate reductase activity. The two proteins are highly similar.
Probab=83.72  E-value=0.38  Score=36.26  Aligned_cols=20  Identities=20%  Similarity=0.232  Sum_probs=16.3

Q ss_pred             eecccCceecccCCc--ccccc
Q psy3842          76 LSELSGKRESTCAPA--REGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtg--al~~~   95 (139)
                      .|+.||.|+++|||+  |+.++
T Consensus       176 ~C~gCG~C~~~CP~~~~AI~v~  197 (213)
T TIGR00397       176 KCTGCGTCEKHCVLSEAAIRVL  197 (213)
T ss_pred             cCCCcchhhHhCCCCCCeEEEe
Confidence            589999999999998  44444


No 106
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein. Members of this protein family are the Fe-S protein, NrfC, of a cytochrome c nitrite reductase system for which the pentaheme cytochrome c protein, NrfB (family TIGR03146) is an unambiguous marker. Members of this protein family show similarity to other ferredoxin-like proteins, including a subunit of a polysulfide reductase.
Probab=83.60  E-value=0.5  Score=35.82  Aligned_cols=18  Identities=11%  Similarity=-0.129  Sum_probs=12.1

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|+.||.|+.+||.+|+.
T Consensus       126 ~C~~C~~C~~aCP~~A~~  143 (225)
T TIGR03149       126 LCVGCQYCIAACPYRVRF  143 (225)
T ss_pred             hCCcchHHHHhCCCCCcE
Confidence            456677777777777753


No 107
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family. This subset of the radical-SAM family (pfam04055) includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centered radical. The closest relatives to this family are the pyruvate-formate lyase activating enzyme (PflA, 1.97.1.4, TIGR02493) and the anaerobic ribonucleotide reductase activating enzyme (TIGR02491). Included within this subfamily are activators of hydroxyphenyl acetate decarboxylase (HdpA, ), benzylsuccinate synthase (BssD, ), gycerol dehydratase (DhaB2, ) as well as enzymes annotated in E. coli as activators of different isozymes of pyruvate-formate lyase (PFLC and PFLE) however, these appear to lack characterization and may activate enzymes with distinctive functions. Most of the sequence-level variability between these forms is concentrated within an N-terminal domain which follows a conserved group of three cysteines and contains a variable pattern of 0 
Probab=83.47  E-value=0.28  Score=38.17  Aligned_cols=21  Identities=14%  Similarity=0.178  Sum_probs=18.1

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|..||.|+.+||++|+..
T Consensus        81 ~~~C~~Cg~C~~~CP~~Ai~~  101 (295)
T TIGR02494        81 REKCTHCGKCTEACPSGALSI  101 (295)
T ss_pred             hhhcCchhHhhccCcHhHHhh
Confidence            446899999999999999854


No 108
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein. Members of this protein family are the Fe-S protein, NrfC, of a cytochrome c nitrite reductase system for which the pentaheme cytochrome c protein, NrfB (family TIGR03146) is an unambiguous marker. Members of this protein family show similarity to other ferredoxin-like proteins, including a subunit of a polysulfide reductase.
Probab=83.29  E-value=0.49  Score=35.87  Aligned_cols=23  Identities=4%  Similarity=-0.029  Sum_probs=18.9

Q ss_pred             ceeecccC----------ceecccCCcccccce
Q psy3842          74 LFLSELSG----------KRESTCAPAREGVME   96 (139)
Q Consensus        74 ~~~~~~~g----------~~~~~CPtgal~~~e   96 (139)
                      +..|+.|+          .|+++||++|+...+
T Consensus       151 ~~kC~~C~~~~~~~g~~P~Cv~~Cp~~Ai~f~~  183 (225)
T TIGR03149       151 ADKCNFCRDTNLAEGKLPACVESCPTKALTFGD  183 (225)
T ss_pred             cccCCCCCcchhhCCCCCcccccCccCCEEEec
Confidence            45889998          799999999986443


No 109
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed
Probab=82.57  E-value=0.47  Score=31.72  Aligned_cols=20  Identities=5%  Similarity=-0.290  Sum_probs=16.8

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|..|+.|+.+||++++...
T Consensus        52 ~Ci~C~~C~~~CP~~ai~~~   71 (105)
T PRK09624         52 KCVRCYLCYIYCPEPAIYLD   71 (105)
T ss_pred             HCcChhhHHhhCCHhhEEec
Confidence            57889999999999987543


No 110
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric. This model represents a single chain form of pyruvate:ferredoxin (or flavodoxin) oxidoreductase. This enzyme may transfer electrons to nitrogenase in nitrogen-fixing species. Portions of this protein are homologous to gamma subunit of the four subunit pyruvate:ferredoxin (flavodoxin) oxidoreductase.
Probab=82.22  E-value=0.59  Score=43.52  Aligned_cols=20  Identities=10%  Similarity=-0.125  Sum_probs=17.4

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||.|+.+||++|+..
T Consensus       683 ~~Ci~Cg~C~~vCP~~ai~~  702 (1165)
T TIGR02176       683 DNCIQCNQCAFVCPHAAIRP  702 (1165)
T ss_pred             ccCCCccchHHhcChhhccc
Confidence            36899999999999999853


No 111
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only. This model describes iron-only hydrogenases of anaerobic and microaerophilic bacteria and protozoa. This model is narrower, and covers a longer stretch of sequence, than Pfam model pfam02906. This family represents a division among families that belong to pfam02906, which also includes proteins such as nuclear prelamin A recognition factor in animals. Note that this family shows some heterogeneity in terms of periplasmic, cytosolic, or hydrogenosome location, NAD or NADP dependence, and overal protein protein length.
Probab=82.18  E-value=0.44  Score=38.79  Aligned_cols=20  Identities=10%  Similarity=-0.072  Sum_probs=17.8

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||.|+.+||++|+..
T Consensus        50 ~~C~~Cg~Cv~~CP~~Ai~~   69 (374)
T TIGR02512        50 SNCIGCGQCSLVCPVGAITE   69 (374)
T ss_pred             ccCcCccCHHHhCCCChhhh
Confidence            46899999999999999864


No 112
>PF12797 Fer4_2:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=82.16  E-value=0.35  Score=23.35  Aligned_cols=14  Identities=21%  Similarity=0.195  Sum_probs=12.3

Q ss_pred             eecccCceecccCC
Q psy3842          76 LSELSGKRESTCAP   89 (139)
Q Consensus        76 ~~~~~g~~~~~CPt   89 (139)
                      .|..|+.|+.+||+
T Consensus         9 rCiGC~~C~~AC~~   22 (22)
T PF12797_consen    9 RCIGCGACEVACPV   22 (22)
T ss_pred             cccCchhHHHhhCc
Confidence            58899999999985


No 113
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed
Probab=82.00  E-value=0.4  Score=33.47  Aligned_cols=19  Identities=11%  Similarity=-0.202  Sum_probs=16.6

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..||.|+.+||.+++..
T Consensus        60 ~Ci~C~~C~~~CP~~ai~~   78 (133)
T PRK09625         60 ICINCFNCWVYCPDAAILS   78 (133)
T ss_pred             HCcChhhHHHhCCHhheEe
Confidence            5789999999999998753


No 114
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only. This model describes iron-only hydrogenases of anaerobic and microaerophilic bacteria and protozoa. This model is narrower, and covers a longer stretch of sequence, than Pfam model pfam02906. This family represents a division among families that belong to pfam02906, which also includes proteins such as nuclear prelamin A recognition factor in animals. Note that this family shows some heterogeneity in terms of periplasmic, cytosolic, or hydrogenosome location, NAD or NADP dependence, and overal protein protein length.
Probab=81.99  E-value=0.56  Score=38.17  Aligned_cols=18  Identities=11%  Similarity=0.065  Sum_probs=16.3

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|..||.|+.+||++|+.
T Consensus         8 kCi~Cg~Cv~~CP~~ai~   25 (374)
T TIGR02512         8 KCIGCGRCVRACTNVQIV   25 (374)
T ss_pred             hCCcChHhhhhCCHhhcc
Confidence            588999999999999975


No 115
>PRK15055 anaerobic sulfite reductase subunit A; Provisional
Probab=81.88  E-value=0.57  Score=37.94  Aligned_cols=19  Identities=11%  Similarity=0.217  Sum_probs=16.9

Q ss_pred             cceeecccCceecccCCcc
Q psy3842          73 KLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtga   91 (139)
                      +...|+.||+|..+||++.
T Consensus       305 g~~~CvgCGrC~~~CP~~I  323 (344)
T PRK15055        305 GYHMCVGCGRCDDRCPEYI  323 (344)
T ss_pred             chhhCcCcCccccccCCCC
Confidence            5568999999999999985


No 116
>TIGR01660 narH nitrate reductase, beta subunit. The Nitrate reductase enzyme complex allows bacteria to use nitrate as an electron acceptor during anaerobic growth. The enzyme complex consists of a tetramer that has an alpha, beta and 2 gamma subunits. The alpha and beta subunits have catalytic activity and the gamma subunits attach the enzyme to the membrane and is a b-type cytochrome that receives electrons from the quinone pool and transfers them to the beta subunit. This model is specific for the beta subunit for nitrate reductase I (narH) and nitrate reductase II (narY) for gram positive and gram negative bacteria.A few thermophiles and archaea also match the model.The seed members used in this model are all experimentally characterized and include the following: NarH and NarY, both E.Coli, sequences from B. Subtilis, Pseudomonas fluorescens, Paracoccus denitrificans, and Halomonas halodenitrificans. This model also matches PFAM pfam00037 for 4Fe-4S binding domain.
Probab=80.41  E-value=0.6  Score=39.28  Aligned_cols=18  Identities=17%  Similarity=0.095  Sum_probs=11.8

Q ss_pred             eecccC--ceecccCCcccc
Q psy3842          76 LSELSG--KRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g--~~~~~CPtgal~   93 (139)
                      .|..|+  .|+.+||++|+.
T Consensus       182 ~C~HC~nP~CV~ACPtGAI~  201 (492)
T TIGR01660       182 LCEHCLNPACVASCPSGAIY  201 (492)
T ss_pred             cCcCCCcccchhhCccCCeE
Confidence            466665  677777777764


No 117
>PRK13795 hypothetical protein; Provisional
Probab=80.36  E-value=0.49  Score=41.24  Aligned_cols=20  Identities=10%  Similarity=0.037  Sum_probs=17.3

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|..||.|+.+||++++...
T Consensus       582 ~C~~Cg~C~~~CP~~ai~~~  601 (636)
T PRK13795        582 ECVGCGVCVGACPTGAIRIE  601 (636)
T ss_pred             cCCCHhHHHHhCCcccEEee
Confidence            68899999999999997653


No 118
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional
Probab=80.25  E-value=0.84  Score=33.20  Aligned_cols=19  Identities=11%  Similarity=-0.092  Sum_probs=15.5

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|+.||.|+.+||++|+..
T Consensus        88 ~C~~C~~C~~~CP~~ai~~  106 (181)
T PRK10330         88 RCIGCKTCVVACPYGAMEV  106 (181)
T ss_pred             hCCCcchhhhhCCccCeEe
Confidence            4678899999999998754


No 119
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein.
Probab=80.24  E-value=0.71  Score=33.94  Aligned_cols=20  Identities=5%  Similarity=-0.125  Sum_probs=16.9

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      ....|+.||.|+.+||++++
T Consensus        60 ~~~kCi~Cg~C~~aCP~~ai   79 (183)
T TIGR00403        60 EFDKCIACEVCVRVCPINLP   79 (183)
T ss_pred             CcccCcCcCChhhhCCCCcc
Confidence            34468999999999999975


No 120
>CHL00014 ndhI NADH dehydrogenase subunit I
Probab=80.24  E-value=0.61  Score=33.69  Aligned_cols=19  Identities=5%  Similarity=-0.153  Sum_probs=16.4

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      ...|+.||.|+.+||++++
T Consensus        58 ~~~Ci~Cg~C~~aCP~~~~   76 (167)
T CHL00014         58 FDKCIACEVCVRVCPIDLP   76 (167)
T ss_pred             cccCCCcCcHHHhCCCCCc
Confidence            3468999999999999975


No 121
>PRK07118 ferredoxin; Validated
Probab=80.15  E-value=0.51  Score=37.08  Aligned_cols=21  Identities=10%  Similarity=-0.065  Sum_probs=17.1

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|..||.|+++||++|+...+
T Consensus       140 ~CigCg~C~~aCp~~AI~~~~  160 (280)
T PRK07118        140 GCLGLGSCVAACPFDAIHIEN  160 (280)
T ss_pred             CCcChhHHHHhCCccCeEccC
Confidence            578899999999999976543


No 122
>PF13247 Fer4_11:  4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B ....
Probab=80.02  E-value=0.49  Score=31.39  Aligned_cols=14  Identities=7%  Similarity=0.067  Sum_probs=8.0

Q ss_pred             CceecccCCccccc
Q psy3842          81 GKRESTCAPAREGV   94 (139)
Q Consensus        81 g~~~~~CPtgal~~   94 (139)
                      +.|+.+||++||..
T Consensus        82 PaCv~~Cp~~Al~~   95 (98)
T PF13247_consen   82 PACVEACPTGALTF   95 (98)
T ss_dssp             -HHHHH-TTS-EEE
T ss_pred             ChhHHhccccceEE
Confidence            57777788777754


No 123
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. This model describes one of two paralogous families of archaealflavoprotein. The other, described by TIGR02699 and typified by the partially characterized AF1518 of Archaeoglobus fulgidus, is a homodimeric FMN-containing flavoprotein that accepts electrons from ferredoxin and can transfer them to various oxidoreductases. The function of this protein family is unknown.
Probab=79.96  E-value=0.71  Score=35.14  Aligned_cols=25  Identities=16%  Similarity=0.069  Sum_probs=19.7

Q ss_pred             eecccCceecccCCcccccc-eeeec
Q psy3842          76 LSELSGKRESTCAPAREGVM-EFLLV  100 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~-e~~l~  100 (139)
                      .|..||.|+.+||++|+... +|.+.
T Consensus       178 ~C~~Cg~C~~~CP~~AI~~~~~~~~~  203 (234)
T TIGR02700       178 KCVGCGKCKEACPYNAIHGGLEYEMR  203 (234)
T ss_pred             hCCccchHHhhCCCCceecCCceEEe
Confidence            57899999999999998654 45433


No 124
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein. Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB.
Probab=79.87  E-value=0.66  Score=38.26  Aligned_cols=21  Identities=10%  Similarity=-0.091  Sum_probs=15.7

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|..|+.|+++||++|+..
T Consensus        38 ~~~C~~C~~C~~~CP~~AI~~   58 (411)
T TIGR03224        38 ADVCNGCMACVSPCPTGAIDN   58 (411)
T ss_pred             cccCcCHHHHHhhcCccccee
Confidence            346778888888888888763


No 125
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit. This model describes the beta subunit of sulfite reductase.
Probab=79.19  E-value=0.65  Score=37.49  Aligned_cols=18  Identities=11%  Similarity=0.028  Sum_probs=16.3

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|..||.|+.+||++|+.
T Consensus       215 ~Ci~Cg~Ci~~CP~~a~~  232 (341)
T TIGR02066       215 KCIYCGNCYTMCPAMPIF  232 (341)
T ss_pred             cCCcCCchHHhCchhhcc
Confidence            588999999999999985


No 126
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]
Probab=78.82  E-value=0.73  Score=33.51  Aligned_cols=21  Identities=5%  Similarity=-0.143  Sum_probs=18.0

Q ss_pred             eecccCceecccCCcccccce
Q psy3842          76 LSELSGKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e   96 (139)
                      .|..||.|+.+||-||+....
T Consensus        83 kCiGC~~C~~aCPfGai~~~~  103 (165)
T COG1142          83 KCIGCKLCVVACPFGAITMVS  103 (165)
T ss_pred             hccCcchhhhcCCcceEEEEe
Confidence            578999999999999986544


No 127
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein. Succinate dehydrogenase and fumarate reductase are reverse directions of the same enzymatic interconversion, succinate + FAD+ = fumarate + FADH2 (EC 1.3.11.1). In E. coli, the forward and reverse reactions are catalyzed by distinct complexes: fumarate reductase operates under anaerobic conditions and succinate dehydrogenase operates under aerobic conditions. This model also describes a region of the B subunit of a cytosolic archaeal fumarate reductase.
Probab=78.76  E-value=0.92  Score=34.14  Aligned_cols=20  Identities=5%  Similarity=0.119  Sum_probs=17.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.||+|..+||++.-
T Consensus       192 ~~~~C~~Cg~C~~~CP~~I~  211 (220)
T TIGR00384       192 GVWRCTTCMNCSEVCPKGVN  211 (220)
T ss_pred             CCccCccccccccccCCCCC
Confidence            55689999999999999864


No 128
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional
Probab=78.60  E-value=0.6  Score=39.81  Aligned_cols=18  Identities=6%  Similarity=-0.118  Sum_probs=12.6

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|+.||.|+.+||++|+.
T Consensus       542 ~C~~Cg~C~~~CP~~Ai~  559 (564)
T PRK12771        542 KCTGCHICADVCPCGAIE  559 (564)
T ss_pred             cCcChhHHHhhcCcCceE
Confidence            466777777777777764


No 129
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family. Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase. Some species with this reductase lack NapC but accomplish electron transfer to NapAB in some other manner, likely to involve NapH, NapG, and/or some other protein. A few members of this protein are designated MauN and are found in methylamine utilization operons in species that appear to lack a periplasmic nitrate reductase.
Probab=78.32  E-value=0.69  Score=35.67  Aligned_cols=19  Identities=5%  Similarity=-0.139  Sum_probs=15.4

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      ...|+.|++|+++||+++.
T Consensus       200 ~~~C~~C~~C~~vCP~~~v  218 (255)
T TIGR02163       200 REKCTNCMDCFNVCPEPQV  218 (255)
T ss_pred             cccCeEcCCccCcCCCCce
Confidence            3458899999999999863


No 130
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=77.77  E-value=0.78  Score=42.16  Aligned_cols=20  Identities=10%  Similarity=0.150  Sum_probs=17.4

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|..||.|+++||++|+...
T Consensus       922 ~C~~CG~C~~vCP~~a~~~~  941 (1012)
T TIGR03315       922 MCNECGNCATFCPYDGAPYK  941 (1012)
T ss_pred             cccccchHHHhCCCCcccce
Confidence            49999999999999998543


No 131
>TIGR02912 sulfite_red_C sulfite reductase, subunit C. Members of this protein family include the C subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite.
Probab=77.07  E-value=0.93  Score=35.92  Aligned_cols=16  Identities=13%  Similarity=0.056  Sum_probs=14.0

Q ss_pred             eecccCceecccCCcc
Q psy3842          76 LSELSGKRESTCAPAR   91 (139)
Q Consensus        76 ~~~~~g~~~~~CPtga   91 (139)
                      .|..||.|+.+||..+
T Consensus       170 ~C~~Cg~C~~~Cp~~a  185 (314)
T TIGR02912       170 RCIGCGACVKVCKKKA  185 (314)
T ss_pred             cCCcchHHHHhcChhh
Confidence            5889999999999754


No 132
>PRK14993 tetrathionate reductase subunit B; Provisional
Probab=76.89  E-value=0.85  Score=35.08  Aligned_cols=18  Identities=6%  Similarity=-0.186  Sum_probs=11.3

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|..|+.|+.+||.+|+.
T Consensus       131 ~CigC~~Cv~aCP~~Ai~  148 (244)
T PRK14993        131 RCVGCAYCVQACPYDARF  148 (244)
T ss_pred             HCCCHHHHHHhcCCCCCE
Confidence            355666666666666654


No 133
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit. This model represents the iron-sulfur subunit, typically called the beta subunit, of various proteins that also contain a molybdopterin subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase.
Probab=76.84  E-value=0.75  Score=36.88  Aligned_cols=17  Identities=6%  Similarity=-0.121  Sum_probs=8.5

Q ss_pred             ecccCceecccCCcccc
Q psy3842          77 SELSGKRESTCAPAREG   93 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal~   93 (139)
                      |..|+.|+.+||.+|+.
T Consensus       164 CiGCg~Cv~ACPygAi~  180 (321)
T TIGR03478       164 CKGYRYCVEACPYKKVY  180 (321)
T ss_pred             CcchHHHHHhCCCCCcE
Confidence            44455555555555543


No 134
>PRK14993 tetrathionate reductase subunit B; Provisional
Probab=76.66  E-value=1  Score=34.66  Aligned_cols=22  Identities=5%  Similarity=-0.094  Sum_probs=17.9

Q ss_pred             ceeecccC---------ceecccCCcccccc
Q psy3842          74 LFLSELSG---------KRESTCAPAREGVM   95 (139)
Q Consensus        74 ~~~~~~~g---------~~~~~CPtgal~~~   95 (139)
                      +..|+.|+         .|+.+||++|+...
T Consensus       156 ~~KC~~C~~r~~~G~~PaCv~~CP~~Al~~g  186 (244)
T PRK14993        156 ADKCTFCVHRLEAGLLPACVESCVGGARIIG  186 (244)
T ss_pred             cccCcCCcchhhCCCCcccchhcccCCEEEc
Confidence            45788886         89999999998643


No 135
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional
Probab=76.40  E-value=0.72  Score=35.71  Aligned_cols=19  Identities=26%  Similarity=0.260  Sum_probs=16.2

Q ss_pred             eecccCceecccCCc--cccc
Q psy3842          76 LSELSGKRESTCAPA--REGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtg--al~~   94 (139)
                      .|+.||.|+.+||++  |+.+
T Consensus       185 ~C~gCG~C~~aCP~~~~AI~v  205 (254)
T PRK09476        185 ACTGCGKCEKACVLEKAAIKV  205 (254)
T ss_pred             HCcCcChhhHhcCCCcceEEE
Confidence            688999999999998  5544


No 136
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=75.92  E-value=1.4  Score=38.37  Aligned_cols=19  Identities=5%  Similarity=-0.104  Sum_probs=14.8

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|+.|+.|+.+||++|+..
T Consensus        86 ~C~~C~~C~~~CP~~ai~~  104 (654)
T PRK12769         86 KCIGCKSCVVACPFGTMQI  104 (654)
T ss_pred             cccCcChhcccCCccCeee
Confidence            5778888888888888753


No 137
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric. This model represents a single chain form of pyruvate:ferredoxin (or flavodoxin) oxidoreductase. This enzyme may transfer electrons to nitrogenase in nitrogen-fixing species. Portions of this protein are homologous to gamma subunit of the four subunit pyruvate:ferredoxin (flavodoxin) oxidoreductase.
Probab=75.81  E-value=1.1  Score=41.78  Aligned_cols=21  Identities=10%  Similarity=0.021  Sum_probs=17.5

Q ss_pred             ceeecccCceecccCCc--cccc
Q psy3842          74 LFLSELSGKRESTCAPA--REGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtg--al~~   94 (139)
                      ...|+.||.|+++||++  |+..
T Consensus       738 ~~~C~gCg~Cv~~CP~~~~Al~m  760 (1165)
T TIGR02176       738 PLDCTGCGNCVDICPAKEKALVM  760 (1165)
T ss_pred             cccCcCccchhhhcCCCCccccc
Confidence            45799999999999996  6643


No 138
>PRK05035 electron transport complex protein RnfC; Provisional
Probab=75.57  E-value=1  Score=39.72  Aligned_cols=17  Identities=12%  Similarity=0.126  Sum_probs=15.6

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      .|..||.|+++||.+.+
T Consensus       371 ~CI~CG~Cv~aCP~~ll  387 (695)
T PRK05035        371 PCIRCGACADACPASLL  387 (695)
T ss_pred             hcCCcccHHHHCCccch
Confidence            68899999999999987


No 139
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]
Probab=75.46  E-value=1.3  Score=33.30  Aligned_cols=21  Identities=10%  Similarity=0.078  Sum_probs=17.0

Q ss_pred             ceeeccc------C---ceecccCCccccc
Q psy3842          74 LFLSELS------G---KRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~------g---~~~~~CPtgal~~   94 (139)
                      |..|++|      |   +|+++|||+|+..
T Consensus       126 ~~KCt~C~~ri~~g~~PaCV~~CP~~A~~f  155 (203)
T COG0437         126 VDKCTFCVDRVAVGKLPACVEACPTGALIF  155 (203)
T ss_pred             ccccCcchhhHhcCCCCcccccCCcccccc
Confidence            6677877      6   8999999999864


No 140
>PRK10882 hydrogenase 2 protein HybA; Provisional
Probab=75.31  E-value=1.1  Score=36.12  Aligned_cols=45  Identities=11%  Similarity=0.192  Sum_probs=27.7

Q ss_pred             CCEEEcCCHHHHHHHHHHHHHHHH--------------hCCCCCCCcCCC---CcchhHHHH
Q psy3842           3 GWRVKTNSEMTRRAREGVMEFLLV--------------NHPLDCPICDQG---GECDLQDQS   47 (139)
Q Consensus         3 Gm~V~T~s~~v~~~r~~~lelll~--------------~h~~~C~~C~~~---g~C~Lq~l~   47 (139)
                      ++.+.++++++....+.++++...              .++..|..|...   ..|.++.+.
T Consensus        69 ~~~~~~~~~~l~~~~~~~I~~~~~~~~~~~d~~~~~~~~~~~~C~hC~~p~Cv~aCP~gAi~  130 (328)
T PRK10882         69 GEQTWDNPDKLSPYTNNIIKVWKSGTGVNKDQEENGYAYIKKQCMHCVDPNCVSVCPVSALT  130 (328)
T ss_pred             ccceecccccccccccceEEEEecCccccccccccccccccccCCCcCchhhHhhCCCCCEE
Confidence            456677777766666656654432              356788888643   456665554


No 141
>PRK09477 napH quinol dehydrogenase membrane component; Provisional
Probab=75.27  E-value=1.5  Score=34.17  Aligned_cols=20  Identities=5%  Similarity=-0.189  Sum_probs=16.1

Q ss_pred             ceeecccCceecccCCcccc
Q psy3842          74 LFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~   93 (139)
                      ...|..|+.|..+||+++..
T Consensus       207 ~~~C~~C~~C~~~CP~~~i~  226 (271)
T PRK09477        207 RQKCTRCMDCFHVCPEPQVL  226 (271)
T ss_pred             cccCcccCCcCCcCCCccee
Confidence            34588999999999998743


No 142
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit. This family consists of the iron-sulfur subunit, or chain B, of an enzyme called the anaerobic dimethyl sulfoxide reductase. Chains A and B are catalytic, while chain C is a membrane anchor.
Probab=75.03  E-value=0.94  Score=32.30  Aligned_cols=13  Identities=8%  Similarity=0.059  Sum_probs=8.6

Q ss_pred             ceecccCCccccc
Q psy3842          82 KRESTCAPAREGV   94 (139)
Q Consensus        82 ~~~~~CPtgal~~   94 (139)
                      .|+.+||++|+..
T Consensus       138 ~Cv~~Cp~~Ai~~  150 (161)
T TIGR02951       138 ACVDACPMRALDF  150 (161)
T ss_pred             cchhhccccceEE
Confidence            6777777776643


No 143
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional
Probab=74.99  E-value=1.8  Score=34.22  Aligned_cols=19  Identities=11%  Similarity=-0.170  Sum_probs=16.6

Q ss_pred             eeecccCceecccCCcccc
Q psy3842          75 FLSELSGKRESTCAPAREG   93 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~   93 (139)
                      ..|..|+.|..+||++++.
T Consensus       247 ~~Ci~C~~C~~~CP~~ai~  265 (312)
T PRK14028        247 SKCIMCRKCWLYCPDDAII  265 (312)
T ss_pred             ccCcCcccccccCChhhhh
Confidence            3689999999999999864


No 144
>PRK09898 hypothetical protein; Provisional
Probab=74.37  E-value=1.5  Score=32.64  Aligned_cols=20  Identities=5%  Similarity=-0.056  Sum_probs=16.0

Q ss_pred             eecccC--ceecccCCcccccc
Q psy3842          76 LSELSG--KRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g--~~~~~CPtgal~~~   95 (139)
                      .|..|+  .|+.+||++|+...
T Consensus       122 ~C~~C~~~~C~~~CP~gAi~~~  143 (208)
T PRK09898        122 TCRQCKEPQCMNVCPIGAITWQ  143 (208)
T ss_pred             cCCCccCcchhhhCCcceEEee
Confidence            578887  79999999997643


No 145
>PRK10882 hydrogenase 2 protein HybA; Provisional
Probab=74.24  E-value=1.3  Score=35.62  Aligned_cols=16  Identities=6%  Similarity=-0.139  Sum_probs=8.6

Q ss_pred             ecccCceecccCCccc
Q psy3842          77 SELSGKRESTCAPARE   92 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal   92 (139)
                      |+.|+.|+.+||.+++
T Consensus       145 CigCg~Cv~aCP~gai  160 (328)
T PRK10882        145 CTGCRYCMVACPFNVP  160 (328)
T ss_pred             cCcccHHHHhCCccce
Confidence            4455555555555554


No 146
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit. This model represents the molybdopterin subunit, typically called the alpha subunit, of various proteins that also contain an iron-sulfur subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase, ethylbenzene dehydrogenase, and an archaeal respiratory nitrate reductase. This alpha subunit has a twin-arginine translocation (TAT) signal for Sec-independent translocation across the plasma membrane.
Probab=74.18  E-value=1.4  Score=39.91  Aligned_cols=38  Identities=5%  Similarity=-0.213  Sum_probs=28.5

Q ss_pred             ceecccCCcccccc--------------eeeeccccccCCCCCCCCcchhHH
Q psy3842          82 KRESTCAPAREGVM--------------EFLLVNHPLDCPICDQGGECDLQD  119 (139)
Q Consensus        82 ~~~~~CPtgal~~~--------------e~~l~~~~~~C~~C~~g~~~eL~~  119 (139)
                      ..-.+||+||++..              .|.+..+++.|++|+.+|...++.
T Consensus        25 ~~~~~~pvga~~~~~~~~~~e~~yr~~~~wd~~~~~t~c~~C~~gC~l~v~V   76 (912)
T TIGR03479        25 AFGFLKPIQDPLKAYPYRDWEDLYRKEWTWDKVGRGAHLNNCTGSCAFYVYV   76 (912)
T ss_pred             hhccccccccccccCCCchHHHHhhhhhcccceeccccCCCccCCCCeEEEE
Confidence            47789999998721              133555788999999999887753


No 147
>COG2768 Uncharacterized Fe-S center protein [General function prediction only]
Probab=74.15  E-value=1.2  Score=35.72  Aligned_cols=20  Identities=10%  Similarity=-0.021  Sum_probs=17.8

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|..||.|+..||++|++..
T Consensus       194 kc~~c~~cv~~cp~~Ai~~~  213 (354)
T COG2768         194 KCYDCGLCVKICPVGAITLT  213 (354)
T ss_pred             cccccchhhhhCCCcceecc
Confidence            67899999999999998765


No 148
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated
Probab=74.02  E-value=1.1  Score=36.97  Aligned_cols=20  Identities=5%  Similarity=-0.170  Sum_probs=16.8

Q ss_pred             eecccCceecccCC-cccccc
Q psy3842          76 LSELSGKRESTCAP-AREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPt-gal~~~   95 (139)
                      .|+.||.|+.+||+ +|+...
T Consensus       378 ~C~~Cg~C~~~CP~~~Ai~~~  398 (420)
T PRK08318        378 ECVGCNLCAHVCPVEGCITMG  398 (420)
T ss_pred             hCcccchHHhhCCCCCCEEEe
Confidence            58899999999999 897543


No 149
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=73.88  E-value=1.7  Score=37.89  Aligned_cols=22  Identities=5%  Similarity=0.051  Sum_probs=18.2

Q ss_pred             ceeecccCc--eecccCCcccccc
Q psy3842          74 LFLSELSGK--RESTCAPAREGVM   95 (139)
Q Consensus        74 ~~~~~~~g~--~~~~CPtgal~~~   95 (139)
                      +..|..|+.  |+.+||++|+...
T Consensus        53 ~~~C~~C~~~~C~~~CP~~ai~~~   76 (654)
T PRK12769         53 AVTCHHCEDAPCARSCPNGAISHV   76 (654)
T ss_pred             CccCCCCCChhHhhhCCccceecc
Confidence            457889986  9999999997653


No 150
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit. This model describes the beta subunit of sulfite reductase.
Probab=73.54  E-value=2  Score=34.71  Aligned_cols=18  Identities=6%  Similarity=-0.112  Sum_probs=14.8

Q ss_pred             ecccCceecccCCccccc
Q psy3842          77 SELSGKRESTCAPAREGV   94 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal~~   94 (139)
                      |-.+|.|+++||++|++.
T Consensus       183 ~c~~~~Cv~~CP~~Ai~~  200 (341)
T TIGR02066       183 VCEIPSVVAACPTGALKP  200 (341)
T ss_pred             hcCCCceEeeCchhhcee
Confidence            335689999999999775


No 151
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the B subunit.
Probab=73.43  E-value=3.1  Score=29.94  Aligned_cols=28  Identities=18%  Similarity=0.220  Sum_probs=23.9

Q ss_pred             CCCCCCCCcchhHHHHHHhCCCCCCCCC
Q psy3842         106 CPICDQGGECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus       106 C~~C~~g~~~eL~~~~~~~gv~~~rf~~  133 (139)
                      ...|+.+++++||+++..+|++..+|.+
T Consensus        68 i~~C~~~g~c~l~~~a~~~gv~~~~~~~   95 (165)
T TIGR01944        68 INKCPPGGEAVILALAELLGVEPIPQPL   95 (165)
T ss_pred             cCcCccccHHHHHHHHHHcCCCcccCCc
Confidence            5568889999999999999998887654


No 152
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=72.57  E-value=1.8  Score=39.91  Aligned_cols=15  Identities=13%  Similarity=0.180  Sum_probs=12.3

Q ss_pred             ccCceecccCCcccc
Q psy3842          79 LSGKRESTCAPAREG   93 (139)
Q Consensus        79 ~~g~~~~~CPtgal~   93 (139)
                      .||.|+++||++|..
T Consensus       894 ~C~~C~~vCP~~A~~  908 (1019)
T PRK09853        894 VCEKCVDVCPNRANV  908 (1019)
T ss_pred             ccchhhhhCCccccc
Confidence            459999999999943


No 153
>PRK09326 F420H2 dehydrogenase subunit F; Provisional
Probab=72.45  E-value=0.86  Score=36.61  Aligned_cols=21  Identities=19%  Similarity=0.170  Sum_probs=17.7

Q ss_pred             eeecccCceecccCCcccccc
Q psy3842          75 FLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ..|+.||.|+.+||++++...
T Consensus        12 ~~C~gCg~C~~~CP~~aI~~~   32 (341)
T PRK09326         12 DVCTACGACEAVCPIGAITVD   32 (341)
T ss_pred             ccCcChHHHHHhCCHhhhecc
Confidence            368999999999999997543


No 154
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit. This model represents the iron-sulfur subunit, typically called the beta subunit, of various proteins that also contain a molybdopterin subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase.
Probab=72.36  E-value=1.6  Score=35.01  Aligned_cols=18  Identities=6%  Similarity=0.045  Sum_probs=15.9

Q ss_pred             eecccC--ceecccCCcccc
Q psy3842          76 LSELSG--KRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g--~~~~~CPtgal~   93 (139)
                      .|..|+  .|+++||++|+.
T Consensus       130 ~C~hC~nP~Cv~aCPtgAI~  149 (321)
T TIGR03478       130 ICNHCTNPACLAACPTGAIY  149 (321)
T ss_pred             cCCCCCCccchhhCCcCcEE
Confidence            677888  899999999985


No 155
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit. This family consists of the iron-sulfur subunit, or chain B, of an enzyme called the anaerobic dimethyl sulfoxide reductase. Chains A and B are catalytic, while chain C is a membrane anchor.
Probab=72.34  E-value=1.5  Score=31.17  Aligned_cols=18  Identities=6%  Similarity=-0.007  Sum_probs=11.0

Q ss_pred             eecccC--ceecccCCcccc
Q psy3842          76 LSELSG--KRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g--~~~~~CPtgal~   93 (139)
                      .|..|+  .|+.+||++|+.
T Consensus        63 ~C~~C~~~~C~~~CP~~ai~   82 (161)
T TIGR02951        63 SCNHCADPACVKNCPTGAMY   82 (161)
T ss_pred             cCCCcCCcchHHhCCCCCEE
Confidence            455566  666666666653


No 156
>PRK13984 putative oxidoreductase; Provisional
Probab=71.78  E-value=1.7  Score=37.35  Aligned_cols=21  Identities=10%  Similarity=-0.007  Sum_probs=17.4

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|..||.|+.+||++++..
T Consensus        44 ~~~Ci~C~~C~~~Cp~~ai~~   64 (604)
T PRK13984         44 WEKCIGCGTCSKICPTDAITM   64 (604)
T ss_pred             hhhCcCccchhhhCCccceEe
Confidence            345889999999999998653


No 157
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]
Probab=71.59  E-value=1.8  Score=32.07  Aligned_cols=19  Identities=11%  Similarity=0.043  Sum_probs=15.9

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .||.|+.|+..|||..+..
T Consensus       146 lCTGC~lCva~CPtdci~m  164 (198)
T COG2878         146 LCTGCDLCVAPCPTDCIEM  164 (198)
T ss_pred             HhcCCCcccCCCCCCceee
Confidence            5788999999999998754


No 158
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]
Probab=71.51  E-value=1.8  Score=34.01  Aligned_cols=23  Identities=17%  Similarity=0.052  Sum_probs=15.0

Q ss_pred             cceeecccCceecccCCcccccc
Q psy3842          73 KLFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ...-|..||.|.-+||..|+...
T Consensus        97 ~~~lC~GCgaC~~~CP~~AI~~~  119 (284)
T COG1149          97 NPDLCEGCGACSIVCPEPAIEEE  119 (284)
T ss_pred             CcccccCcccceeeCCCcccccc
Confidence            34467777777777777776543


No 159
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG. Member of this ferredoxin-like protein family are found exclusively in species with an operon encoding the cbb3 type of cytochrome c oxidase (cco-cbb3), and near the cco-cbb3 operon in about half the cases. The cco-cbb3 is found in a variety of proteobacteria and almost nowhere else, and is associated with oxygen use under microaerobic conditions. Some (but not all) of these proteobacteria are also nitrogen-fixing, hence the gene symbol fixG. FixG was shown essential for functional cco-cbb3 expression in Bradyrhizobium japonicum.
Probab=71.10  E-value=0.85  Score=38.06  Aligned_cols=18  Identities=11%  Similarity=-0.132  Sum_probs=15.6

Q ss_pred             ceeecccCceecccCCcc
Q psy3842          74 LFLSELSGKRESTCAPAR   91 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtga   91 (139)
                      ...|+.|+.|+.+||++.
T Consensus       230 ~~~Ci~C~~Cv~vCP~gi  247 (434)
T TIGR02745       230 LGDCIDCNLCVQVCPTGI  247 (434)
T ss_pred             CCCCCChhhhHHhCCCCC
Confidence            347899999999999994


No 160
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing. In addition to the gamma proteobacteria, a sequence from Aquifex aolicus falls within the scope of this model. This appears to be the case for the alpha, gamma and epsilon (accessory protein TIGR01562) chains as well.
Probab=71.04  E-value=1.5  Score=34.53  Aligned_cols=19  Identities=11%  Similarity=-0.151  Sum_probs=13.4

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+.+||.+++..
T Consensus       125 kCigC~~Cv~aCP~~a~~~  143 (283)
T TIGR01582       125 KCIGCGYCIVGCPFNIPRY  143 (283)
T ss_pred             HCCcchHHHhhCCCCCcEE
Confidence            4667777777777777643


No 161
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase. The D subunit of archaeal RNA polymerase (RNAP) is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. A single distinct RNAP complex is found in archaea, which may be responsible for the synthesis of all RNAs. The archaeal RNAP harbors homologues of all eukaryotic RNAP II subunits with two exceptions (RPB8 and RPB9). The 12 archaeal subunits are designated by letters and can be divided into three functional groups that are engaged in: (I) catalysis (A'/A", B'/B" or B); (II) assembly (L, N, D and P); and (III) auxiliary functions (F, E, H and K). The D subunit is equivalent to the RPB3 subunit of eukaryotic RNAP II. It contains two subdomains: one subdomain is similar the eukaryotic Rpb11/AC19/archaeal L subunit w
Probab=70.66  E-value=1.4  Score=34.02  Aligned_cols=19  Identities=16%  Similarity=0.141  Sum_probs=16.4

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+.+||++++..
T Consensus       170 ~C~~C~~C~~~CP~~vi~~  188 (259)
T cd07030         170 DCDGCGKCVEECPRGVLEL  188 (259)
T ss_pred             hCCChHHHHHhCCccceEc
Confidence            4778999999999999854


No 162
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit. During dissimilatory sulfate reduction and sulfur oxidation, adenylylsulfate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulfite and AMP. Found in several bacterial lineages and in Archaeoglobales, APS reductase is a heterodimer composed of an alpha subunit containing a noncovalently bound FAD, and a beta subunit containing two [4Fe-4S] clusters. Described by this model is the beta subunit of APS reductase, sharing common evolutionary origin with other iron-sulfur cluster-binding proteins.
Probab=70.22  E-value=1.6  Score=30.53  Aligned_cols=19  Identities=5%  Similarity=-0.083  Sum_probs=16.3

Q ss_pred             eecccC-----ceecccCCccccc
Q psy3842          76 LSELSG-----KRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g-----~~~~~CPtgal~~   94 (139)
                      .|+.||     .|+.+||++++..
T Consensus         9 ~C~gC~~~~~~~Cv~~CP~~ai~~   32 (132)
T TIGR02060         9 KCDGCKAGEKTACVYICPNDLMHL   32 (132)
T ss_pred             cccCccCCchhcCHhhcCccceEe
Confidence            578999     9999999998743


No 163
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional
Probab=70.02  E-value=2.1  Score=34.67  Aligned_cols=20  Identities=15%  Similarity=0.059  Sum_probs=17.2

Q ss_pred             ceeecccCceecccCCcccc
Q psy3842          74 LFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~   93 (139)
                      ...|..||.|.++||+.+..
T Consensus         6 ~~~Ci~Cg~C~~~CP~~~~~   25 (396)
T PRK11168          6 FDSCIKCTVCTTACPVARVN   25 (396)
T ss_pred             hhhcCCCCCCCccCCCcccC
Confidence            45799999999999999753


No 164
>TIGR01660 narH nitrate reductase, beta subunit. The Nitrate reductase enzyme complex allows bacteria to use nitrate as an electron acceptor during anaerobic growth. The enzyme complex consists of a tetramer that has an alpha, beta and 2 gamma subunits. The alpha and beta subunits have catalytic activity and the gamma subunits attach the enzyme to the membrane and is a b-type cytochrome that receives electrons from the quinone pool and transfers them to the beta subunit. This model is specific for the beta subunit for nitrate reductase I (narH) and nitrate reductase II (narY) for gram positive and gram negative bacteria.A few thermophiles and archaea also match the model.The seed members used in this model are all experimentally characterized and include the following: NarH and NarY, both E.Coli, sequences from B. Subtilis, Pseudomonas fluorescens, Paracoccus denitrificans, and Halomonas halodenitrificans. This model also matches PFAM pfam00037 for 4Fe-4S binding domain.
Probab=69.84  E-value=1.1  Score=37.77  Aligned_cols=33  Identities=12%  Similarity=-0.030  Sum_probs=23.1

Q ss_pred             eecccCceecccCCcccccceeeeccccccCCCCC
Q psy3842          76 LSELSGKRESTCAPAREGVMEFLLVNHPLDCPICD  110 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~e~~l~~~~~~C~~C~  110 (139)
                      .|..|+.|+.+||.+|+..-..  ......|.+|.
T Consensus       215 kCiGCg~CV~ACPygAI~~n~~--~g~~~KCd~C~  247 (492)
T TIGR01660       215 KCRGWRMCISGCPYKKIYFNWK--TGKSEKCIFCY  247 (492)
T ss_pred             hccChHHHHHhCCCCCcEecCC--CCccccCCCCh
Confidence            5789999999999999754322  12344677764


No 165
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]
Probab=69.75  E-value=2  Score=32.33  Aligned_cols=18  Identities=17%  Similarity=0.104  Sum_probs=12.1

Q ss_pred             eecccCceecccCCcccc
Q psy3842          76 LSELSGKRESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~   93 (139)
                      .|..||-|+.+||-||..
T Consensus       101 ~CIGC~yCi~ACPyga~~  118 (203)
T COG0437         101 LCIGCGYCIAACPYGAPQ  118 (203)
T ss_pred             cccCchHHHhhCCCCCce
Confidence            456777777777777754


No 166
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit. Indolepyruvate ferredoxin oxidoreductase (IOR) is an alpha 2/beta 2 tetramer related to ketoacid oxidoreductases for pyruvate (1.2.7.1, POR), 2-ketoglutarate (1.2.7.3, KOR), and 2-oxoisovalerate (1.2.7.7, VOR). These multi-subunit enzymes typically are found in anaerobes and are inactiviated by oxygen. IOR in Pyrococcus acts in fermentation of all three aromatic amino acids, following removal of the amino group by transamination. In Methanococcus maripaludis, by contrast, IOR acts in the opposite direction, in pathways of amino acid biosynthesis from phenylacetate, indoleacetate, and p-hydroxyphenylacetate. In M. maripaludis and many other species, iorA and iorB are found next to an apparent phenylacetate-CoA ligase.
Probab=69.47  E-value=1.2  Score=38.37  Aligned_cols=17  Identities=18%  Similarity=0.128  Sum_probs=13.9

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      .|..||.|+++||++|+
T Consensus       579 ~C~~Cg~C~~~CP~~Ai  595 (595)
T TIGR03336       579 LCTGCGVCAQICPFDAI  595 (595)
T ss_pred             CCcCHHHHHhhCccccC
Confidence            58888888888888874


No 167
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. This protein is a predicted to bind FeS clusters, based on the presence of two copies of the Fer4 domain (pfam00037), with each copy having four Cys residues invariant across all members.
Probab=69.09  E-value=1.3  Score=36.49  Aligned_cols=20  Identities=15%  Similarity=-0.086  Sum_probs=16.9

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||.|+.+||++|+..
T Consensus       330 ~~Ci~CGaCV~aCP~~AI~~  349 (391)
T TIGR03287       330 EDCFGCGYCAEICPGGAFEV  349 (391)
T ss_pred             HhCcChHHHHhhCCccceEE
Confidence            35889999999999999754


No 168
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=69.02  E-value=2.1  Score=37.19  Aligned_cols=19  Identities=5%  Similarity=-0.092  Sum_probs=14.3

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+.+||++|+..
T Consensus        86 ~C~gC~~C~~~CP~~ai~~  104 (639)
T PRK12809         86 KCIGCKRCAIACPFGVVEM  104 (639)
T ss_pred             hCcchhhHhhhcCCCCEEc
Confidence            4677888888888887643


No 169
>PF13534 Fer4_17:  4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B ....
Probab=68.81  E-value=1.2  Score=26.21  Aligned_cols=17  Identities=12%  Similarity=0.128  Sum_probs=11.7

Q ss_pred             ecccCceecccCCcccc
Q psy3842          77 SELSGKRESTCAPAREG   93 (139)
Q Consensus        77 ~~~~g~~~~~CPtgal~   93 (139)
                      |+.||.|+.+||++..+
T Consensus         2 C~~Cg~C~~~CP~~~~~   18 (61)
T PF13534_consen    2 CTQCGYCVPACPSYIAT   18 (61)
T ss_dssp             ----STTGGGSHHHHHC
T ss_pred             CCCCCcCcccCCCcccc
Confidence            68899999999998764


No 170
>PF04879 Molybdop_Fe4S4:  Molybdopterin oxidoreductase Fe4S4 domain;  InterPro: IPR006963 The molybdopterin oxidoreductase Fe4S4 domain is found in a number of reductase/dehydrogenase families, which include the periplasmic nitrate reductase precursor and the formate dehydrogenase alpha chain [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 2VPZ_A 2VPY_A 2VPW_A 2VPX_A 2NYA_A 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 ....
Probab=68.57  E-value=1.3  Score=25.68  Aligned_cols=19  Identities=32%  Similarity=0.651  Sum_probs=13.1

Q ss_pred             cccccCCCCCCCCcchhHH
Q psy3842         101 NHPLDCPICDQGGECDLQD  119 (139)
Q Consensus       101 ~~~~~C~~C~~g~~~eL~~  119 (139)
                      ..++.|++|+.+|..++..
T Consensus         3 ~~~t~C~~C~~gC~i~~~v   21 (55)
T PF04879_consen    3 TVPTVCPYCSSGCGIDVYV   21 (55)
T ss_dssp             EEEEE-SSCTT--EEEEEE
T ss_pred             EEeeECcCCcCCCcEEEEE
Confidence            4578999999999988865


No 171
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma. This model represents that clade of F420-dependent hydrogenases (FRH) beta subunits found exclusively and universally in methanogenic archaea. This protein contains two 4Fe-4S cluster binding domains (pfam00037) and scores above the trusted cutoff to model pfam01058 for the "NADH ubiquinone oxidoreductase, 20 Kd subunit" family.
Probab=68.01  E-value=1.2  Score=33.97  Aligned_cols=19  Identities=16%  Similarity=0.226  Sum_probs=16.3

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+.+||++++..
T Consensus       175 ~C~~C~~C~~aCP~~ai~~  193 (228)
T TIGR03294       175 LCMGCGTCAAACPTRAIEM  193 (228)
T ss_pred             hCcChhHHHHhCCHhhEEE
Confidence            5778999999999999754


No 172
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the C subunit.
Probab=66.96  E-value=2.8  Score=34.92  Aligned_cols=18  Identities=17%  Similarity=-0.003  Sum_probs=15.4

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||.|.++||.+.+
T Consensus       363 ~~Ci~Cg~C~~vCP~~l~  380 (435)
T TIGR01945       363 KPCIRCGKCVQVCPMNLL  380 (435)
T ss_pred             CcCcCccchhhhCccchh
Confidence            478899999999999853


No 173
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed
Probab=66.95  E-value=2.7  Score=31.90  Aligned_cols=20  Identities=10%  Similarity=0.114  Sum_probs=17.5

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.||+|..+||.+..
T Consensus       196 ~i~~C~~Cg~C~~~CP~gi~  215 (232)
T PRK05950        196 GVFRCHTIMNCVEVCPKGLN  215 (232)
T ss_pred             ccccCcCcCCcCccccCCCC
Confidence            56789999999999999864


No 174
>PRK15449 ferredoxin-like protein FixX; Provisional
Probab=66.83  E-value=1.7  Score=28.71  Aligned_cols=14  Identities=7%  Similarity=-0.031  Sum_probs=12.1

Q ss_pred             CceecccCCccccc
Q psy3842          81 GKRESTCAPAREGV   94 (139)
Q Consensus        81 g~~~~~CPtgal~~   94 (139)
                      ..|+.+||++|+..
T Consensus        37 k~C~~aCPagA~~~   50 (95)
T PRK15449         37 ELLVKACPAGLYKK   50 (95)
T ss_pred             hHHHHHCCHhhcEe
Confidence            48999999999854


No 175
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]
Probab=66.76  E-value=3.3  Score=32.66  Aligned_cols=19  Identities=21%  Similarity=0.097  Sum_probs=17.1

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..||.|.++|+-+|+..
T Consensus        70 ~C~~CG~C~~vC~f~Ai~~   88 (284)
T COG1149          70 KCIRCGKCAEVCRFGAIVV   88 (284)
T ss_pred             hccccCcHHHhCCCCeEEE
Confidence            4999999999999999953


No 176
>PRK05113 electron transport complex protein RnfB; Provisional
Probab=66.74  E-value=5.8  Score=29.32  Aligned_cols=26  Identities=19%  Similarity=0.432  Sum_probs=22.3

Q ss_pred             CCCCCCCcchhHHHHHHhCCCCCCCC
Q psy3842         107 PICDQGGECDLQDQSMAFGSDRSRFT  132 (139)
Q Consensus       107 ~~C~~g~~~eL~~~~~~~gv~~~rf~  132 (139)
                      ..|.++++|+||+++..+|++..+|.
T Consensus        71 ~~C~~~G~c~lq~la~~~Gv~~~~~~   96 (191)
T PRK05113         71 NKCPPGGEATMLKLAELLGVEPQPLD   96 (191)
T ss_pred             CcCCCCchHHHHHHHHHhCCCcccCc
Confidence            45788999999999999999877764


No 177
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C. The last step in methanogenesis leaves two coenzymes of methanogenesis, CoM and CoB, linked by a disulfide bond. Members of this protein family are the C subunit of the enzyme that reduces the heterodisulfide to CoB-SH and CoM-SH. Similar enzyme complex subunits are found in various other species, but likely act on a different substrate.
Probab=66.42  E-value=2.5  Score=29.58  Aligned_cols=20  Identities=10%  Similarity=0.253  Sum_probs=17.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      ....|+.||.|..+||.+..
T Consensus        44 ~~~~C~~Cg~C~~~CP~~i~   63 (144)
T TIGR03290        44 DLWMCTTCYTCQERCPRDVK   63 (144)
T ss_pred             CCCcCcCcCchhhhcCCCCC
Confidence            45589999999999999875


No 178
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. This protein is a predicted to bind FeS clusters, based on the presence of two copies of the Fer4 domain (pfam00037), with each copy having four Cys residues invariant across all members.
Probab=66.19  E-value=1.5  Score=36.11  Aligned_cols=19  Identities=11%  Similarity=-0.031  Sum_probs=16.2

Q ss_pred             eecccCcee--cccCCccccc
Q psy3842          76 LSELSGKRE--STCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~--~~CPtgal~~   94 (139)
                      .|+.|+.|.  ++||++++..
T Consensus       303 kCi~Cg~C~~~~aCPt~AI~~  323 (391)
T TIGR03287       303 RCENCDPCLVEEACPVPAIKK  323 (391)
T ss_pred             hCcCCCCCcCCcCCCHhhEec
Confidence            588999995  9999999763


No 179
>PF06902 Fer4_19:  Divergent 4Fe-4S mono-cluster;  InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues. These ferredoxins each bind a 3Fe-4S cluster. Ferredoxin-soy (SoyB) act as electron transport protein for the cytochrome P450-SOY system []. Ferredoxin-1 (SuaB) and Ferredoxin-2 (SubB) act as electron transport proteins for the herbicide-metabolising cytochrome P-450 SU1 and SU2 systems, respectively [, ]. Ferredoxin-fas2 also plays a role in electrontransfer, the fas operon encoding genes involved in cytokinin production and in host plant fasciation (leafy gall).
Probab=65.49  E-value=2.3  Score=25.92  Aligned_cols=14  Identities=7%  Similarity=0.159  Sum_probs=11.4

Q ss_pred             ceecccCCcccccc
Q psy3842          82 KRESTCAPAREGVM   95 (139)
Q Consensus        82 ~~~~~CPtgal~~~   95 (139)
                      +.++.||.|||...
T Consensus        49 ~~v~~CPSGAL~~~   62 (64)
T PF06902_consen   49 EAVDRCPSGALSYW   62 (64)
T ss_pred             HHHHcCCccCcEEe
Confidence            56789999999754


No 180
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated
Probab=65.42  E-value=3  Score=32.25  Aligned_cols=20  Identities=15%  Similarity=0.185  Sum_probs=17.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|..||.|..+||.+.-
T Consensus       210 gv~~C~~Cg~Cs~VCPk~I~  229 (250)
T PRK07570        210 GFGNCTNTGECEAVCPKGIS  229 (250)
T ss_pred             CcccCcccCccccccCCCCC
Confidence            45679999999999999874


No 181
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=65.21  E-value=2.6  Score=36.61  Aligned_cols=18  Identities=6%  Similarity=0.038  Sum_probs=9.6

Q ss_pred             eecccCc--eecccCCcccc
Q psy3842          76 LSELSGK--RESTCAPAREG   93 (139)
Q Consensus        76 ~~~~~g~--~~~~CPtgal~   93 (139)
                      .|..|+.  |+.+||++|+.
T Consensus        55 ~C~~C~~~~C~~~CP~~ai~   74 (639)
T PRK12809         55 ACHHCNNAPCVTACPVNALT   74 (639)
T ss_pred             CCcCcCChhHHhhCCcCcee
Confidence            4455554  55555555543


No 182
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional
Probab=64.61  E-value=2.1  Score=33.08  Aligned_cols=19  Identities=21%  Similarity=0.158  Sum_probs=12.1

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|+.|+.|+.+||++|+..
T Consensus       200 ~C~~C~~Ci~~CP~~AI~i  218 (263)
T PRK00783        200 NCSLCKLCERACPGKAIRV  218 (263)
T ss_pred             hCCCchHHHHhCCCCceEE
Confidence            3566677777777666543


No 183
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional
Probab=64.57  E-value=2.8  Score=32.24  Aligned_cols=20  Identities=10%  Similarity=0.285  Sum_probs=17.2

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.||+|..+||.+.-
T Consensus       201 gl~~C~~C~~C~~vCP~~I~  220 (244)
T PRK12385        201 GVWSCTFVGYCSEVCPKHVD  220 (244)
T ss_pred             hhhhCcCcccccccCCCCCC
Confidence            55689999999999999864


No 184
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]
Probab=64.01  E-value=2.7  Score=35.14  Aligned_cols=20  Identities=15%  Similarity=0.071  Sum_probs=16.7

Q ss_pred             ceeecccCceecccCCcccc
Q psy3842          74 LFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~   93 (139)
                      .+-|..||+|..+||+-+..
T Consensus       307 ~L~CIRCGaC~n~CPvY~~i  326 (459)
T COG1139         307 ALRCIRCGACLNHCPVYRHI  326 (459)
T ss_pred             HHHhhcchHhhhcChhhhhc
Confidence            34688999999999997763


No 185
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed
Probab=63.88  E-value=2.9  Score=32.23  Aligned_cols=20  Identities=20%  Similarity=0.197  Sum_probs=16.5

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      ....|..||.|.++||+...
T Consensus       150 ~~~~CI~CG~C~saCP~~~~  169 (249)
T PRK08640        150 ELSKCMTCGCCLEACPNVNE  169 (249)
T ss_pred             hhhhccCcCcccccCCCCcc
Confidence            34579999999999998753


No 186
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional
Probab=62.83  E-value=3.4  Score=31.68  Aligned_cols=21  Identities=14%  Similarity=0.082  Sum_probs=17.8

Q ss_pred             ccceeecccCceecccCCccc
Q psy3842          72 EKLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtgal   92 (139)
                      .+...|+.||+|..+||.+..
T Consensus       203 ~gi~~C~~C~~C~~vCPk~I~  223 (239)
T PRK13552        203 DGVFGCMSLLGCEDNCPKDLP  223 (239)
T ss_pred             CCcCCCcCcCccchhCCCCCc
Confidence            356799999999999998754


No 187
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional
Probab=62.78  E-value=3.3  Score=31.70  Aligned_cols=20  Identities=15%  Similarity=0.218  Sum_probs=17.4

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.||+|..+||.|..
T Consensus       199 gl~~C~~C~~C~~vCPkgI~  218 (235)
T PRK12575        199 RLFRCRTIMNCVDVCPKGLN  218 (235)
T ss_pred             CcccccCcchhccccCCCCc
Confidence            46789999999999999864


No 188
>TIGR00273 iron-sulfur cluster-binding protein. Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy. Members probably bind two 4fe-4S iron-sulfur clusters.
Probab=62.53  E-value=2.8  Score=35.03  Aligned_cols=20  Identities=25%  Similarity=0.376  Sum_probs=17.2

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      ....|+.||.|.++||++.-
T Consensus       341 ~~~~C~~Cg~C~~vCP~gI~  360 (432)
T TIGR00273       341 LPYLSSLCGACREVCPVKIP  360 (432)
T ss_pred             cCccchhhhhhhccCCCCCc
Confidence            34689999999999999864


No 189
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated
Probab=60.70  E-value=3.9  Score=31.64  Aligned_cols=18  Identities=11%  Similarity=0.065  Sum_probs=15.3

Q ss_pred             ceeecccCceecccCCcc
Q psy3842          74 LFLSELSGKRESTCAPAR   91 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtga   91 (139)
                      ...|..||.|.++||+..
T Consensus       156 ~~~CI~CG~C~saCP~~~  173 (250)
T PRK07570        156 AAACIGCGACVAACPNGS  173 (250)
T ss_pred             ccccCCCcccccccCCcc
Confidence            346899999999999963


No 190
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed
Probab=60.33  E-value=4  Score=31.46  Aligned_cols=20  Identities=5%  Similarity=-0.046  Sum_probs=17.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.||+|..+||.|..
T Consensus       207 g~~~C~~Cg~C~~vCPkgI~  226 (249)
T PRK08640        207 GIADCGNAQNCVRVCPKGIP  226 (249)
T ss_pred             CeeCCcCcCcccccCCCCCC
Confidence            45789999999999999864


No 191
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase. The D subunit of archaeal RNA polymerase (RNAP) is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. A single distinct RNAP complex is found in archaea, which may be responsible for the synthesis of all RNAs. The archaeal RNAP harbors homologues of all eukaryotic RNAP II subunits with two exceptions (RPB8 and RPB9). The 12 archaeal subunits are designated by letters and can be divided into three functional groups that are engaged in: (I) catalysis (A'/A", B'/B" or B); (II) assembly (L, N, D and P); and (III) auxiliary functions (F, E, H and K). The D subunit is equivalent to the RPB3 subunit of eukaryotic RNAP II. It contains two subdomains: one subdomain is similar the eukaryotic Rpb11/AC19/archaeal L subunit w
Probab=59.86  E-value=2.8  Score=32.27  Aligned_cols=19  Identities=21%  Similarity=0.179  Sum_probs=16.7

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|+.|+.|+.+||.+|+..
T Consensus       200 ~C~~C~~C~~~Cp~~AI~~  218 (259)
T cd07030         200 DCSLCKLCERACDAGAIRV  218 (259)
T ss_pred             hCcCchHHHHhCCCCcEEE
Confidence            6889999999999998754


No 192
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein. Succinate dehydrogenase and fumarate reductase are reverse directions of the same enzymatic interconversion, succinate + FAD+ = fumarate + FADH2 (EC 1.3.11.1). In E. coli, the forward and reverse reactions are catalyzed by distinct complexes: fumarate reductase operates under anaerobic conditions and succinate dehydrogenase operates under aerobic conditions. This model also describes a region of the B subunit of a cytosolic archaeal fumarate reductase.
Probab=59.83  E-value=3.9  Score=30.71  Aligned_cols=18  Identities=28%  Similarity=0.170  Sum_probs=15.6

Q ss_pred             ceeecccCceecccCCcc
Q psy3842          74 LFLSELSGKRESTCAPAR   91 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtga   91 (139)
                      ...|..||.|.++||+..
T Consensus       137 ~~~Ci~CG~C~~~CP~~~  154 (220)
T TIGR00384       137 LSGCILCGCCYSSCPAFW  154 (220)
T ss_pred             hhhccccccccccCCCCc
Confidence            457899999999999974


No 193
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing. In addition to the gamma proteobacteria, a sequence from Aquifex aolicus falls within the scope of this model. This appears to be the case for the alpha, gamma and epsilon (accessory protein TIGR01562) chains as well.
Probab=59.78  E-value=2.6  Score=33.24  Aligned_cols=21  Identities=14%  Similarity=0.162  Sum_probs=16.7

Q ss_pred             ceeeccc---------CceecccCCccccc
Q psy3842          74 LFLSELS---------GKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~---------g~~~~~CPtgal~~   94 (139)
                      +..|+.|         ++|+.+||++|+..
T Consensus       150 ~~KC~~C~dr~~~G~~PaCv~aCP~gAi~f  179 (283)
T TIGR01582       150 PYKCTLCIDRVSVGQEPACVKTCPTNAISF  179 (283)
T ss_pred             hhhhcccccccccCCCChHhCcccHhhEEE
Confidence            4567777         48999999999853


No 194
>TIGR00273 iron-sulfur cluster-binding protein. Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy. Members probably bind two 4fe-4S iron-sulfur clusters.
Probab=59.34  E-value=3.8  Score=34.20  Aligned_cols=19  Identities=16%  Similarity=0.305  Sum_probs=16.1

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      +..|..||.|..+||+-+.
T Consensus       292 ~~~CIrCG~C~~~CPvy~~  310 (432)
T TIGR00273       292 VLACIRCGACQNECPVYRH  310 (432)
T ss_pred             HhhCCCCCCccccCcchhc
Confidence            4579999999999998754


No 195
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional
Probab=59.06  E-value=4.1  Score=31.94  Aligned_cols=20  Identities=10%  Similarity=0.107  Sum_probs=17.2

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.||+|..+||.+..
T Consensus       204 ~i~~C~~Cg~C~~~CP~~I~  223 (279)
T PRK12576        204 SSWRCTYCYSCSNVCPRDIE  223 (279)
T ss_pred             cCCcccCcccchhhCCCCCc
Confidence            45689999999999998763


No 196
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional
Probab=58.85  E-value=4.3  Score=31.82  Aligned_cols=19  Identities=16%  Similarity=0.088  Sum_probs=15.9

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      ...|..||.|.++||+.+.
T Consensus       151 ~~~CI~CG~C~~~CP~~~~  169 (279)
T PRK12576        151 FAQCIWCGLCVSACPVVAI  169 (279)
T ss_pred             chhCcccCcccccCCCccc
Confidence            3478999999999998753


No 197
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional
Probab=58.16  E-value=3.8  Score=35.00  Aligned_cols=19  Identities=5%  Similarity=-0.185  Sum_probs=15.3

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..|+.|+.+||++++..
T Consensus       511 ~c~~C~~C~~~Cp~~ai~~  529 (564)
T PRK12771        511 NCFECDNCYGACPQDAIIK  529 (564)
T ss_pred             cccccchhhhhCChhheee
Confidence            3456799999999999754


No 198
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]
Probab=57.42  E-value=5.7  Score=34.06  Aligned_cols=19  Identities=16%  Similarity=0.039  Sum_probs=17.3

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|+.||.|+. ||-+|++.-
T Consensus       562 ~C~gC~~C~~-Cpf~ais~~  580 (622)
T COG1148         562 KCTGCGICAE-CPFGAISVD  580 (622)
T ss_pred             hhcCCcceee-CCCCceecc
Confidence            5889999999 999999876


No 199
>PRK13795 hypothetical protein; Provisional
Probab=57.34  E-value=3.2  Score=36.24  Aligned_cols=19  Identities=16%  Similarity=0.130  Sum_probs=17.0

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..||.|+++||++++..
T Consensus       613 ~C~~Cg~C~~aCP~~a~~~  631 (636)
T PRK13795        613 KCIHCGKCTEVCPVVKYKD  631 (636)
T ss_pred             hcCChhHHHhhcCCCeeEe
Confidence            6889999999999998765


No 200
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional
Probab=56.96  E-value=5.1  Score=30.69  Aligned_cols=20  Identities=15%  Similarity=0.146  Sum_probs=16.2

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      ....|..||.|.++||+.+.
T Consensus       142 ~~~~CI~CG~C~s~CP~~~~  161 (235)
T PRK12575        142 GLYECILCACCSTACPSYWW  161 (235)
T ss_pred             hhhhCcccccccccccCccc
Confidence            34579999999999998643


No 201
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated
Probab=56.37  E-value=5.2  Score=32.94  Aligned_cols=16  Identities=13%  Similarity=0.115  Sum_probs=14.0

Q ss_pred             eecccCceecccCCcc
Q psy3842          76 LSELSGKRESTCAPAR   91 (139)
Q Consensus        76 ~~~~~g~~~~~CPtga   91 (139)
                      .|+.||.|+.+||.++
T Consensus       343 ~C~~C~~C~~~Cp~~~  358 (420)
T PRK08318        343 KCIGCGRCYIACEDTS  358 (420)
T ss_pred             HCCCCCcccccCCCcc
Confidence            5889999999999863


No 202
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional
Probab=55.85  E-value=5.7  Score=30.76  Aligned_cols=21  Identities=10%  Similarity=0.108  Sum_probs=17.9

Q ss_pred             ccceeecccCceecccCCccc
Q psy3842          72 EKLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtgal   92 (139)
                      .+...|..|++|.++||-|..
T Consensus       197 ~gl~~C~~C~~C~~vCPkgI~  217 (251)
T PRK12386        197 HGLGYCNITKCCTEVCPEHIK  217 (251)
T ss_pred             cCcccCcCCCCcCCcCCCCcC
Confidence            356789999999999999864


No 203
>PRK15055 anaerobic sulfite reductase subunit A; Provisional
Probab=55.29  E-value=5.1  Score=32.52  Aligned_cols=16  Identities=13%  Similarity=0.094  Sum_probs=14.3

Q ss_pred             ceeecccCceecccCC
Q psy3842          74 LFLSELSGKRESTCAP   89 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPt   89 (139)
                      +.-|..||+|..+|||
T Consensus       225 ~~rCi~Cg~C~~~CPt  240 (344)
T PRK15055        225 DSRCIACGRCNFVCPT  240 (344)
T ss_pred             HhhCccCccccccCCc
Confidence            3478999999999999


No 204
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=55.17  E-value=4.5  Score=37.40  Aligned_cols=20  Identities=10%  Similarity=0.102  Sum_probs=17.3

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..||+|+.+||+.+.-.
T Consensus       926 ~~C~~CG~C~~~CP~~~~py  945 (1019)
T PRK09853        926 AMCNECGNCAQFCPWNGKPY  945 (1019)
T ss_pred             ccCccccchhhhCCCCCCcc
Confidence            57999999999999998643


No 205
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=53.54  E-value=6.7  Score=36.27  Aligned_cols=15  Identities=13%  Similarity=0.153  Sum_probs=13.3

Q ss_pred             ccCceecccCCcccc
Q psy3842          79 LSGKRESTCAPAREG   93 (139)
Q Consensus        79 ~~g~~~~~CPtgal~   93 (139)
                      .||.|+.+||.+|+.
T Consensus       889 ~Cg~Cv~vCP~~Aii  903 (1012)
T TIGR03315       889 VCEKCVDVCPNRANI  903 (1012)
T ss_pred             CCCChhhhCChhhhh
Confidence            499999999999863


No 206
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit. This model describes the alpha subunit of sulfite reductase.
Probab=53.15  E-value=6.6  Score=32.52  Aligned_cols=15  Identities=7%  Similarity=0.034  Sum_probs=11.6

Q ss_pred             CceecccCCcccccc
Q psy3842          81 GKRESTCAPAREGVM   95 (139)
Q Consensus        81 g~~~~~CPtgal~~~   95 (139)
                      .+|+++|||+|+...
T Consensus       248 ~~~v~~Cp~~ai~~~  262 (402)
T TIGR02064       248 NEVVNRCPTKAISWD  262 (402)
T ss_pred             hhHhhcCCccccccC
Confidence            358899999998654


No 207
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]
Probab=52.86  E-value=4.9  Score=34.45  Aligned_cols=22  Identities=9%  Similarity=0.143  Sum_probs=18.5

Q ss_pred             ceeecccCceecccCCcccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      +..|..||-|..+||.||+...
T Consensus       586 ~~~C~gCG~C~~aCp~gai~~~  607 (622)
T COG1148         586 PLRCKGCGICSAACPSGAIDLA  607 (622)
T ss_pred             hhhhCcccchhhhCCcccchhc
Confidence            4478899999999999997644


No 208
>TIGR02910 sulfite_red_A sulfite reductase, subunit A. Members of this protein family include the A subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite.
Probab=52.23  E-value=6.1  Score=31.94  Aligned_cols=17  Identities=12%  Similarity=0.256  Sum_probs=14.8

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      .-|..||+|..+|||=.
T Consensus       220 ~rCi~C~~C~~~CPtC~  236 (334)
T TIGR02910       220 SRCIACGRCNTVCPTCT  236 (334)
T ss_pred             hhCCcCccccccCCceE
Confidence            46899999999999955


No 209
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]
Probab=52.15  E-value=5.2  Score=34.12  Aligned_cols=20  Identities=15%  Similarity=0.122  Sum_probs=17.5

Q ss_pred             eecccCceecccCCcccccc
Q psy3842          76 LSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~~   95 (139)
                      .|..||-|+.-||-+|+...
T Consensus        51 lCiGCGICvkkCPF~AI~Iv   70 (591)
T COG1245          51 LCIGCGICVKKCPFDAISIV   70 (591)
T ss_pred             hhccchhhhccCCcceEEEe
Confidence            57899999999999998654


No 210
>COG3592 Uncharacterized conserved protein [Function unknown]
Probab=51.84  E-value=3.8  Score=25.49  Aligned_cols=18  Identities=22%  Similarity=0.051  Sum_probs=13.7

Q ss_pred             cccCceecccCCcccccc
Q psy3842          78 ELSGKRESTCAPAREGVM   95 (139)
Q Consensus        78 ~~~g~~~~~CPtgal~~~   95 (139)
                      +.--++++.||.|||..+
T Consensus        55 e~i~~vi~sCPSGAl~Y~   72 (74)
T COG3592          55 EEIVKVIDTCPSGALKYR   72 (74)
T ss_pred             HHHHHHHHhCCchhhhee
Confidence            344578999999998754


No 211
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit
Probab=50.75  E-value=6.7  Score=30.86  Aligned_cols=20  Identities=15%  Similarity=0.288  Sum_probs=17.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.|++|..+||.|..
T Consensus       242 gl~~C~~C~~C~~vCPkgI~  261 (276)
T PLN00129        242 KLYRCHTIRNCSNACPKGLN  261 (276)
T ss_pred             CCCcCcChhhccccCCCCCC
Confidence            55789999999999999863


No 212
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional
Probab=50.71  E-value=6.7  Score=30.36  Aligned_cols=20  Identities=10%  Similarity=0.037  Sum_probs=16.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      ....|..||.|.++||+...
T Consensus       140 ~~~~CI~CG~C~s~CPv~~~  159 (251)
T PRK12386        140 EFRKCIECFLCQNVCHVVRD  159 (251)
T ss_pred             chhhcccCCcccCcCCcccc
Confidence            34478999999999998753


No 213
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional
Probab=50.09  E-value=6.4  Score=31.56  Aligned_cols=20  Identities=10%  Similarity=0.002  Sum_probs=17.3

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.|+.|..+||.+.-
T Consensus       207 giw~C~~C~~C~~~CPk~I~  226 (329)
T PRK12577        207 GVWGCTRCYYCNSVCPMEVA  226 (329)
T ss_pred             ccccCcChhhhhhhCCCCCc
Confidence            45689999999999999863


No 214
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG. Member of this ferredoxin-like protein family are found exclusively in species with an operon encoding the cbb3 type of cytochrome c oxidase (cco-cbb3), and near the cco-cbb3 operon in about half the cases. The cco-cbb3 is found in a variety of proteobacteria and almost nowhere else, and is associated with oxygen use under microaerobic conditions. Some (but not all) of these proteobacteria are also nitrogen-fixing, hence the gene symbol fixG. FixG was shown essential for functional cco-cbb3 expression in Bradyrhizobium japonicum.
Probab=49.81  E-value=4.3  Score=33.92  Aligned_cols=17  Identities=12%  Similarity=0.020  Sum_probs=14.6

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||.|+++||. ++
T Consensus       255 ~~Ci~Cg~CidaCp~-a~  271 (434)
T TIGR02745       255 LECINCGLCIDACDD-VM  271 (434)
T ss_pred             hhChhhhHHHHhCCC-hH
Confidence            368999999999998 54


No 215
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion]
Probab=49.77  E-value=8  Score=29.72  Aligned_cols=20  Identities=10%  Similarity=0.252  Sum_probs=17.0

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      +...|+.+++|.++||.+--
T Consensus       196 gv~~C~~~~~C~~vCPK~i~  215 (234)
T COG0479         196 GVWRCTTCGNCTEVCPKGIP  215 (234)
T ss_pred             CEecccccccccccCCCCCC
Confidence            45689999999999999853


No 216
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional
Probab=49.35  E-value=7.3  Score=31.22  Aligned_cols=18  Identities=22%  Similarity=0.126  Sum_probs=15.4

Q ss_pred             ceeecccCceecccCCcc
Q psy3842          74 LFLSELSGKRESTCAPAR   91 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtga   91 (139)
                      ...|..||.|.++||+..
T Consensus       151 ~~~Ci~CG~C~s~CP~~~  168 (329)
T PRK12577        151 TGNCILCGACYSECNARE  168 (329)
T ss_pred             hhhCcccCcccccCCCCC
Confidence            456999999999999874


No 217
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional
Probab=49.21  E-value=6.2  Score=30.24  Aligned_cols=18  Identities=11%  Similarity=0.014  Sum_probs=15.1

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||.|.++||+...
T Consensus       149 ~~CI~Cg~C~saCP~~~~  166 (239)
T PRK13552        149 DRCIECGCCVAACGTKQM  166 (239)
T ss_pred             hhccccchhHhhCCCCcc
Confidence            468999999999997653


No 218
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit
Probab=49.12  E-value=8.3  Score=30.34  Aligned_cols=17  Identities=12%  Similarity=0.216  Sum_probs=14.7

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      ..|..||.|.++||+-.
T Consensus       187 ~~CI~CG~C~saCPv~~  203 (276)
T PLN00129        187 YECILCACCSTSCPSYW  203 (276)
T ss_pred             hhCccccccccccCCCc
Confidence            47999999999999753


No 219
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional
Probab=48.94  E-value=7.5  Score=29.86  Aligned_cols=17  Identities=12%  Similarity=-0.058  Sum_probs=14.8

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      ..|..||.|.++||+..
T Consensus       147 ~~CI~Cg~C~saCP~~~  163 (244)
T PRK12385        147 SGCINCGLCYAACPQFG  163 (244)
T ss_pred             HhcCcCccccCcCcCcc
Confidence            47999999999999953


No 220
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA.  ACS forms a heterotetramer with carbon monoxide dehydrogenase (CODH) consisting of two ACS and two CODH subunits. CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP).  ACS has three structural domains, an N-terminal rossman fold domain with a helical region at its N-terminus which interacts with CODH, and two alpha + beta fold domains.  A Ni-Fe-S center referred to as the A-cluster is located in the C-terminal domain. A large cavity exists between the three domains which may bind CoA.
Probab=48.80  E-value=5.3  Score=35.62  Aligned_cols=19  Identities=16%  Similarity=0.158  Sum_probs=16.6

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      ...|+.||+|.++||+++-
T Consensus       402 ~~~Ct~CG~C~evCP~gIp  420 (731)
T cd01916         402 FDQCVGCGRCEQECPKEIP  420 (731)
T ss_pred             HhhhhhhhHHhhhCCCCCC
Confidence            4579999999999999983


No 221
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]
Probab=48.75  E-value=7.7  Score=32.52  Aligned_cols=20  Identities=15%  Similarity=0.300  Sum_probs=17.2

Q ss_pred             ccceeecccCceecccCCcc
Q psy3842          72 EKLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtga   91 (139)
                      +.+..|+.||.|..+||+..
T Consensus       355 ~~~~~c~lcg~C~evCPv~I  374 (459)
T COG1139         355 DLPYACSLCGACTEVCPVKI  374 (459)
T ss_pred             ccchhhccccCCCCcCCCCC
Confidence            34568999999999999986


No 222
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed
Probab=48.65  E-value=7.6  Score=29.42  Aligned_cols=17  Identities=18%  Similarity=0.323  Sum_probs=14.9

Q ss_pred             ceeecccCceecccCCc
Q psy3842          74 LFLSELSGKRESTCAPA   90 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtg   90 (139)
                      ...|..||.|.++||+.
T Consensus       140 ~~~Ci~Cg~C~~~CP~~  156 (232)
T PRK05950        140 LYECILCACCSTSCPSF  156 (232)
T ss_pred             HHhccccccccccCCcc
Confidence            44789999999999986


No 223
>PRK13409 putative ATPase RIL; Provisional
Probab=48.22  E-value=7.8  Score=33.54  Aligned_cols=19  Identities=16%  Similarity=0.100  Sum_probs=16.9

Q ss_pred             eecccCceecccCCccccc
Q psy3842          76 LSELSGKRESTCAPAREGV   94 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal~~   94 (139)
                      .|..||-|+.-||-.|+..
T Consensus        50 ~c~~c~~c~~~cp~~a~~i   68 (590)
T PRK13409         50 LCIGCGICVKKCPFDAISI   68 (590)
T ss_pred             hccccccccccCCcceEEE
Confidence            5789999999999999864


No 224
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit. Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species.
Probab=48.10  E-value=8.4  Score=31.28  Aligned_cols=19  Identities=11%  Similarity=-0.024  Sum_probs=16.1

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      ...|..||.|.++||+-..
T Consensus         4 ~~~Ci~Cg~C~~~Cp~~~~   22 (397)
T TIGR03379         4 FESCIKCTVCTVYCPVAKA   22 (397)
T ss_pred             hhhCCCCCCCcccCcCccc
Confidence            3468999999999999754


No 225
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]
Probab=48.09  E-value=22  Score=27.54  Aligned_cols=25  Identities=12%  Similarity=0.057  Sum_probs=20.2

Q ss_pred             cccceeecccCceecccCCcccccc
Q psy3842          71 REKLFLSELSGKRESTCAPAREGVM   95 (139)
Q Consensus        71 ~~~~~~~~~~g~~~~~CPtgal~~~   95 (139)
                      ++.-..|..||-|...||+-|+.-.
T Consensus       186 l~qg~~C~G~~TC~A~CP~~ai~c~  210 (247)
T COG1941         186 LEQGLPCMGCGTCAASCPSRAIPCR  210 (247)
T ss_pred             ecCCCcccCchhhhccCCccCCccc
Confidence            4455678999999999999998654


No 226
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional
Probab=47.96  E-value=7.7  Score=31.59  Aligned_cols=21  Identities=19%  Similarity=0.142  Sum_probs=17.7

Q ss_pred             ccceeecccCceecccCCccc
Q psy3842          72 EKLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtgal   92 (139)
                      +....|+.||.|..+||.+..
T Consensus        70 ~~~~~C~~C~~C~~~CP~~v~   90 (407)
T PRK11274         70 LHLDRCLTCRNCETTCPSGVQ   90 (407)
T ss_pred             cccccCccccchhhhCCCCCC
Confidence            346689999999999999853


No 227
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional
Probab=46.73  E-value=9.2  Score=32.03  Aligned_cols=22  Identities=23%  Similarity=0.309  Sum_probs=18.5

Q ss_pred             ccceeecccCceecccCCcccc
Q psy3842          72 EKLFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtgal~   93 (139)
                      ++...|+.||.|..+||.|...
T Consensus       182 ~~~~~C~~C~~C~~~CP~gi~~  203 (486)
T PRK06259        182 EGLYNCTTCGKCVEVCPKEIDI  203 (486)
T ss_pred             CCCcCCCCcCcccCcCCCCCCc
Confidence            4567899999999999998654


No 228
>PRK13984 putative oxidoreductase; Provisional
Probab=46.54  E-value=6.7  Score=33.70  Aligned_cols=20  Identities=5%  Similarity=-0.008  Sum_probs=16.6

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      ..|..|+.|+++||++|+..
T Consensus        86 ~~c~~c~~c~~~Cp~~Ai~~  105 (604)
T PRK13984         86 GRCSFCALCVDICTTGSLKM  105 (604)
T ss_pred             ccCcCcchHHhhCCcCcEEe
Confidence            35788999999999998643


No 229
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion]
Probab=44.71  E-value=11  Score=30.26  Aligned_cols=20  Identities=20%  Similarity=0.157  Sum_probs=17.3

Q ss_pred             ceeecccCceecccCCcccc
Q psy3842          74 LFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~   93 (139)
                      ...|+.||.|.++||+-..+
T Consensus         8 ~~~Cv~Cg~C~~~CP~~~~~   27 (388)
T COG0247           8 LDKCVHCGFCTNVCPSYRAT   27 (388)
T ss_pred             HHhcCCCCcccCcCCCcccc
Confidence            44799999999999998875


No 230
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional
Probab=44.36  E-value=11  Score=30.73  Aligned_cols=20  Identities=20%  Similarity=0.102  Sum_probs=16.5

Q ss_pred             cceeecccCceecccCCccc
Q psy3842          73 KLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtgal   92 (139)
                      .+..|..||.|..+||+-..
T Consensus        21 ~~~~C~~Cg~C~~~CP~~~~   40 (407)
T PRK11274         21 ILRKCVHCGFCTATCPTYQL   40 (407)
T ss_pred             HHHhCccCCCccccCCcccc
Confidence            34479999999999998654


No 231
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional
Probab=43.93  E-value=11  Score=30.50  Aligned_cols=20  Identities=20%  Similarity=0.253  Sum_probs=17.9

Q ss_pred             ccceeecccCceecccCCcc
Q psy3842          72 EKLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtga   91 (139)
                      ..+..|..||.|..+||.+.
T Consensus        51 ~~~~~C~~C~~C~~~CP~~i   70 (396)
T PRK11168         51 ESLKYCSNCKRCEVACPSGV   70 (396)
T ss_pred             CCCCcCcCcCccCcccCCCC
Confidence            46678999999999999986


No 232
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=43.56  E-value=11  Score=14.11  Aligned_cols=6  Identities=17%  Similarity=0.556  Sum_probs=3.2

Q ss_pred             cccCCc
Q psy3842          85 STCAPA   90 (139)
Q Consensus        85 ~~CPtg   90 (139)
                      ..||.|
T Consensus         4 ~nCP~G    9 (9)
T PF00220_consen    4 RNCPIG    9 (9)
T ss_pred             ccCCCC
Confidence            446654


No 233
>PRK09326 F420H2 dehydrogenase subunit F; Provisional
Probab=43.50  E-value=9.9  Score=30.51  Aligned_cols=18  Identities=11%  Similarity=0.003  Sum_probs=15.3

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||.|..+||+.+.
T Consensus        53 ~~C~~Cg~C~~vCP~~~~   70 (341)
T PRK09326         53 NVCEGCLTCSRICPVVDG   70 (341)
T ss_pred             CcCcCcCchhhhCCCCcc
Confidence            468999999999998654


No 234
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated
Probab=43.19  E-value=7.7  Score=34.82  Aligned_cols=17  Identities=18%  Similarity=0.118  Sum_probs=15.5

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      ..|+.||.|.++||++.
T Consensus       442 ~~Ct~CG~CeeVCPtgI  458 (781)
T PRK00941        442 DKCIGCGRCEQVCPKNI  458 (781)
T ss_pred             hhccchhHHhhhCCCCC
Confidence            47999999999999986


No 235
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=42.51  E-value=12  Score=28.00  Aligned_cols=21  Identities=19%  Similarity=0.120  Sum_probs=17.7

Q ss_pred             ceeecccCceecccCCccccc
Q psy3842          74 LFLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~~   94 (139)
                      ...|-.||.|-..||.++.+.
T Consensus        38 l~~C~QCG~CT~sCPs~r~t~   58 (195)
T COG1150          38 LEGCYQCGTCTGSCPSGRFTD   58 (195)
T ss_pred             HhHhhccCcccCCCCCcccCC
Confidence            345999999999999999753


No 236
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional
Probab=42.08  E-value=11  Score=31.47  Aligned_cols=19  Identities=26%  Similarity=0.086  Sum_probs=16.3

Q ss_pred             cceeecccCceecccCCcc
Q psy3842          73 KLFLSELSGKRESTCAPAR   91 (139)
Q Consensus        73 ~~~~~~~~g~~~~~CPtga   91 (139)
                      ....|..||.|.++||+.+
T Consensus       131 ~~~~Ci~CG~C~~~CP~~~  149 (486)
T PRK06259        131 KLRGCIECLSCVSTCPARK  149 (486)
T ss_pred             CchhcccCccccccCCCCc
Confidence            4457999999999999875


No 237
>KOG0421|consensus
Probab=41.76  E-value=36  Score=24.33  Aligned_cols=30  Identities=20%  Similarity=0.308  Sum_probs=26.4

Q ss_pred             CCCCEEEcCCHHHHHHHHHHHHHHHHhCCC
Q psy3842           1 MKGWRVKTNSEMTRRAREGVMEFLLVNHPL   30 (139)
Q Consensus         1 ~~Gm~V~T~s~~v~~~r~~~lelll~~h~~   30 (139)
                      .++|.|.-.-.-.++.|+.+|.||+++.+.
T Consensus        19 a~~m~v~~~~~V~KRLq~ELm~Lmms~~~g   48 (175)
T KOG0421|consen   19 AAPMAVVDGHSVTKRLQSELMGLMMSNTPG   48 (175)
T ss_pred             CCCcccccCchHHHHHHHHHHHHHhcCCCC
Confidence            368888888889999999999999999875


No 238
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit. Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species.
Probab=41.29  E-value=13  Score=30.27  Aligned_cols=21  Identities=19%  Similarity=0.235  Sum_probs=18.1

Q ss_pred             ccceeecccCceecccCCccc
Q psy3842          72 EKLFLSELSGKRESTCAPARE   92 (139)
Q Consensus        72 ~~~~~~~~~g~~~~~CPtgal   92 (139)
                      +.+..|..|+.|..+||.+.-
T Consensus        49 ~~~~~C~~C~~C~~~CP~~i~   69 (397)
T TIGR03379        49 EALKYCTNCKRCEVACPSDVK   69 (397)
T ss_pred             cccccCcCcCccchhcCCCCC
Confidence            456789999999999999864


No 239
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit. This model represents the NqrA subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=41.20  E-value=10  Score=31.83  Aligned_cols=17  Identities=12%  Similarity=-0.181  Sum_probs=15.0

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      .|..||+|+++||.+-+
T Consensus       374 aCI~CG~C~~vCPm~L~  390 (447)
T TIGR01936       374 AMIPIGIYERVMPLDIP  390 (447)
T ss_pred             ceeECChHhhcCCCCCC
Confidence            57899999999999864


No 240
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit. This model describes the alpha subunit of sulfite reductase.
Probab=39.93  E-value=12  Score=30.93  Aligned_cols=16  Identities=0%  Similarity=-0.373  Sum_probs=13.9

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      .|+.|+.|+.+||. |+
T Consensus       273 ~C~~Cm~Ci~~~p~-a~  288 (402)
T TIGR02064       273 ECVRCMHCINKMPK-AL  288 (402)
T ss_pred             hcCcCccccccCcc-cc
Confidence            58899999999998 44


No 241
>PF13223 DUF4031:  Protein of unknown function (DUF4031)
Probab=38.88  E-value=18  Score=23.32  Aligned_cols=20  Identities=20%  Similarity=0.240  Sum_probs=16.5

Q ss_pred             cchhHHHHHHhCCCCCCCCC
Q psy3842         114 ECDLQDQSMAFGSDRSRFTD  133 (139)
Q Consensus       114 ~~eL~~~~~~~gv~~~rf~~  133 (139)
                      --||+.+|.++|+.+.-|..
T Consensus        23 ~~ELHafA~riGv~rr~fq~   42 (83)
T PF13223_consen   23 LDELHAFAARIGVPRRWFQR   42 (83)
T ss_pred             HHHHHHHHHHcCCCHHHHcC
Confidence            44999999999998765766


No 242
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion]
Probab=36.79  E-value=11  Score=30.42  Aligned_cols=19  Identities=16%  Similarity=0.046  Sum_probs=16.0

Q ss_pred             eeecccCceecccCCccccc
Q psy3842          75 FLSELSGKRESTCAPAREGV   94 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~~   94 (139)
                      -.|+.||.|+.+||. +++.
T Consensus         5 ~~c~~Cg~C~a~cp~-~i~~   23 (332)
T COG1035           5 GLCTGCGTCAAVCPY-AITE   23 (332)
T ss_pred             cccccchhhHhhCCc-eEEE
Confidence            468999999999999 6654


No 243
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit. Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex. Carbon monoxide dehydrogenase is a synonym. The ACDS complex carries out an unusual reaction involving the reversible cleavage and synthesis of acetyl-CoA in methanogens. The model contains the prosite signature for 4Fe-4S ferredoxins [C-x(2)-C-x(2)-C-x(3)-C-[PEG]] between residues 448-462 of the model.
Probab=36.29  E-value=11  Score=33.87  Aligned_cols=16  Identities=19%  Similarity=0.308  Sum_probs=14.8

Q ss_pred             eecccCceecccCCcc
Q psy3842          76 LSELSGKRESTCAPAR   91 (139)
Q Consensus        76 ~~~~~g~~~~~CPtga   91 (139)
                      .|+.||.|.++||++.
T Consensus       438 ~C~~CG~C~evCP~gI  453 (784)
T TIGR00314       438 QCYACGRCEQACPKNI  453 (784)
T ss_pred             hhhhhhHHhccCCCCC
Confidence            6999999999999984


No 244
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional
Probab=35.88  E-value=14  Score=30.97  Aligned_cols=18  Identities=11%  Similarity=-0.204  Sum_probs=15.2

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||+|.++||.+-+
T Consensus       374 ~~CI~Cg~C~~vCP~~L~  391 (448)
T PRK05352        374 RAMVPIGNYERVMPLDIL  391 (448)
T ss_pred             cceeecCcHhhcCCCCCC
Confidence            378899999999999643


No 245
>COG2768 Uncharacterized Fe-S center protein [General function prediction only]
Probab=35.11  E-value=14  Score=29.83  Aligned_cols=19  Identities=11%  Similarity=-0.022  Sum_probs=16.5

Q ss_pred             eeecccCceecccCCcccc
Q psy3842          75 FLSELSGKRESTCAPAREG   93 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal~   93 (139)
                      ..|..|+.|.++||+||..
T Consensus       221 ~~ci~c~~c~~ac~~gav~  239 (354)
T COG2768         221 EKCIGCGQCMEACPYGAVD  239 (354)
T ss_pred             hhccchhhhhhhccCcccc
Confidence            3678999999999999964


No 246
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA.  ACS forms a heterotetramer with carbon monoxide dehydrogenase (CODH) consisting of two ACS and two CODH subunits. CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP).  ACS has three structural domains, an N-terminal rossman fold domain with a helical region at its N-terminus which interacts with CODH, and two alpha + beta fold domains.  A Ni-Fe-S center referred to as the A-cluster is located in the C-terminal domain. A large cavity exists between the three domains which may bind CoA.
Probab=33.97  E-value=18  Score=32.32  Aligned_cols=17  Identities=12%  Similarity=0.055  Sum_probs=15.0

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      ..|+.||.|..+||++.
T Consensus       365 ~kCI~CG~Cv~aCP~~l  381 (731)
T cd01916         365 AKCTDCGWCTRACPNSL  381 (731)
T ss_pred             hcCCCCCcccccCCCCC
Confidence            36899999999999984


No 247
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=33.93  E-value=10  Score=22.27  Aligned_cols=14  Identities=36%  Similarity=0.911  Sum_probs=7.3

Q ss_pred             HHHhCCCCCCCcCC
Q psy3842          24 LLVNHPLDCPICDQ   37 (139)
Q Consensus        24 ll~~h~~~C~~C~~   37 (139)
                      +.++||..||.|++
T Consensus        19 ~~S~~PatCP~C~a   32 (54)
T PF09237_consen   19 SQSEQPATCPICGA   32 (54)
T ss_dssp             CTTS--EE-TTT--
T ss_pred             hccCCCCCCCcchh
Confidence            45789999999986


No 248
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the C subunit.
Probab=33.38  E-value=19  Score=29.96  Aligned_cols=19  Identities=16%  Similarity=0.093  Sum_probs=16.0

Q ss_pred             ceeecccCceecccCCccc
Q psy3842          74 LFLSELSGKRESTCAPARE   92 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal   92 (139)
                      ...|..||.|..+||.+.-
T Consensus       401 ~~~C~~Cg~C~~vCP~~i~  419 (435)
T TIGR01945       401 LMDCIECGCCSYVCPSNIP  419 (435)
T ss_pred             CCcCCcCCCcccccCCCCC
Confidence            3578999999999999753


No 249
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]
Probab=32.65  E-value=15  Score=32.19  Aligned_cols=20  Identities=10%  Similarity=-0.034  Sum_probs=17.1

Q ss_pred             ceeecccCceecccCCcccc
Q psy3842          74 LFLSELSGKRESTCAPAREG   93 (139)
Q Consensus        74 ~~~~~~~g~~~~~CPtgal~   93 (139)
                      ...|..||.|+++||-.|+.
T Consensus       607 ~~~C~GCg~C~~iCP~~a~~  626 (640)
T COG4231         607 PSSCNGCGSCVEVCPSFAIK  626 (640)
T ss_pred             ccccccchhhhhcCchhhee
Confidence            34699999999999999874


No 250
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit. Indolepyruvate ferredoxin oxidoreductase (IOR) is an alpha 2/beta 2 tetramer related to ketoacid oxidoreductases for pyruvate (1.2.7.1, POR), 2-ketoglutarate (1.2.7.3, KOR), and 2-oxoisovalerate (1.2.7.7, VOR). These multi-subunit enzymes typically are found in anaerobes and are inactiviated by oxygen. IOR in Pyrococcus acts in fermentation of all three aromatic amino acids, following removal of the amino group by transamination. In Methanococcus maripaludis, by contrast, IOR acts in the opposite direction, in pathways of amino acid biosynthesis from phenylacetate, indoleacetate, and p-hydroxyphenylacetate. In M. maripaludis and many other species, iorA and iorB are found next to an apparent phenylacetate-CoA ligase.
Probab=31.87  E-value=16  Score=31.67  Aligned_cols=17  Identities=12%  Similarity=-0.107  Sum_probs=14.4

Q ss_pred             eeecccCceec--ccCCcc
Q psy3842          75 FLSELSGKRES--TCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~--~CPtga   91 (139)
                      ..|+.||.|+.  .||...
T Consensus       550 ~~C~~C~~C~~~~~CP~~~  568 (595)
T TIGR03336       550 DKCIGCKKCIKELGCPAIE  568 (595)
T ss_pred             CcCCCccccccccCCCCcc
Confidence            46899999999  999654


No 251
>PRK05035 electron transport complex protein RnfC; Provisional
Probab=31.64  E-value=20  Score=31.82  Aligned_cols=18  Identities=17%  Similarity=0.165  Sum_probs=15.7

Q ss_pred             eeecccCceecccCCccc
Q psy3842          75 FLSELSGKRESTCAPARE   92 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtgal   92 (139)
                      ..|..||.|..+||.+.-
T Consensus       409 ~~CieCG~C~~vCPs~Ip  426 (695)
T PRK05035        409 FDCIECGACAYVCPSNIP  426 (695)
T ss_pred             hhccccCcccccCCCCCc
Confidence            479999999999999853


No 252
>PF13459 Fer4_15:  4Fe-4S single cluster domain
Probab=31.64  E-value=14  Score=21.98  Aligned_cols=14  Identities=7%  Similarity=-0.223  Sum_probs=12.2

Q ss_pred             eecccCceecccCC
Q psy3842          76 LSELSGKRESTCAP   89 (139)
Q Consensus        76 ~~~~~g~~~~~CPt   89 (139)
                      .|..||.|+..||-
T Consensus         7 ~C~gcg~C~~~aP~   20 (65)
T PF13459_consen    7 RCIGCGLCVELAPE   20 (65)
T ss_pred             cCcCccHHHhhCCc
Confidence            58899999999984


No 253
>PF03091 CutA1:  CutA1 divalent ion tolerance protein;  InterPro: IPR004323  The CutA family of proteins which exhibit ion tolerance are found in a large variety of species []. In E.Coli, two operons on the cutA locus contain genes that encode three proteins, CutA1, CutA2 and CutA3. CutA1 proteins are found in the cytoplasm while CutA2 (50kDa) and CutA3 (24kDa) are located in the inner membrane. Although the role of E. Coli CutA1 is not clear, studies on E. coli cutA locus describe some mutations that lead to an increase in copper sensitivity, thus suggesting a role in ion tolerance []. To date, the structure of CutA proteins from several species have been solved [, ]. The crystal structures of the E.Coli and rat CutA1 proteins show both these proteins to be trimeric in the crystal as well as in solution[].Trimerisation seems to supported by the formation of beta sheets between the subunit. This trimeric structure suggests the protein may be involved in signal transduction due to architectural similarities with PII signal transducer proteins []. Recent studies propose that mammalian CutA1 in the neuronal cell membrane acts as an anchor for acetylcholinesterase (AChE)1 [].; GO: 0010038 response to metal ion; PDB: 1O5J_A 1KR4_A 1VHF_A 3GSD_H 1OSC_A 3OPK_A 4E98_C 1V9B_F 1UKU_A 2E66_C ....
Probab=30.67  E-value=37  Score=22.49  Aligned_cols=26  Identities=23%  Similarity=0.305  Sum_probs=18.9

Q ss_pred             CEEEcCCHHHHHHHHHHHHHHHHhCCCCCC
Q psy3842           4 WRVKTNSEMTRRAREGVMEFLLVNHPLDCP   33 (139)
Q Consensus         4 m~V~T~s~~v~~~r~~~lelll~~h~~~C~   33 (139)
                      +.+.|.+....+    +.++|.+.||-+.|
T Consensus        54 l~~KT~~~~~~~----l~~~i~~~HpYe~P   79 (102)
T PF03091_consen   54 LLIKTTASRFDE----LEERIRELHPYEVP   79 (102)
T ss_dssp             EEEEEEGGGHHH----HHHHHHHHSSSSS-
T ss_pred             EEEEecHHHHHH----HHHHHHHhCCCCCC
Confidence            456777776665    66777888999987


No 254
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion]
Probab=30.36  E-value=15  Score=31.50  Aligned_cols=17  Identities=6%  Similarity=-0.093  Sum_probs=15.4

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      .|..|+.|+++||+.-+
T Consensus       366 sCi~C~~C~d~CP~~Ll  382 (529)
T COG4656         366 SCIRCSLCADACPVNLL  382 (529)
T ss_pred             ccccHHHHHHhCccccC
Confidence            78899999999999865


No 255
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit. Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex. Carbon monoxide dehydrogenase is a synonym. The ACDS complex carries out an unusual reaction involving the reversible cleavage and synthesis of acetyl-CoA in methanogens. The model contains the prosite signature for 4Fe-4S ferredoxins [C-x(2)-C-x(2)-C-x(3)-C-[PEG]] between residues 448-462 of the model.
Probab=29.74  E-value=22  Score=32.09  Aligned_cols=17  Identities=18%  Similarity=0.173  Sum_probs=14.9

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      ..|+.||.|+.+||++.
T Consensus       399 ~kCI~CG~Cv~aCP~~l  415 (784)
T TIGR00314       399 NKCTQCGNCVRTCPNSL  415 (784)
T ss_pred             ccCCCcccchhhCCCCc
Confidence            46899999999999983


No 256
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=29.50  E-value=63  Score=16.62  Aligned_cols=12  Identities=33%  Similarity=0.947  Sum_probs=8.5

Q ss_pred             ccccCCCCCCCC
Q psy3842         102 HPLDCPICDQGG  113 (139)
Q Consensus       102 ~~~~C~~C~~g~  113 (139)
                      .+..||.|+.+.
T Consensus        16 ~~~~CP~Cg~~~   27 (33)
T cd00350          16 APWVCPVCGAPK   27 (33)
T ss_pred             CCCcCcCCCCcH
Confidence            566799888643


No 257
>PF09824 ArsR:  ArsR transcriptional regulator;  InterPro: IPR014517 Members of this family of archaeal proteins are conserved transcriptional regulators belonging to the ArsR family.
Probab=27.45  E-value=1.3e+02  Score=21.83  Aligned_cols=42  Identities=19%  Similarity=0.183  Sum_probs=32.7

Q ss_pred             CEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCccc
Q psy3842           4 WRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRF   57 (139)
Q Consensus         4 m~V~T~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~r~   57 (139)
                      |.+.++.+++++.-..+.+++            ++|+..+.+++..+|+.+..+
T Consensus        97 ~i~f~~deel~~~~e~i~~~v------------~~Gn~Sl~~lsr~l~~sp~fi  138 (160)
T PF09824_consen   97 YIAFMSDEELRDYVEKIEKEV------------EAGNTSLSDLSRKLGISPVFI  138 (160)
T ss_pred             heeecCHHHHHHHHHHHHHHH------------HcCCCcHHHHHHHhCCCHHHH
Confidence            355677788888888888877            346788999999999987543


No 258
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated
Probab=26.71  E-value=29  Score=31.33  Aligned_cols=17  Identities=12%  Similarity=-0.009  Sum_probs=14.8

Q ss_pred             eeecccCceecccCCcc
Q psy3842          75 FLSELSGKRESTCAPAR   91 (139)
Q Consensus        75 ~~~~~~g~~~~~CPtga   91 (139)
                      ..|..||.|+.+||++.
T Consensus       404 drCI~CG~Cv~aCP~~l  420 (781)
T PRK00941        404 KKCTECGWCVRVCPNEL  420 (781)
T ss_pred             hhCcCCCCccccCCCCc
Confidence            36889999999999974


No 259
>COG1141 Fer Ferredoxin [Energy production and conversion]
Probab=26.57  E-value=24  Score=21.80  Aligned_cols=15  Identities=7%  Similarity=-0.124  Sum_probs=12.7

Q ss_pred             eecccCceecccCCc
Q psy3842          76 LSELSGKRESTCAPA   90 (139)
Q Consensus        76 ~~~~~g~~~~~CPtg   90 (139)
                      .|..||.|..+||..
T Consensus         9 ~Cigcg~C~~~aPdv   23 (68)
T COG1141           9 TCIGCGACLAVAPDV   23 (68)
T ss_pred             hccccchhhhcCCcc
Confidence            588999999999874


No 260
>PF13370 Fer4_13:  4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A ....
Probab=25.71  E-value=16  Score=21.46  Aligned_cols=15  Identities=7%  Similarity=-0.192  Sum_probs=9.0

Q ss_pred             eecccCceecccCCc
Q psy3842          76 LSELSGKRESTCAPA   90 (139)
Q Consensus        76 ~~~~~g~~~~~CPtg   90 (139)
                      .|..||.|+.++|.-
T Consensus         5 ~Ci~Cg~C~~~aP~v   19 (58)
T PF13370_consen    5 KCIGCGLCVEIAPDV   19 (58)
T ss_dssp             T--S-SHHHHH-TTT
T ss_pred             hCcCCChHHHhCcHh
Confidence            478899999988864


No 261
>KOG0917|consensus
Probab=25.57  E-value=51  Score=26.20  Aligned_cols=23  Identities=22%  Similarity=0.474  Sum_probs=20.2

Q ss_pred             CCCEEEcCCHHHHHHHHHHHHHH
Q psy3842           2 KGWRVKTNSEMTRRAREGVMEFL   24 (139)
Q Consensus         2 ~Gm~V~T~s~~v~~~r~~~lell   24 (139)
                      -||+|-+.|++.++.=-.+|.+|
T Consensus        39 ~gmKid~qT~e~rk~lsgLm~~l   61 (338)
T KOG0917|consen   39 TGMKIDSQTPECRKFLSGLMDQL   61 (338)
T ss_pred             hcccCCccCHHHHHHHHHHHHHH
Confidence            59999999999999888888776


No 262
>KOG0723|consensus
Probab=25.22  E-value=1e+02  Score=20.97  Aligned_cols=32  Identities=28%  Similarity=0.385  Sum_probs=23.7

Q ss_pred             CCHHHHHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHH
Q psy3842           9 NSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQ   46 (139)
Q Consensus         9 ~s~~v~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l   46 (139)
                      .|-.-.+.|..-...+++|||.      +.|.-+|+.-
T Consensus        66 ~s~~k~KikeaHrriM~~NHPD------~GGSPYlAsK   97 (112)
T KOG0723|consen   66 PSLDKDKIKEAHRRIMLANHPD------RGGSPYLASK   97 (112)
T ss_pred             ccccHHHHHHHHHHHHHcCCCc------CCCCHHHHHH
Confidence            4445566777778889999995      6788888753


No 263
>PF08279 HTH_11:  HTH domain;  InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets. The winged helix motif consists of two wings (W1, W2), three alpha helices (H1, H2, H3) and three beta-sheets (S1, S2, S3) arranged in the order H1-S1-H2-H3-S2-W1-S3-W2 []. The DNA-recognition helix makes sequence-specific DNA contacts with the major groove of DNA, while the wings make different DNA contacts, often with the minor groove or the backbone of DNA. Several winged-helix proteins display an exposed patch of hydrophobic residues thought to mediate protein-protein interactions. This entry represents a subset of the winged helix domain superfamily which is predominantly found in bacterial proteins, though there are also some archaeal and eukaryotic examples. This domain is commonly found in the biotin (vitamin H) repressor protein BirA which regulates transcription of the biotin operon []. It is also found in other proteins including regulators of amino acid biosynthsis such as LysM [], and regulators of carbohydrate metabolisms such as LicR and FrvR [, ].; PDB: 1HXD_B 2EWN_B 1BIA_A 1BIB_A 1J5Y_A 3V7S_A 3V7C_A 3RKW_A 3RIR_A 3RKX_A ....
Probab=25.02  E-value=1.2e+02  Score=16.91  Aligned_cols=28  Identities=14%  Similarity=0.332  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCC
Q psy3842          17 REGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDR   54 (139)
Q Consensus        17 r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~   54 (139)
                      ++.++++|+.+++.          -..++++..+|+++
T Consensus         2 ~~~il~~L~~~~~~----------it~~eLa~~l~vS~   29 (55)
T PF08279_consen    2 QKQILKLLLESKEP----------ITAKELAEELGVSR   29 (55)
T ss_dssp             HHHHHHHHHHTTTS----------BEHHHHHHHCTS-H
T ss_pred             HHHHHHHHHHcCCC----------cCHHHHHHHhCCCH
Confidence            45688888777652          46789999999865


No 264
>PF07381 DUF1495:  Winged helix DNA-binding domain (DUF1495);  InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length. The function of this family is unknown, although one sequence (Q8U3W1 from SWISSPROT) is described as a putative HTH transcription regulator.
Probab=24.89  E-value=1.3e+02  Score=19.60  Aligned_cols=32  Identities=28%  Similarity=0.358  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCc
Q psy3842          15 RAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRS   55 (139)
Q Consensus        15 ~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~   55 (139)
                      +.|+.+|.+|.+.+|.         .=.+++++...|++.+
T Consensus         9 ~~R~~vl~~L~~~yp~---------~~~~~eIar~v~~~~s   40 (90)
T PF07381_consen    9 KVRKKVLEYLCSIYPE---------PAYPSEIARSVGSDYS   40 (90)
T ss_pred             HHHHHHHHHHHHcCCC---------cCCHHHHHHHHCCCHH
Confidence            6799999999999885         3478888888887654


No 265
>PRK10645 divalent-cation tolerance protein CutA; Provisional
Probab=24.06  E-value=1e+02  Score=20.87  Aligned_cols=26  Identities=27%  Similarity=0.446  Sum_probs=19.1

Q ss_pred             CEEEcCCHHHHHHHHHHHHHHHHhCCCCCC
Q psy3842           4 WRVKTNSEMTRRAREGVMEFLLVNHPLDCP   33 (139)
Q Consensus         4 m~V~T~s~~v~~~r~~~lelll~~h~~~C~   33 (139)
                      +.++|..++..+    +.+.|...||-+.|
T Consensus        64 l~iKT~~~~~~~----l~~~I~~~HpYevP   89 (112)
T PRK10645         64 MLLKTTVSHQQA----LLECLKSHHPYQTP   89 (112)
T ss_pred             EEEEeCHHHHHH----HHHHHHHhCCCCCC
Confidence            456777666655    66777888999887


No 266
>PF15174 PRNT:  Prion-related protein testis-specific
Probab=23.68  E-value=1.1e+02  Score=17.39  Aligned_cols=25  Identities=24%  Similarity=0.514  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHhCCCCCCCcCC
Q psy3842          13 TRRAREGVMEFLLVNHPLDCPICDQ   37 (139)
Q Consensus        13 v~~~r~~~lelll~~h~~~C~~C~~   37 (139)
                      ..++--.+..|..-.-|.||..|++
T Consensus        20 TlKAvavthSLW~LqiPvDcQACnR   44 (51)
T PF15174_consen   20 TLKAVAVTHSLWHLQIPVDCQACNR   44 (51)
T ss_pred             HHHHHHHHHHHHhhcCCcchhhhcc
Confidence            4455666778888889999999986


No 267
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=23.13  E-value=48  Score=18.33  Aligned_cols=9  Identities=33%  Similarity=1.043  Sum_probs=6.6

Q ss_pred             cccCCCCCC
Q psy3842         103 PLDCPICDQ  111 (139)
Q Consensus       103 ~~~C~~C~~  111 (139)
                      ...|++|+.
T Consensus        21 ~~~Cp~CG~   29 (46)
T PRK00398         21 GVRCPYCGY   29 (46)
T ss_pred             ceECCCCCC
Confidence            567888873


No 268
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=22.76  E-value=55  Score=22.05  Aligned_cols=19  Identities=26%  Similarity=0.495  Sum_probs=13.6

Q ss_pred             eeccccccCCCCCCCCcch
Q psy3842          98 LLVNHPLDCPICDQGGECD  116 (139)
Q Consensus        98 ~l~~~~~~C~~C~~g~~~e  116 (139)
                      -|...|.+||+|+.--..+
T Consensus        21 DLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   21 DLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCCccCCCCCCccCcc
Confidence            3556888999999755444


No 269
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=22.72  E-value=77  Score=15.45  Aligned_cols=6  Identities=50%  Similarity=1.508  Sum_probs=3.2

Q ss_pred             cCCCCC
Q psy3842         105 DCPICD  110 (139)
Q Consensus       105 ~C~~C~  110 (139)
                      .||.|+
T Consensus        18 ~CPnCG   23 (24)
T PF07754_consen   18 PCPNCG   23 (24)
T ss_pred             eCCCCC
Confidence            455554


No 270
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]
Probab=22.36  E-value=36  Score=28.36  Aligned_cols=21  Identities=19%  Similarity=0.137  Sum_probs=16.2

Q ss_pred             eeccc--CceecccCCcccccce
Q psy3842          76 LSELS--GKRESTCAPAREGVME   96 (139)
Q Consensus        76 ~~~~~--g~~~~~CPtgal~~~e   96 (139)
                      .|+.|  ..|++.||.||+.-++
T Consensus       182 iCeHCLNPsCvasCPsgaiYKRe  204 (513)
T COG1140         182 LCEHCLNPSCVASCPSGAIYKRE  204 (513)
T ss_pred             HHhhcCCcHHhhcCCcccccccc
Confidence            56665  5899999999986443


No 271
>PF12404 DUF3663:  Peptidase ;  InterPro: IPR008330 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This family represents the peptidase B group of leucyl aminopeptidases, which are restricted to the gammaproteobacteria. They contain a C-terminal aminopeptidase catalytic domain and an N-terminal domain of unknown function. They are zinc-dependent exopeptidases (3.4.11.1 from EC) and belong to MEROPS peptidase family M17 (leucyl aminopeptidase family, clan MF). They selectively release N-terminal amino acid residues from polypeptides and proteins and are involved in the processing, catabolism and degradation of intracellular proteins [, , ]. Leucyl aminopeptidase forms a homohexamer containing two trimers stacked on top of one another []. Each monomer binds two zinc ions. The zinc-binding and catalytic sites are located within the C-terminal catalytic domain []. The same catalytic aminopeptidase domain is found in the other M17 peptidases IPR011356 from INTERPRO. These two groups of aminopeptidases differ by their N-terminal domains. The N-terminal domain in members of IPR011356 from INTERPRO has been implicated in DNA binding [, ] and it is not associated with members of this family which have a different N-terminal domain and therefore are not expected to bind DNA or be involved in transcriptional regulation. In addition, there are related proteins with the same catalytic domain and unique N-terminal sequences unrelated to any of the two N-terminal domains discussed above. For additional information please see [, , , ]. ; GO: 0004177 aminopeptidase activity, 0008235 metalloexopeptidase activity, 0030145 manganese ion binding, 0005737 cytoplasm
Probab=22.18  E-value=1.1e+02  Score=19.39  Aligned_cols=23  Identities=9%  Similarity=0.212  Sum_probs=17.0

Q ss_pred             CCCCEEE-cCCHHHHHHHHHHHHH
Q psy3842           1 MKGWRVK-TNSEMTRRAREGVMEF   23 (139)
Q Consensus         1 ~~Gm~V~-T~s~~v~~~r~~~lel   23 (139)
                      ++||.|+ +..+.++.++|..-+|
T Consensus        24 ~~ga~IHl~~~~~l~~IQrAaRkL   47 (77)
T PF12404_consen   24 EQGATIHLSEGDDLRAIQRAARKL   47 (77)
T ss_pred             CCCEEEEECCCcchHHHHHHHHHH
Confidence            4688887 5667788887777665


No 272
>PRK15360 pathogenicity island 2 effector protein SseE; Provisional
Probab=22.18  E-value=1.3e+02  Score=21.23  Aligned_cols=26  Identities=19%  Similarity=0.189  Sum_probs=20.1

Q ss_pred             CEEEcC--CHHHHHHHHHHHHHHHHhCC
Q psy3842           4 WRVKTN--SEMTRRAREGVMEFLLVNHP   29 (139)
Q Consensus         4 m~V~T~--s~~v~~~r~~~lelll~~h~   29 (139)
                      |.|.||  .|.++..|+.+++.|++...
T Consensus        87 mlii~~~~~~~l~~~R~rL~~vL~a~GA  114 (137)
T PRK15360         87 MLIITDVLDEKKAMLRRKLLRILTVMGA  114 (137)
T ss_pred             heeeccccCHHHHHHHHHHHHHHHHcCC
Confidence            445554  69999999999999988654


No 273
>PF12801 Fer4_5:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=21.68  E-value=21  Score=19.78  Aligned_cols=12  Identities=8%  Similarity=-0.147  Sum_probs=9.1

Q ss_pred             eecccCCccccc
Q psy3842          83 RESTCAPAREGV   94 (139)
Q Consensus        83 ~~~~CPtgal~~   94 (139)
                      |..+||.|++..
T Consensus        24 C~~~CP~g~~~~   35 (48)
T PF12801_consen   24 CGWLCPFGALQE   35 (48)
T ss_pred             HhccCCchHHHH
Confidence            667899998754


No 274
>COG0348 NapH Polyferredoxin [Energy production and conversion]
Probab=21.44  E-value=28  Score=28.58  Aligned_cols=17  Identities=12%  Similarity=0.032  Sum_probs=15.1

Q ss_pred             eecccCceecccCCccc
Q psy3842          76 LSELSGKRESTCAPARE   92 (139)
Q Consensus        76 ~~~~~g~~~~~CPtgal   92 (139)
                      +|..|++|+++||-..+
T Consensus       246 ~CI~C~~CidaCd~~~~  262 (386)
T COG0348         246 ECIGCGRCIDACDDDML  262 (386)
T ss_pred             ccccHhhHhhhCCHHhh
Confidence            58999999999998775


No 275
>COG3373 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.20  E-value=1.9e+02  Score=19.07  Aligned_cols=33  Identities=27%  Similarity=0.282  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHhCCCCCCCcCCCCcchhHHHHHHhCCCCc
Q psy3842          14 RRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRS   55 (139)
Q Consensus        14 ~~~r~~~lelll~~h~~~C~~C~~~g~C~Lq~l~~~~g~~~~   55 (139)
                      -+.||.+|.+|.+-.|..         -+|.+++...+.+++
T Consensus        16 SeLRrkiL~yLy~iYP~~---------~YLSEIsR~V~SDPS   48 (108)
T COG3373          16 SELRRKILFYLYSIYPYR---------SYLSEISRAVKSDPS   48 (108)
T ss_pred             HHHHHHHHHHHHHHccch---------hHHHHHHHHHcCCch
Confidence            467999999999999973         589999888877664


No 276
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=20.00  E-value=1.1e+02  Score=17.17  Aligned_cols=23  Identities=26%  Similarity=0.260  Sum_probs=12.1

Q ss_pred             CCHHHHHHHHHHHHHHHHhCCCCCCCc
Q psy3842           9 NSEMTRRAREGVMEFLLVNHPLDCPIC   35 (139)
Q Consensus         9 ~s~~v~~~r~~~lelll~~h~~~C~~C   35 (139)
                      +|++.++.|+....-    ....|..|
T Consensus        41 ~s~~~~~~r~~~~~~----~~~~C~~C   63 (64)
T PF13186_consen   41 NSPKFREFRKRHKKN----NFEPCKNC   63 (64)
T ss_pred             CCHHHHHHHHHHhCC----CCCcCCCC
Confidence            556666655554433    34456555


Done!